Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO012A6_2|g2437.t1
Gene name
Locationscaffold_05:8699..11340
Strand-
Gene length (bp)2641
Transcript length (bp)2583
Coding sequence length (bp)2583
Protein length (aa) 861

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00320 GATA GATA zinc finger 3.2E-16 660 693
PF08550 DUF1752 Fungal protein of unknown function (DUF1752) 1.6E-12 84 111
PF07573 AreA_N Nitrogen regulatory protein AreA N terminus 1.3E-10 22 73

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0043565 sequence-specific DNA binding Yes
GO:0003677 DNA binding Yes
GO:0005634 nucleus Yes
GO:0042128 nitrate assimilation Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0050789 regulation of biological process No
GO:2001057 reactive nitrogen species metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0044281 small molecule metabolic process No
GO:0043229 intracellular organelle No
GO:0008150 biological_process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0051252 regulation of RNA metabolic process No
GO:0043167 ion binding No
GO:0042126 nitrate metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043226 organelle No
GO:0009889 regulation of biosynthetic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0080090 regulation of primary metabolic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0046914 transition metal ion binding No
GO:2001141 regulation of RNA biosynthetic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0071941 nitrogen cycle metabolic process No
GO:0044237 cellular metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0060255 regulation of macromolecule metabolic process No
GO:0010468 regulation of gene expression No
GO:0005488 binding No
GO:0071704 organic substance metabolic process No
GO:0065007 biological regulation No
GO:0043169 cation binding No
GO:0110165 cellular anatomical entity No
GO:0097159 organic cyclic compound binding No
GO:0046872 metal ion binding No
GO:0009987 cellular process No
GO:0050794 regulation of cellular process No
GO:0031323 regulation of cellular metabolic process No
GO:0006082 organic acid metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0003676 nucleic acid binding No
GO:0043227 membrane-bounded organelle No
GO:0005575 cellular_component No
GO:0019222 regulation of metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
GATA type zinc finger

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID2
Orthogroup4942
Change Orthofinder run
Species Protein ID
Penicillium roqueforti DTO002I6 Pro_DTO002I6_2|g554.t1
Penicillium roqueforti DTO003C3 Pro_DTO003C3_2|g6252.t1
Penicillium roqueforti DTO003H1 (CBS 147308) Pro_DTO003H1_2|g7163.t1
Penicillium roqueforti DTO006G1 Pro_DTO006G1_2|g8271.t1
Penicillium roqueforti DTO006G7 Pro_DTO006G7_3|g3223.t1
Penicillium roqueforti DTO012A1 Pro_DTO012A1_2|g4585.t1
Penicillium roqueforti DTO012A2 (CBS 147309) Pro_DTO012A2_2|g3729.t1
Penicillium roqueforti DTO012A6 (CBS 147310) Pro_DTO012A6_2|g2437.t1 (this protein)
Penicillium roqueforti DTO012A7 Pro_DTO012A7_2|g572.t1
Penicillium roqueforti DTO012A8 Pro_DTO012A8_2|g7266.t1
Penicillium roqueforti DTO012A9 Pro_DTO012A9_2|g2066.t1
Penicillium roqueforti DTO013E5 Pro_DTO013E5_2|g4534.t1
Penicillium roqueforti DTO013F2 Pro_DTO013F2_2|g1834.t1
Penicillium roqueforti DTO013F5 (CBS 147311) Pro_DTO013F5_2|g8977.t1
Penicillium roqueforti DTO027I6 Pro_DTO027I6_2|g2576.t1
Penicillium roqueforti DTO032C6 Pro_DTO032C6_2|g3259.t1
Penicillium roqueforti DTO039G3 Pro_DTO039G3_2|g2197.t1
Penicillium roqueforti DTO046C5 Pro_DTO046C5_2|g2762.t1
Penicillium roqueforti DTO070G2 (CBS 147317) Pro_DTO070G2_2|g8288.t1
Penicillium roqueforti DTO081F9 (CBS 147318) Pro_DTO081F9_2|g3229.t1
Penicillium roqueforti DTO101D6 (CBS 147325) Pro_DTO101D6_2|g2649.t1
Penicillium roqueforti DTO102I9 (CBS 147326) Pro_DTO102I9_2|g3301.t1
Penicillium roqueforti DTO126G2 (CBS 147330) Pro_DTO126G2_2|g3021.t1
Penicillium roqueforti DTO127F7 (CBS 147331) Pro_DTO127F7_2|g4036.t1
Penicillium roqueforti DTO127F9 (CBS 147332) Pro_DTO127F9_2|g4778.t1
Penicillium roqueforti DTO130C1 (CBS 147333) Pro_DTO130C1_2|g6222.t1
Penicillium roqueforti DTO163C3 (CBS 147337) Pro_DTO163C3_2|g4151.t1
Penicillium roqueforti DTO163F5 (CBS 147338) Pro_DTO163F5_2|g9622.t1
Penicillium roqueforti DTO163G4 (CBS 147339) Pro_DTO163G4_2|g3186.t1
Penicillium roqueforti DTO265D5 (CBS 147372) Pro_DTO265D5_2|g5312.t1
Penicillium roqueforti DTO369A1 (CBS 147354) Pro_DTO369A1_2|g6017.t1
Penicillium roqueforti DTO375B1 (CBS 147355) Pro_DTO375B1_2|g5574.t1
Penicillium roqueforti DTO377G2 (LCP 96.3914a) Pro_DTO377G2_2|g2758.t1
Penicillium roqueforti LCP96 04111 Pro_DTO377G3_2|g8771.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO012A6_2|g2437.t1
MDGIHHGGHGRARPSHPMAFPDFDADSHMMSDDFSFDTPFSPSGSSNANDTVLGNSIFPEWTNGASRGDSPDEMQ
RKDPLGAQIWKLYTRTKSQLPNQERMENLTWRMMAMNLKRKEREQQARASETLSPTPSGIAQMRLSDQPSPAGGD
LAHDTTSDPMNLDDFIVPFDSPAEHSSHPIDRHFTATPTGSIPIKSRKDHAMMDSSTAASFPHPPQDQRTNSEFG
YVARRVRKTSVDDRQFFAGLSVPTRKRPAEASPQVPPVSNAMMAQHSELSSALPDYSLDHPPSAYALSGNGTVGP
RRPQHHHTHSNIPYGLDTYGISEDHGLNSAGSYQQNFHFSPSDSPMTAGNPFSSLYAQTPLASSLNSTEFFSPPP
SGYQSTVSTPQPIYEGEQSIFFSDAPSAESHTQRRIPNYIQQRQSNLSASLQPRYMYNMSNGESHSGSAVTGPPT
THVSGFSVPPPQHINPSQVLGHGEFSTTAPSSSMFTFGGDSDNEDDDGNFGEGGGMTMPNDFASLDESGDMSAGL
HWDGGFPGSIHSLPGFNAQHRKHVTIGSTDMIDGPPEWNQGGTLGRAHGSAASVSEVRNQNQDPRRYGKVPRTAS
TPNAAALLRQSLNGSASGPPTNHPSPSTPPESGLSSAVPSRPGSPGGSKNGDPNAGPTTCTNCFTQTTPLWRRNP
EGQPLCNACGLFLKLHGVVRPLSLKTDVIKKRNRSSASTLAVGTSRSSKKSSRKNSIQHAPSTSISSRMNTSESP
PSMNGSSSLGKTGVVPIAAAPPKSGPPAGVVQARAGVQVAPRRQRRLEKAPTGSDPDLEDSPKSAAPPSRSKVVP
LAPAMAPPAAANPANHSIAGGQGASQEWEWLTMSL*
Coding >Pro_DTO012A6_2|g2437.t1
ATGGACGGGATACATCACGGAGGGCACGGGAGAGCCCGGCCTTCCCACCCTATGGCCTTCCCCGACTTCGACGCG
GATTCCCATATGATGTCCGACGACTTCTCTTTCGATACTCCCTTCAGTCCCTCCGGTTCCTCCAATGCCAATGAT
ACCGTCCTCGGCAACTCCATCTTTCCGGAATGGACGAACGGTGCGTCGCGTGGCGACAGCCCTGACGAGATGCAA
AGGAAAGATCCGCTGGGCGCTCAGATCTGGAAACTCTACACCAGGACAAAGTCTCAGTTGCCCAACCAAGAGCGC
ATGGAGAATCTGACATGGCGAATGATGGCCATGAATCTTAAGCGGAAGGAACGGGAACAGCAGGCTCGTGCCTCG
GAAACTTTAAGCCCGACACCGAGCGGCATCGCGCAGATGCGCTTGTCCGACCAACCATCGCCCGCTGGTGGCGAT
CTAGCACACGATACCACTTCGGATCCAATGAATCTAGATGACTTCATCGTTCCCTTTGATTCTCCCGCCGAACAT
TCCTCGCATCCTATTGATCGACACTTCACAGCAACACCCACTGGATCAATTCCTATTAAATCGCGCAAGGACCAT
GCGATGATGGATTCGTCGACCGCTGCCTCATTCCCTCATCCACCCCAGGATCAGCGAACAAATTCCGAGTTTGGA
TACGTCGCCCGTCGGGTCCGCAAAACGAGCGTCGACGACCGGCAGTTCTTTGCCGGTTTGTCTGTTCCGACGCGC
AAGCGCCCTGCCGAGGCCTCGCCTCAGGTTCCCCCGGTATCAAACGCCATGATGGCACAGCACTCGGAACTGTCT
TCTGCACTGCCAGACTACTCGCTCGATCATCCACCTTCTGCCTATGCTCTTTCCGGCAATGGCACGGTGGGTCCG
CGCAGACCTCAACACCATCACACGCACTCTAACATTCCCTACGGGTTGGATACGTATGGCATTAGCGAAGATCAC
GGGCTCAATTCGGCCGGCTCATACCAGCAAAATTTCCATTTTTCGCCGTCAGATTCTCCAATGACTGCAGGAAAT
CCTTTCTCGAGTCTATATGCCCAGACGCCGCTCGCCTCGTCGCTTAACTCAACCGAGTTCTTCTCGCCCCCGCCT
TCTGGCTATCAGTCTACTGTGTCAACCCCGCAACCGATTTATGAAGGGGAGCAATCGATATTCTTTTCTGATGCG
CCCTCCGCTGAATCACACACCCAGCGCCGCATTCCTAATTATATCCAGCAGCGCCAGTCGAACCTGTCTGCATCG
CTGCAGCCACGTTATATGTACAACATGTCCAACGGCGAATCTCACTCAGGGAGTGCAGTTACAGGGCCACCAACC
ACCCACGTGTCTGGATTTTCGGTGCCACCACCGCAGCATATCAACCCATCACAGGTGCTTGGCCATGGCGAATTC
TCTACAACAGCGCCTTCCAGTAGCATGTTTACTTTCGGTGGAGACTCAGACAACGAAGATGACGATGGCAACTTT
GGTGAAGGTGGAGGCATGACTATGCCAAATGACTTTGCCTCTCTGGATGAGTCTGGTGATATGAGCGCCGGTCTT
CATTGGGACGGGGGTTTCCCCGGATCAATACACTCGCTACCAGGCTTCAATGCTCAGCACCGTAAGCACGTTACA
ATAGGATCCACGGACATGATAGATGGCCCACCTGAATGGAACCAGGGAGGCACTCTTGGTCGTGCGCACGGATCC
GCTGCTTCGGTCAGCGAAGTCCGTAACCAAAACCAGGATCCTCGTCGCTACGGAAAGGTTCCCCGCACAGCATCG
ACGCCCAATGCTGCTGCACTACTCCGTCAGAGCTTGAATGGTTCAGCCAGTGGGCCTCCAACAAACCATCCTTCG
CCAAGCACCCCTCCAGAGTCTGGTCTTAGCAGTGCGGTGCCGTCCCGGCCAGGTAGCCCTGGTGGGTCGAAAAAC
GGTGACCCGAACGCGGGACCGACCACCTGCACCAACTGTTTCACCCAGACCACCCCTCTATGGAGACGTAATCCA
GAGGGCCAACCTCTGTGCAATGCATGTGGCCTGTTCCTGAAACTCCATGGCGTTGTCCGACCACTTTCGCTCAAG
ACTGATGTTATCAAGAAGCGGAACCGTAGCAGCGCTAGCACACTTGCTGTCGGCACTTCTCGGTCATCTAAGAAG
TCTTCCCGCAAAAACTCCATCCAGCATGCCCCATCCACATCGATTTCATCCCGCATGAACACTTCTGAGTCGCCA
CCCTCGATGAATGGATCTAGCTCGTTGGGTAAAACCGGTGTTGTCCCAATTGCCGCTGCTCCACCCAAGTCCGGT
CCCCCGGCTGGCGTTGTTCAAGCTCGTGCTGGTGTGCAAGTGGCACCCAGGCGGCAGCGCAGACTCGAAAAAGCA
CCAACTGGATCCGATCCAGATCTAGAGGACAGCCCTAAGTCGGCCGCTCCTCCGAGCCGATCCAAAGTCGTACCA
TTAGCTCCGGCGATGGCACCACCCGCTGCCGCAAACCCAGCGAATCACAGTATCGCGGGTGGGCAGGGTGCGAGT
CAGGAATGGGAGTGGTTGACAATGAGTCTATAG
Transcript >Pro_DTO012A6_2|g2437.t1
ATGGACGGGATACATCACGGAGGGCACGGGAGAGCCCGGCCTTCCCACCCTATGGCCTTCCCCGACTTCGACGCG
GATTCCCATATGATGTCCGACGACTTCTCTTTCGATACTCCCTTCAGTCCCTCCGGTTCCTCCAATGCCAATGAT
ACCGTCCTCGGCAACTCCATCTTTCCGGAATGGACGAACGGTGCGTCGCGTGGCGACAGCCCTGACGAGATGCAA
AGGAAAGATCCGCTGGGCGCTCAGATCTGGAAACTCTACACCAGGACAAAGTCTCAGTTGCCCAACCAAGAGCGC
ATGGAGAATCTGACATGGCGAATGATGGCCATGAATCTTAAGCGGAAGGAACGGGAACAGCAGGCTCGTGCCTCG
GAAACTTTAAGCCCGACACCGAGCGGCATCGCGCAGATGCGCTTGTCCGACCAACCATCGCCCGCTGGTGGCGAT
CTAGCACACGATACCACTTCGGATCCAATGAATCTAGATGACTTCATCGTTCCCTTTGATTCTCCCGCCGAACAT
TCCTCGCATCCTATTGATCGACACTTCACAGCAACACCCACTGGATCAATTCCTATTAAATCGCGCAAGGACCAT
GCGATGATGGATTCGTCGACCGCTGCCTCATTCCCTCATCCACCCCAGGATCAGCGAACAAATTCCGAGTTTGGA
TACGTCGCCCGTCGGGTCCGCAAAACGAGCGTCGACGACCGGCAGTTCTTTGCCGGTTTGTCTGTTCCGACGCGC
AAGCGCCCTGCCGAGGCCTCGCCTCAGGTTCCCCCGGTATCAAACGCCATGATGGCACAGCACTCGGAACTGTCT
TCTGCACTGCCAGACTACTCGCTCGATCATCCACCTTCTGCCTATGCTCTTTCCGGCAATGGCACGGTGGGTCCG
CGCAGACCTCAACACCATCACACGCACTCTAACATTCCCTACGGGTTGGATACGTATGGCATTAGCGAAGATCAC
GGGCTCAATTCGGCCGGCTCATACCAGCAAAATTTCCATTTTTCGCCGTCAGATTCTCCAATGACTGCAGGAAAT
CCTTTCTCGAGTCTATATGCCCAGACGCCGCTCGCCTCGTCGCTTAACTCAACCGAGTTCTTCTCGCCCCCGCCT
TCTGGCTATCAGTCTACTGTGTCAACCCCGCAACCGATTTATGAAGGGGAGCAATCGATATTCTTTTCTGATGCG
CCCTCCGCTGAATCACACACCCAGCGCCGCATTCCTAATTATATCCAGCAGCGCCAGTCGAACCTGTCTGCATCG
CTGCAGCCACGTTATATGTACAACATGTCCAACGGCGAATCTCACTCAGGGAGTGCAGTTACAGGGCCACCAACC
ACCCACGTGTCTGGATTTTCGGTGCCACCACCGCAGCATATCAACCCATCACAGGTGCTTGGCCATGGCGAATTC
TCTACAACAGCGCCTTCCAGTAGCATGTTTACTTTCGGTGGAGACTCAGACAACGAAGATGACGATGGCAACTTT
GGTGAAGGTGGAGGCATGACTATGCCAAATGACTTTGCCTCTCTGGATGAGTCTGGTGATATGAGCGCCGGTCTT
CATTGGGACGGGGGTTTCCCCGGATCAATACACTCGCTACCAGGCTTCAATGCTCAGCACCGTAAGCACGTTACA
ATAGGATCCACGGACATGATAGATGGCCCACCTGAATGGAACCAGGGAGGCACTCTTGGTCGTGCGCACGGATCC
GCTGCTTCGGTCAGCGAAGTCCGTAACCAAAACCAGGATCCTCGTCGCTACGGAAAGGTTCCCCGCACAGCATCG
ACGCCCAATGCTGCTGCACTACTCCGTCAGAGCTTGAATGGTTCAGCCAGTGGGCCTCCAACAAACCATCCTTCG
CCAAGCACCCCTCCAGAGTCTGGTCTTAGCAGTGCGGTGCCGTCCCGGCCAGGTAGCCCTGGTGGGTCGAAAAAC
GGTGACCCGAACGCGGGACCGACCACCTGCACCAACTGTTTCACCCAGACCACCCCTCTATGGAGACGTAATCCA
GAGGGCCAACCTCTGTGCAATGCATGTGGCCTGTTCCTGAAACTCCATGGCGTTGTCCGACCACTTTCGCTCAAG
ACTGATGTTATCAAGAAGCGGAACCGTAGCAGCGCTAGCACACTTGCTGTCGGCACTTCTCGGTCATCTAAGAAG
TCTTCCCGCAAAAACTCCATCCAGCATGCCCCATCCACATCGATTTCATCCCGCATGAACACTTCTGAGTCGCCA
CCCTCGATGAATGGATCTAGCTCGTTGGGTAAAACCGGTGTTGTCCCAATTGCCGCTGCTCCACCCAAGTCCGGT
CCCCCGGCTGGCGTTGTTCAAGCTCGTGCTGGTGTGCAAGTGGCACCCAGGCGGCAGCGCAGACTCGAAAAAGCA
CCAACTGGATCCGATCCAGATCTAGAGGACAGCCCTAAGTCGGCCGCTCCTCCGAGCCGATCCAAAGTCGTACCA
TTAGCTCCGGCGATGGCACCACCCGCTGCCGCAAACCCAGCGAATCACAGTATCGCGGGTGGGCAGGGTGCGAGT
CAGGAATGGGAGTGGTTGACAATGAGTCTATAG
Gene >Pro_DTO012A6_2|g2437.t1
ATGGACGGGATACATCACGGAGGGCACGGGAGAGCCCGGCCTTCCCACCCTATGGCCTTCCCCGACTTCGACGCG
GATTCCCATATGATGTCCGACGACTTCTCTTTCGATACTCCCTTCAGTCCCTCCGGTTCCTCCAATGCCAATGAT
ACCGTCCTCGGCAACTCCATCTTTCCGGAATGGACGAACGGTGCGTCGCGTGGCGACAGCCCTGACGAGATGCAA
AGGAAAGATCCGCTGGGCGCTCAGATCTGGAAACTCTACACCAGGACAAAGTCTCAGTTGCCCAACCAAGAGCGC
ATGGAGAATCTGACATGGCGAATGATGGCCATGAATCTTAAGCGGAAGGAACGGGAACAGCAGGCTCGGTAAGAA
ACACTCTTATGAATGCTAAAGCACATGGCTGATTTACTGATGTCCGAATAGTGCCTCGGAAACTTTAAGCCCGAC
ACCGAGCGGCATCGCGCAGATGCGCTTGTCCGACCAACCATCGCCCGCTGGTGGCGATCTAGCACACGATACCAC
TTCGGATCCAATGAATCTAGATGACTTCATCGTTCCCTTTGATTCTCCCGCCGAACATTCCTCGCATCCTATTGA
TCGACACTTCACAGCAACACCCACTGGATCAATTCCTATTAAATCGCGCAAGGACCATGCGATGATGGATTCGTC
GACCGCTGCCTCATTCCCTCATCCACCCCAGGATCAGCGAACAAATTCCGAGTTTGGATACGTCGCCCGTCGGGT
CCGCAAAACGAGCGTCGACGACCGGCAGTTCTTTGCCGGTTTGTCTGTTCCGACGCGCAAGCGCCCTGCCGAGGC
CTCGCCTCAGGTTCCCCCGGTATCAAACGCCATGATGGCACAGCACTCGGAACTGTCTTCTGCACTGCCAGACTA
CTCGCTCGATCATCCACCTTCTGCCTATGCTCTTTCCGGCAATGGCACGGTGGGTCCGCGCAGACCTCAACACCA
TCACACGCACTCTAACATTCCCTACGGGTTGGATACGTATGGCATTAGCGAAGATCACGGGCTCAATTCGGCCGG
CTCATACCAGCAAAATTTCCATTTTTCGCCGTCAGATTCTCCAATGACTGCAGGAAATCCTTTCTCGAGTCTATA
TGCCCAGACGCCGCTCGCCTCGTCGCTTAACTCAACCGAGTTCTTCTCGCCCCCGCCTTCTGGCTATCAGTCTAC
TGTGTCAACCCCGCAACCGATTTATGAAGGGGAGCAATCGATATTCTTTTCTGATGCGCCCTCCGCTGAATCACA
CACCCAGCGCCGCATTCCTAATTATATCCAGCAGCGCCAGTCGAACCTGTCTGCATCGCTGCAGCCACGTTATAT
GTACAACATGTCCAACGGCGAATCTCACTCAGGGAGTGCAGTTACAGGGCCACCAACCACCCACGTGTCTGGATT
TTCGGTGCCACCACCGCAGCATATCAACCCATCACAGGTGCTTGGCCATGGCGAATTCTCTACAACAGCGCCTTC
CAGTAGCATGTTTACTTTCGGTGGAGACTCAGACAACGAAGATGACGATGGCAACTTTGGTGAAGGTGGAGGCAT
GACTATGCCAAATGACTTTGCCTCTCTGGATGAGTCTGGTGATATGAGCGCCGGTCTTCATTGGGACGGGGGTTT
CCCCGGATCAATACACTCGCTACCAGGCTTCAATGCTCAGCACCGTAAGCACGTTACAATAGGATCCACGGACAT
GATAGATGGCCCACCTGAATGGAACCAGGGAGGCACTCTTGGTCGTGCGCACGGATCCGCTGCTTCGGTCAGCGA
AGTCCGTAACCAAAACCAGGATCCTCGTCGCTACGGAAAGGTTCCCCGCACAGCATCGACGCCCAATGCTGCTGC
ACTACTCCGTCAGAGCTTGAATGGTTCAGCCAGTGGGCCTCCAACAAACCATCCTTCGCCAAGCACCCCTCCAGA
GTCTGGTCTTAGCAGTGCGGTGCCGTCCCGGCCAGGTAGCCCTGGTGGGTCGAAAAACGGTGACCCGAACGCGGG
ACCGACCACCTGCACCAACTGTTTCACCCAGACCACCCCTCTATGGAGACGTAATCCAGAGGGCCAACCTCTGTG
CAATGCATGTGGCCTGTTCCTGAAACTCCATGGCGTTGTCCGACCACTTTCGCTCAAGACTGATGTTATCAAGAA
GCGGAACCGTAGCAGCGCTAGCACACTTGCTGTCGGCACTTCTCGGTCATCTAAGAAGTCTTCCCGCAAAAACTC
CATCCAGCATGCCCCATCCACATCGATTTCATCCCGCATGAACACTTCTGAGTCGCCACCCTCGATGAATGGATC
TAGCTCGTTGGGTAAAACCGGTGTTGTCCCAATTGCCGCTGCTCCACCCAAGTCCGGTCCCCCGGCTGGCGTTGT
TCAAGCTCGTGCTGGTGTGCAAGTGGCACCCAGGCGGCAGCGCAGACTCGAAAAAGCACCAACTGGATCCGATCC
AGATCTAGAGGACAGCCCTAAGTCGGCCGCTCCTCCGAGCCGATCCAAAGTCGTACCATTAGCTCCGGCGATGGC
ACCACCCGCTGCCGCAAACCCAGCGAATCACAGTATCGCGGGTGGGCAGGGTGCGAGTCAGGAATGGGAGTGGTT
GACAATGAGTCTATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail