Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO013F5_2|g59.t1
Gene name
Locationscaffold_001:164741..167035
Strand-
Gene length (bp)2294
Transcript length (bp)1542
Coding sequence length (bp)1542
Protein length (aa) 514

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00098 zf-CCHC Zinc knuckle 1.5E-06 67 84
PF00098 zf-CCHC Zinc knuckle 9.6E-05 90 106
PF00098 zf-CCHC Zinc knuckle 4.1E-06 112 128
PF00098 zf-CCHC Zinc knuckle 1.3E-04 304 320
PF00098 zf-CCHC Zinc knuckle 1.6E-03 331 348
PF00098 zf-CCHC Zinc knuckle 2.8E-05 355 371
PF00098 zf-CCHC Zinc knuckle 1.9E-06 379 394
PF00098 zf-CCHC Zinc knuckle 1.9E-06 402 419
PF00098 zf-CCHC Zinc knuckle 8.7E-06 427 443
PF14392 zf-CCHC_4 Zinc knuckle 8.0E-02 67 83
PF14392 zf-CCHC_4 Zinc knuckle 3.2E-01 89 105
PF14392 zf-CCHC_4 Zinc knuckle 6.4E-02 111 128
PF14392 zf-CCHC_4 Zinc knuckle 1.8E-01 298 319
PF14392 zf-CCHC_4 Zinc knuckle 8.3E+00 328 347
PF14392 zf-CCHC_4 Zinc knuckle 3.3E+00 452 466

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0008270 zinc ion binding Yes
GO:0005488 binding No
GO:0046914 transition metal ion binding No
GO:0046872 metal ion binding No
GO:0043167 ion binding No
GO:1901363 heterocyclic compound binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Zinc finger, CCHC-type

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID2
Orthogroup7054
Change Orthofinder run
Species Protein ID
Penicillium roqueforti DTO002I6 Pro_DTO002I6_2|g7762.t1
Penicillium roqueforti DTO003C3 Pro_DTO003C3_2|g1568.t1
Penicillium roqueforti DTO003H1 (CBS 147308) Pro_DTO003H1_2|g9291.t1
Penicillium roqueforti DTO006G1 Pro_DTO006G1_2|g6878.t1
Penicillium roqueforti DTO006G7 Pro_DTO006G7_3|g2617.t1
Penicillium roqueforti DTO012A1 Pro_DTO012A1_2|g8021.t1
Penicillium roqueforti DTO012A2 (CBS 147309) Pro_DTO012A2_2|g7488.t1
Penicillium roqueforti DTO012A6 (CBS 147310) Pro_DTO012A6_2|g6174.t1
Penicillium roqueforti DTO012A7 Pro_DTO012A7_2|g9232.t1
Penicillium roqueforti DTO012A8 Pro_DTO012A8_2|g4067.t1
Penicillium roqueforti DTO012A9 Pro_DTO012A9_2|g4475.t1
Penicillium roqueforti DTO013E5 Pro_DTO013E5_2|g7210.t1
Penicillium roqueforti DTO013F2 Pro_DTO013F2_2|g4966.t1
Penicillium roqueforti DTO013F5 (CBS 147311) Pro_DTO013F5_2|g59.t1 (this protein)
Penicillium roqueforti DTO027I6 Pro_DTO027I6_2|g158.t1
Penicillium roqueforti DTO032C6 Pro_DTO032C6_2|g4148.t1
Penicillium roqueforti DTO039G3 Pro_DTO039G3_2|g9477.t1
Penicillium roqueforti DTO046C5 Pro_DTO046C5_2|g4145.t1
Penicillium roqueforti DTO070G2 (CBS 147317) Pro_DTO070G2_2|g6522.t1
Penicillium roqueforti DTO081F9 (CBS 147318) Pro_DTO081F9_2|g4973.t1
Penicillium roqueforti DTO101D6 (CBS 147325) Pro_DTO101D6_2|g3840.t1
Penicillium roqueforti DTO102I9 (CBS 147326) Pro_DTO102I9_2|g7397.t1
Penicillium roqueforti DTO126G2 (CBS 147330) Pro_DTO126G2_2|g3105.t1
Penicillium roqueforti DTO127F7 (CBS 147331) Pro_DTO127F7_2|g6283.t1
Penicillium roqueforti DTO127F9 (CBS 147332) Pro_DTO127F9_2|g2190.t1
Penicillium roqueforti DTO130C1 (CBS 147333) Pro_DTO130C1_2|g5427.t1
Penicillium roqueforti DTO163C3 (CBS 147337) Pro_DTO163C3_2|g6976.t1
Penicillium roqueforti DTO163F5 (CBS 147338) Pro_DTO163F5_2|g4013.t1
Penicillium roqueforti DTO163G4 (CBS 147339) Pro_DTO163G4_2|g2279.t1
Penicillium roqueforti DTO265D5 (CBS 147372) Pro_DTO265D5_2|g6352.t1
Penicillium roqueforti DTO369A1 (CBS 147354) Pro_DTO369A1_2|g5231.t1
Penicillium roqueforti DTO375B1 (CBS 147355) Pro_DTO375B1_2|g8912.t1
Penicillium roqueforti DTO377G2 (LCP 96.3914a) Pro_DTO377G2_2|g9153.t1
Penicillium roqueforti LCP96 04111 Pro_DTO377G3_2|g7620.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO013F5_2|g59.t1
METNIHEDRNEDFTCGQCGGSGHMTRQCPNASLPLRQRDSNAGDAYGNYGNDNGGGHGDYSGGGGDRACYNCGQE
GHSKADCTEPRKMGACFNCGQDGHSKAECTEPRKMGACFNCGEEGHSKSECPKPRVFRGTCRICEKEGHPAVDCP
ERPPDVCKNCQAQGHKTMECKENRKFDLNLVADMLPQEGWAAMKKASDERDLDDFREALKIYSKAVPNATWADIE
KKMREDNFNIYIIAMEAEVDDVMSLIDLQGVLDREYVIGFFFNPKASRGHLRDRWPADAEENLERMKSAGIPYER
KVPKCLNCGELGHISRSCKEERAEGNDRVEIKCSNCEGAGHRVRDCRQQRKHKHGCRNCGSIEHIASDCTEPRSA
AGVECRRCNETGHFAKDCPTVADRGPRTCRNCGSEDHIARDCDQPRDVSTVTCRNCEKTGHYSRDCDQPKDWSKV
QCKNCGEMGHTVVRCRQPPKEEEPQDEPTFSPGSPKREEPDPLNSEATDQQFEYKRHDDEDLW*
Coding >Pro_DTO013F5_2|g59.t1
ATGGAGACAAATATCCATGAAGACCGGAATGAAGATTTTACCTGCGGACAATGCGGTGGATCTGGCCATATGACT
CGTCAGTGCCCGAATGCCTCTCTTCCTCTGAGACAGAGAGACAGCAATGCAGGTGATGCCTATGGCAACTACGGC
AACGACAATGGTGGAGGACATGGTGATTACTCCGGTGGTGGCGGTGACCGCGCTTGCTACAACTGCGGCCAAGAA
GGCCATAGCAAAGCCGACTGTACCGAGCCTCGCAAGATGGGGGCATGCTTCAACTGTGGCCAGGACGGTCACTCC
AAGGCCGAATGCACCGAGCCTCGCAAGATGGGCGCTTGCTTCAACTGTGGCGAAGAAGGTCACTCCAAGTCCGAA
TGTCCTAAGCCTCGCGTGTTCAGGGGTACCTGCCGTATCTGCGAAAAGGAAGGCCACCCAGCGGTTGATTGTCCT
GAGAGACCCCCCGATGTTTGCAAGAACTGCCAGGCCCAAGGCCACAAGACGATGGAGTGCAAGGAGAATCGCAAG
TTCGATCTCAACCTTGTTGCTGACATGCTACCCCAAGAAGGTTGGGCTGCAATGAAGAAAGCCAGTGACGAAAGG
GATCTTGATGATTTCCGAGAGGCACTTAAAATCTACTCCAAGGCAGTCCCCAATGCCACCTGGGCAGACATTGAG
AAGAAGATGCGAGAGGATAATTTCAACATCTACATCATTGCTATGGAGGCTGAAGTTGACGATGTCATGAGCCTT
ATCGATCTTCAGGGAGTACTTGACCGTGAGTACGTGATTGGATTCTTTTTCAACCCCAAGGCGTCGCGTGGCCAC
CTCCGAGATCGTTGGCCTGCAGATGCCGAGGAGAACCTAGAGCGCATGAAGAGCGCCGGTATTCCCTACGAGCGC
AAGGTGCCTAAGTGCCTGAACTGTGGAGAGTTGGGACATATCTCCCGCAGTTGCAAGGAGGAGCGCGCCGAGGGC
AATGATCGTGTGGAAATCAAGTGCTCAAACTGTGAGGGAGCTGGACACCGCGTACGCGATTGCAGACAGCAGCGC
AAGCACAAGCATGGTTGCCGTAACTGCGGATCTATTGAGCATATTGCTTCTGACTGCACCGAGCCCCGATCTGCG
GCTGGTGTTGAATGCCGGAGATGCAACGAAACTGGCCACTTTGCCAAAGATTGCCCCACTGTTGCTGACCGTGGC
CCTCGCACCTGCCGCAATTGCGGATCCGAAGACCACATCGCTCGCGATTGTGATCAACCTCGTGACGTTTCCACT
GTTACCTGCCGCAACTGCGAAAAGACCGGACATTACTCTCGTGATTGTGATCAGCCGAAAGATTGGTCGAAGGTT
CAGTGCAAGAACTGCGGAGAAATGGGTCACACTGTTGTCCGTTGCCGCCAGCCGCCTAAGGAGGAAGAGCCTCAA
GACGAACCTACTTTCTCCCCCGGCTCTCCCAAGCGCGAGGAACCTGATCCGCTGAACTCAGAGGCTACTGACCAA
CAGTTTGAATACAAGCGCCATGACGACGAGGACCTCTGGTAA
Transcript >Pro_DTO013F5_2|g59.t1
ATGGAGACAAATATCCATGAAGACCGGAATGAAGATTTTACCTGCGGACAATGCGGTGGATCTGGCCATATGACT
CGTCAGTGCCCGAATGCCTCTCTTCCTCTGAGACAGAGAGACAGCAATGCAGGTGATGCCTATGGCAACTACGGC
AACGACAATGGTGGAGGACATGGTGATTACTCCGGTGGTGGCGGTGACCGCGCTTGCTACAACTGCGGCCAAGAA
GGCCATAGCAAAGCCGACTGTACCGAGCCTCGCAAGATGGGGGCATGCTTCAACTGTGGCCAGGACGGTCACTCC
AAGGCCGAATGCACCGAGCCTCGCAAGATGGGCGCTTGCTTCAACTGTGGCGAAGAAGGTCACTCCAAGTCCGAA
TGTCCTAAGCCTCGCGTGTTCAGGGGTACCTGCCGTATCTGCGAAAAGGAAGGCCACCCAGCGGTTGATTGTCCT
GAGAGACCCCCCGATGTTTGCAAGAACTGCCAGGCCCAAGGCCACAAGACGATGGAGTGCAAGGAGAATCGCAAG
TTCGATCTCAACCTTGTTGCTGACATGCTACCCCAAGAAGGTTGGGCTGCAATGAAGAAAGCCAGTGACGAAAGG
GATCTTGATGATTTCCGAGAGGCACTTAAAATCTACTCCAAGGCAGTCCCCAATGCCACCTGGGCAGACATTGAG
AAGAAGATGCGAGAGGATAATTTCAACATCTACATCATTGCTATGGAGGCTGAAGTTGACGATGTCATGAGCCTT
ATCGATCTTCAGGGAGTACTTGACCGTGAGTACGTGATTGGATTCTTTTTCAACCCCAAGGCGTCGCGTGGCCAC
CTCCGAGATCGTTGGCCTGCAGATGCCGAGGAGAACCTAGAGCGCATGAAGAGCGCCGGTATTCCCTACGAGCGC
AAGGTGCCTAAGTGCCTGAACTGTGGAGAGTTGGGACATATCTCCCGCAGTTGCAAGGAGGAGCGCGCCGAGGGC
AATGATCGTGTGGAAATCAAGTGCTCAAACTGTGAGGGAGCTGGACACCGCGTACGCGATTGCAGACAGCAGCGC
AAGCACAAGCATGGTTGCCGTAACTGCGGATCTATTGAGCATATTGCTTCTGACTGCACCGAGCCCCGATCTGCG
GCTGGTGTTGAATGCCGGAGATGCAACGAAACTGGCCACTTTGCCAAAGATTGCCCCACTGTTGCTGACCGTGGC
CCTCGCACCTGCCGCAATTGCGGATCCGAAGACCACATCGCTCGCGATTGTGATCAACCTCGTGACGTTTCCACT
GTTACCTGCCGCAACTGCGAAAAGACCGGACATTACTCTCGTGATTGTGATCAGCCGAAAGATTGGTCGAAGGTT
CAGTGCAAGAACTGCGGAGAAATGGGTCACACTGTTGTCCGTTGCCGCCAGCCGCCTAAGGAGGAAGAGCCTCAA
GACGAACCTACTTTCTCCCCCGGCTCTCCCAAGCGCGAGGAACCTGATCCGCTGAACTCAGAGGCTACTGACCAA
CAGTTTGAATACAAGCGCCATGACGACGAGGACCTCTGGTAA
Gene >Pro_DTO013F5_2|g59.t1
ATGGAGACAAATATCCATGAAGACCGGAATGAAGATTTTACCTGCGGACAGTGAGTTCTCCCCTCCAAAATTCTA
GCTTTCAAGGCTTAGGATATCCCCCCGAGAAAATCAGTCACTTAAAATTCTAGATGCGGTGGATCTGGCCATATG
ACTCGTCAGTGCCCGAATGCCTCTCTTCCTCTGAGACAGAGAGACAGCAATGCAGGGTAAGTTGGTCCTACACTT
TCCATGTCACATTCTGCCAGTCCATCTAACCAATGCTAAAATATAGTGATGCCTATGGCAACTACGGCAACGACA
ATGGTGGAGGACATGGTGATTACTCCGGTGGTGGCGGTGACCGCGCTTGCTACAACTGCGGCCAAGAAGGGTAAG
TCGTTGATATCTGTGTACTTGCCAAATTTTACTGACAACAATGCAGCCATAGCAAAGCCGACTGTACCGAGCCTC
GCAAGATGGGGGCATGCTTCAACTGTGGCCAGGACGGGTGAGTTATTATTGAACATCTTGTGTATTACGGCGTTA
ATTATTCTCTTGAAACAGTCACTCCAAGGCCGAATGCACCGAGCCTCGCAAGATGGGCGCTTGCTTCAACTGTGG
CGAAGAAGGGTGAGTAACTGCTGGGCGTTTTATACTTTAGTTTGCTAATTGGCTCCAAATACAGTCACTCCAAGT
CCGAATGTCCTAAGCCTCGCGTGTTCAGGGGTACCTGCCGTATCTGCGAAAAGGAAGGCCACCCAGCGGTTGATT
GTCCTGAGAGACCCCCCGATGTTTGCAAGAACTGCCAGGCCCAAGGCCACAAGACGATGGAGTGCAAGGAGAATC
GCAAGTTCGATCTCAACCTTGTTGCTGACATGCTACCCCAAGAAGGTTGGGCTGCAATGAAGAAAGCCAGTGACG
AAAGGGATCTTGATGATTTCCGAGAGGTACCAAAAATCCATACGTACCTTGAAAGTTTCGAACTTTGGCTGACCT
AACTCCAGGCACTTAAAATCTACTCCAAGGCAGTCCCCAATGCCACCTGGGCAGACATTGAGAAGAAGATGCGAG
AGGATAATTTCAACATCTACATCATTGCTATGGTAATCAATCATCATCGTTCTGATACTTGGGGATGAATCGCTA
ATGAATGAATTTTAATTATAGGAGGCTGAAGTTGACGATGTCATGAGCCTTATCGATCTTCAGGGAGTACTTGAC
CGTGAGTACGTGATTGGATTCTTTTTCAACCCCAAGGCGTCGCGTGGCCACCTCCGAGATCGTTGGCCTGCAGAT
GCCGAGGAGAACCTAGAGCGCATGAAGAGCGCCGGTATTCCCTACGAGCGCAAGGTGCCTAAGTGCCTGAACTGT
GGAGGTAAGTGTTTACTTTGAAGATTCCTTATAATATTGCTAAATTCTGTTTAGAGTTGGGACATATCTCCCGCA
GTTGCAAGGAGGAGCGCGCCGAGGGCAATGATCGTGTGGAAATCAAGTGCTCAAACTGTGAGGGAGCTGGACACC
GCGTACGCGATTGCAGACAGCAGCGCAAGCACAAGCATGGTTGCCGTAACTGCGGGTATGTGGCTGTGGTGCAAA
CAACGAACTGGATAATGCTGACTTTTATGAAGATCTATTGAGCATATTGCTTCTGACTGCACCGAGCCCCGATCT
GCGGCTGGTGTTGAATGCCGGAGATGCAACGAAAGTAAGACCTTGCCCAAGATGATTCAAATATTTCATGATGCT
AATGTATCTATTTCAGCTGGCCACTTTGCCAAAGATTGCCCCACTGTTGCTGACCGTGGCCCTCGCACCTGCCGC
AATTGCGGGTATGTTAAAATATCATAGCCCCTGCGATTGTCGCTGATTCTAACATCAATACAGATCCGAAGACCA
CATCGCTCGCGATTGTGATCAACCTCGTGACGTTTCCACTGTTACCTGCCGCAACTGCGAAAAGAGTAAGTGCGA
TGCATGCCCCAAAGATTCTTGGAAACACAACTGACAACTGCTATTTTAGCCGGACATTACTCTCGTGATTGTGAT
CAGCCGAAAGATTGGTCGAAGGTTCAGTGCAAGAACTGCGGAGAAAGTGAGTTGATACATGCGTTTTTAATACTG
AGTTAGTCCGCTAACAATCCTTAGTGGGTCACACTGTTGTCCGTTGCCGCCAGCCGCCTAAGGAGGAAGAGCCTC
AAGACGAACCTACTTTCTCCCCCGGCTCTCCCAAGCGCGAGGAACCTGATCCGCTGAACTCAGAGGCTACTGACC
AACAGTTTGAATACAAGCGCCATGACGACGAGGACCTCTGGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail