Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO006G7_3|g9502.t1
Gene name
Locationscaffold_048:133527..138054
Strand+
Gene length (bp)4527
Transcript length (bp)4176
Coding sequence length (bp)4176
Protein length (aa) 1392

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01061 ABC2_membrane ABC-2 type transporter 3.0E-30 421 629
PF01061 ABC2_membrane ABC-2 type transporter 3.3E-31 1082 1288
PF00005 ABC_tran ABC transporter 1.2E-20 115 269
PF00005 ABC_tran ABC transporter 3.5E-21 788 938
PF06422 PDR_CDR CDR ABC transporter 8.3E-23 642 726
PF06422 PDR_CDR CDR ABC transporter 1.7E-04 1346 1387

GO

GO Term Description Terminal node
GO:0042626 ATPase-coupled transmembrane transporter activity Yes
GO:0005524 ATP binding Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity No
GO:0140657 ATP-dependent activity No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No
GO:0006810 transport No
GO:0031224 intrinsic component of membrane No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0032555 purine ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0097367 carbohydrate derivative binding No
GO:0032553 ribonucleotide binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0022804 active transmembrane transporter activity No
GO:0000166 nucleotide binding No
GO:0005488 binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0017076 purine nucleotide binding No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0030554 adenyl nucleotide binding No
GO:0015399 primary active transmembrane transporter activity No
GO:0043168 anion binding No
GO:0008150 biological_process No
GO:0032559 adenyl ribonucleotide binding No
GO:0051234 establishment of localization No
GO:1901363 heterocyclic compound binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 437 459 22
2 466 488 22
3 523 542 19
4 549 571 22
5 581 600 19
6 685 707 22
7 1135 1157 22
8 1177 1199 22
9 1214 1236 22
10 1243 1262 19
11 1364 1386 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

Gene cluster ID Type of secondary metabolism gene
Cluster 31 Decorating

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID2
Orthogroup4587
Change Orthofinder run
Species Protein ID
Penicillium roqueforti DTO002I6 Pro_DTO002I6_2|g5156.t1
Penicillium roqueforti DTO003C3 Pro_DTO003C3_2|g3160.t1
Penicillium roqueforti DTO003H1 (CBS 147308) Pro_DTO003H1_2|g5219.t1
Penicillium roqueforti DTO006G1 Pro_DTO006G1_2|g8306.t1
Penicillium roqueforti DTO006G7 Pro_DTO006G7_3|g9502.t1 (this protein)
Penicillium roqueforti DTO012A1 Pro_DTO012A1_2|g6864.t1
Penicillium roqueforti DTO012A2 (CBS 147309) Pro_DTO012A2_2|g7988.t1
Penicillium roqueforti DTO012A6 (CBS 147310) Pro_DTO012A6_2|g8100.t1
Penicillium roqueforti DTO012A7 Pro_DTO012A7_2|g8237.t1
Penicillium roqueforti DTO012A8 Pro_DTO012A8_2|g5050.t1
Penicillium roqueforti DTO012A9 Pro_DTO012A9_2|g6254.t1
Penicillium roqueforti DTO013E5 Pro_DTO013E5_2|g6834.t1
Penicillium roqueforti DTO013F2 Pro_DTO013F2_2|g8290.t1
Penicillium roqueforti DTO013F5 (CBS 147311) Pro_DTO013F5_2|g5808.t1
Penicillium roqueforti DTO027I6 Pro_DTO027I6_2|g629.t1
Penicillium roqueforti DTO032C6 Pro_DTO032C6_2|g6320.t1
Penicillium roqueforti DTO039G3 Pro_DTO039G3_2|g8496.t1
Penicillium roqueforti DTO046C5 Pro_DTO046C5_2|g3834.t1
Penicillium roqueforti DTO070G2 (CBS 147317) Pro_DTO070G2_2|g4548.t1
Penicillium roqueforti DTO081F9 (CBS 147318) Pro_DTO081F9_2|g8231.t1
Penicillium roqueforti DTO101D6 (CBS 147325) Pro_DTO101D6_2|g7353.t1
Penicillium roqueforti DTO102I9 (CBS 147326) Pro_DTO102I9_2|g7945.t1
Penicillium roqueforti DTO126G2 (CBS 147330) Pro_DTO126G2_2|g5329.t1
Penicillium roqueforti DTO127F7 (CBS 147331) Pro_DTO127F7_2|g8490.t1
Penicillium roqueforti DTO127F9 (CBS 147332) Pro_DTO127F9_2|g2661.t1
Penicillium roqueforti DTO130C1 (CBS 147333) Pro_DTO130C1_2|g3335.t1
Penicillium roqueforti DTO163C3 (CBS 147337) Pro_DTO163C3_2|g9576.t1
Penicillium roqueforti DTO163F5 (CBS 147338) Pro_DTO163F5_2|g7219.t1
Penicillium roqueforti DTO163G4 (CBS 147339) Pro_DTO163G4_2|g7341.t1
Penicillium roqueforti DTO265D5 (CBS 147372) Pro_DTO265D5_2|g7810.t1
Penicillium roqueforti DTO369A1 (CBS 147354) Pro_DTO369A1_2|g6086.t1
Penicillium roqueforti DTO375B1 (CBS 147355) Pro_DTO375B1_2|g4292.t1
Penicillium roqueforti DTO377G2 (LCP 96.3914a) Pro_DTO377G2_2|g5575.t1
Penicillium roqueforti LCP96 04111 Pro_DTO377G3_2|g8213.t1

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO006G7_3|g9502.t1
MVENHHSSLEEANTPVQSDGDVQKSELAEIDGPSSKSSRIAAGESIADSVRNFLEIRQGGIPGDTGVVFHKISAI
GSGTGSQDAPTVSSAAESAFGLLSPLQNRQRKQYSRPILSGFSGTIDPGEMLLVLGKPGSGCTTFLKTLSGLWDE
YKEIQGELTVDGHPLLDVMAQRPQDILFCAESDDHFPTLTVAETLRFATRARCGPEVSATKIDTMVAQLAKLVGL
ETVLNTKVGDAKIRGVSGGERRRVSLAEALATCAHLICLDNPTQGLDSSTAVEFMEMMREWTTQSRCVAAMSVYQ
ASDAIVSYFDKVLVINSGRQIFYGRVQEAKAYFEDLGFECLSTTTVADFLNVMSADPDVRRAQEGRENQVPRTAE
EFERAFSASPIYQEMQVSVQVAKERSQAHPSPLVKTSAFALPIWHQIWYCASRQFRIVTSDYSLWAVELATIVVQ
SLVLGTLFRNQQRTTNSLFIFASSLFYSVLVPALQSMAEFGNGFAQRPLILKQKRYQISRPIAYALGLVTTDVVW
KVAAICYNIPLYFLTGFQRTPGNFFTWFLIIYLEHLALSMFFRSVAIFSPNMHRAVLPVGIFFNMYVLYTGLYVP
APQMQVWLGWLRYLNPLYYAFESVMVNEFGDLSYQCSISDLVPSGPGYTDIAHQVCTVVGSQPGDRLLSGDSYIH
AQYGFKTSHLWRNVGINAALFVFFALCSGIGMEMLRTPAGQLATVFYKSSSRGIHRRDKIDNETGSVHGNDILDA
SAGQGNDANRSQASQSNALSWTSLCLDIKTRDGDQRLLNNLSGSIKSGQLKALMGVSGAGKTTLLNALAGRSTIG
TLTGTLALNSQLLPTFFRSRMGYVQQQDIHLPTQTVREALQMTARLRRPESIPLVEKNAYVEKVIEWLNMEHIAD
ALVGVPGAGLNLEQRKKVSIGVEMASKPEILFLDEPTSGLDGQSAMLIARLLRRLADSGQAILCTIHQPAAELID
QFDKLYLLSRGGNLVYDGPLGTRCHEAIEYFQSRSRPYGSEENPAEYFLEVIGAGSRNDAHMDWASLWHDSQQGK
EREKAEQSLVPAAEHSPPLEQQSLYSVPFHVQLWVVVQRTWLYYWREPDYVTSKLWMSVGNSLLNSLTYLQSPNT
ERGAYNRVFSAFMSLIVGPPLGLQVQPRFVTLRDIFVHRERESLTYHWLAFVLSAFIVELPFTFLSSLVYWLLWY
FPVGYFYAPSRAGYSFLMYELFGVFATSLAQLCASLMPNIEAAFAANGFFFMFCNTFAGTLSPKPVTPSGWRWFY
NISPLFYLGEGVTVDVLQDLPIRCEQSEVSIFYAANGTTCGQYAKDFLEIATGYLVNPTSTAECQYCRYRDGQSY
YQQYGYEFAHRHRNIGVFIGFIAFNFTMVLVMTYLTKTRRQ*
Coding >Pro_DTO006G7_3|g9502.t1
ATGGTAGAAAATCATCATTCGTCTTTAGAGGAGGCAAATACACCCGTCCAGTCCGATGGTGATGTGCAGAAATCC
GAGTTGGCTGAAATTGATGGACCATCGTCGAAATCTTCACGGATTGCAGCAGGGGAATCGATTGCAGACAGCGTT
CGCAACTTCCTTGAAATACGCCAGGGTGGCATTCCCGGTGACACTGGAGTGGTCTTTCACAAGATCTCAGCCATT
GGAAGCGGAACCGGATCACAAGATGCACCCACCGTCTCATCGGCAGCCGAGTCGGCTTTTGGGCTGTTGAGTCCT
CTACAAAATCGACAAAGGAAACAGTATTCTCGACCCATTCTCAGCGGATTCTCAGGCACGATCGACCCCGGAGAA
ATGTTGTTGGTACTAGGTAAACCCGGGAGCGGGTGTACAACTTTCCTGAAGACCCTGTCGGGCCTGTGGGATGAA
TATAAGGAAATCCAGGGTGAACTCACTGTGGATGGTCACCCACTGCTAGATGTGATGGCACAGCGACCACAGGAT
ATTCTCTTCTGCGCCGAGTCTGATGACCATTTTCCCACGTTGACTGTGGCGGAGACCCTACGCTTTGCGACCAGA
GCACGATGCGGCCCCGAAGTCTCGGCCACTAAAATTGACACGATGGTTGCTCAGCTAGCCAAGCTAGTTGGTCTT
GAAACCGTCTTGAATACGAAAGTGGGAGATGCGAAGATACGAGGAGTCAGCGGCGGAGAGCGACGGCGAGTGTCT
TTGGCGGAGGCCCTGGCCACTTGTGCCCATCTGATTTGCCTGGATAATCCAACACAAGGACTGGACTCATCCACT
GCGGTCGAATTCATGGAAATGATGCGTGAGTGGACGACACAAAGTCGATGTGTGGCCGCGATGAGCGTCTACCAA
GCCAGTGATGCAATTGTCTCCTATTTTGACAAAGTCCTGGTGATCAACTCTGGCCGTCAGATCTTCTATGGCCGT
GTACAGGAAGCGAAGGCATATTTTGAAGATCTCGGGTTTGAGTGTTTATCGACCACCACCGTCGCTGACTTCCTT
AATGTGATGTCCGCTGATCCAGACGTGCGACGAGCCCAAGAAGGCAGGGAGAACCAGGTCCCACGAACGGCGGAG
GAGTTTGAGCGTGCTTTCAGTGCGAGTCCTATCTACCAGGAAATGCAAGTGTCGGTACAAGTGGCCAAGGAGCGT
TCCCAAGCCCATCCCAGTCCCCTTGTCAAAACATCGGCCTTTGCTCTCCCCATCTGGCATCAGATTTGGTACTGT
GCCAGTCGCCAATTTCGCATCGTCACCAGTGATTATAGCTTGTGGGCGGTGGAGCTCGCCACAATCGTCGTTCAA
AGTCTGGTGTTGGGCACGCTGTTCCGAAATCAGCAGCGAACGACCAATTCATTGTTCATTTTCGCGTCTTCTTTA
TTCTACTCTGTCTTAGTCCCGGCACTGCAGTCCATGGCTGAATTTGGCAATGGATTCGCTCAGCGACCGCTCATC
CTGAAGCAGAAGCGATACCAGATCTCTCGCCCGATTGCATACGCTCTCGGCTTGGTCACCACGGATGTTGTGTGG
AAGGTGGCAGCGATCTGTTACAATATCCCCCTGTACTTCCTGACCGGATTTCAGCGGACGCCCGGAAATTTCTTC
ACCTGGTTTCTGATTATCTACCTTGAGCATCTCGCCCTGTCTATGTTCTTTCGCTCGGTGGCCATATTTTCTCCC
AACATGCATCGGGCTGTGCTGCCGGTGGGGATTTTCTTTAATATGTATGTCCTCTATACGGGGCTTTACGTTCCT
GCACCACAGATGCAGGTATGGCTTGGGTGGCTGCGATATCTAAATCCCTTGTATTATGCATTCGAGTCCGTTATG
GTGAATGAATTCGGAGATCTGAGCTATCAGTGCAGTATCTCGGATCTGGTCCCATCAGGGCCAGGATATACCGAT
ATAGCCCACCAGGTCTGTACCGTGGTGGGATCTCAACCCGGGGATCGTCTTCTGTCCGGGGATTCGTACATCCAC
GCCCAGTATGGATTCAAAACCTCCCACCTCTGGCGGAATGTAGGGATTAACGCGGCCCTATTCGTTTTCTTTGCC
CTTTGTTCAGGGATCGGGATGGAGATGCTCAGAACACCCGCAGGTCAACTAGCCACAGTTTTCTACAAGAGCAGC
TCACGAGGAATTCACCGCCGCGATAAAATCGATAATGAAACAGGATCAGTCCACGGAAACGACATTTTGGACGCA
TCGGCTGGCCAAGGCAACGACGCAAATCGGTCACAAGCAAGTCAGAGTAACGCCCTTTCATGGACCAGTCTCTGT
CTTGACATCAAAACCAGAGATGGCGATCAGCGTCTGCTTAACAATCTGAGTGGCTCGATCAAGAGTGGACAACTC
AAGGCTCTAATGGGGGTCTCGGGTGCCGGGAAGACAACCCTGCTGAACGCACTGGCTGGTCGTTCCACCATTGGG
ACTCTCACAGGAACTCTGGCGCTCAATAGTCAATTGCTTCCCACGTTCTTCCGAAGTCGAATGGGCTACGTGCAA
CAGCAGGACATTCATCTTCCTACTCAGACAGTGCGCGAAGCATTGCAAATGACGGCGCGACTTCGACGCCCAGAG
TCCATCCCTCTGGTGGAAAAAAATGCCTACGTTGAAAAGGTGATTGAGTGGTTGAATATGGAGCACATTGCGGAT
GCCCTAGTTGGTGTCCCCGGGGCCGGCCTCAATCTCGAACAACGGAAGAAAGTCAGTATTGGCGTGGAGATGGCA
TCCAAACCAGAAATCCTATTCCTGGATGAACCGACCTCGGGTCTCGATGGCCAATCCGCGATGCTGATCGCTCGC
TTGCTTCGTCGTCTGGCAGACTCGGGACAGGCCATCCTGTGCACGATCCATCAACCGGCAGCAGAGCTCATCGAC
CAGTTTGACAAGTTGTATCTGCTGAGCCGCGGAGGGAACTTGGTCTATGATGGTCCTCTTGGAACTCGCTGCCAC
GAGGCAATCGAGTATTTCCAGTCTCGGAGTCGCCCCTACGGCTCAGAAGAGAACCCGGCAGAATATTTCCTGGAG
GTTATTGGGGCTGGGTCTCGAAACGACGCCCATATGGATTGGGCTAGTCTCTGGCATGACAGCCAGCAGGGCAAG
GAGCGAGAGAAGGCAGAACAAAGTCTGGTCCCTGCCGCAGAACACTCCCCACCGCTGGAGCAACAGTCCCTGTAT
TCGGTGCCGTTCCATGTCCAGCTGTGGGTGGTGGTTCAGCGAACATGGCTTTATTATTGGAGAGAACCAGATTAT
GTCACATCGAAGCTCTGGATGAGCGTCGGAAACTCCCTCCTCAACTCCCTCACCTACTTACAGTCTCCCAACACA
GAGCGAGGGGCATATAATCGGGTCTTCTCTGCTTTCATGTCTCTCATCGTGGGCCCCCCTCTAGGGCTTCAGGTG
CAACCACGCTTCGTGACCCTGCGGGATATTTTCGTCCACCGAGAGCGAGAGAGCTTGACCTATCACTGGCTAGCA
TTTGTCTTATCTGCATTCATCGTGGAACTACCCTTCACATTTCTCAGCTCGCTAGTCTATTGGTTGTTGTGGTAC
TTCCCCGTTGGCTATTTCTACGCCCCCTCGCGCGCAGGGTACAGTTTTCTCATGTATGAACTCTTTGGAGTCTTT
GCTACTAGCCTAGCCCAGCTGTGCGCATCGCTGATGCCCAACATCGAGGCAGCCTTTGCCGCCAACGGATTCTTC
TTCATGTTTTGTAACACCTTTGCGGGGACGCTTTCTCCAAAGCCAGTGACACCCTCGGGTTGGCGCTGGTTTTAC
AATATCTCTCCCCTCTTCTATTTGGGCGAGGGTGTCACCGTGGACGTGCTACAAGATTTACCCATCCGATGCGAG
CAGTCGGAGGTTTCAATCTTCTACGCGGCGAATGGCACGACCTGTGGTCAGTATGCCAAGGATTTCCTGGAAATT
GCTACGGGATATTTGGTTAATCCCACCAGCACGGCGGAGTGTCAATATTGCCGGTATCGCGACGGACAATCATAC
TACCAACAATACGGCTATGAGTTTGCTCATCGGCATCGGAACATTGGCGTTTTCATCGGGTTTATCGCGTTCAAT
TTCACGATGGTTCTGGTGATGACCTATCTTACCAAAACACGCCGCCAGTGA
Transcript >Pro_DTO006G7_3|g9502.t1
ATGGTAGAAAATCATCATTCGTCTTTAGAGGAGGCAAATACACCCGTCCAGTCCGATGGTGATGTGCAGAAATCC
GAGTTGGCTGAAATTGATGGACCATCGTCGAAATCTTCACGGATTGCAGCAGGGGAATCGATTGCAGACAGCGTT
CGCAACTTCCTTGAAATACGCCAGGGTGGCATTCCCGGTGACACTGGAGTGGTCTTTCACAAGATCTCAGCCATT
GGAAGCGGAACCGGATCACAAGATGCACCCACCGTCTCATCGGCAGCCGAGTCGGCTTTTGGGCTGTTGAGTCCT
CTACAAAATCGACAAAGGAAACAGTATTCTCGACCCATTCTCAGCGGATTCTCAGGCACGATCGACCCCGGAGAA
ATGTTGTTGGTACTAGGTAAACCCGGGAGCGGGTGTACAACTTTCCTGAAGACCCTGTCGGGCCTGTGGGATGAA
TATAAGGAAATCCAGGGTGAACTCACTGTGGATGGTCACCCACTGCTAGATGTGATGGCACAGCGACCACAGGAT
ATTCTCTTCTGCGCCGAGTCTGATGACCATTTTCCCACGTTGACTGTGGCGGAGACCCTACGCTTTGCGACCAGA
GCACGATGCGGCCCCGAAGTCTCGGCCACTAAAATTGACACGATGGTTGCTCAGCTAGCCAAGCTAGTTGGTCTT
GAAACCGTCTTGAATACGAAAGTGGGAGATGCGAAGATACGAGGAGTCAGCGGCGGAGAGCGACGGCGAGTGTCT
TTGGCGGAGGCCCTGGCCACTTGTGCCCATCTGATTTGCCTGGATAATCCAACACAAGGACTGGACTCATCCACT
GCGGTCGAATTCATGGAAATGATGCGTGAGTGGACGACACAAAGTCGATGTGTGGCCGCGATGAGCGTCTACCAA
GCCAGTGATGCAATTGTCTCCTATTTTGACAAAGTCCTGGTGATCAACTCTGGCCGTCAGATCTTCTATGGCCGT
GTACAGGAAGCGAAGGCATATTTTGAAGATCTCGGGTTTGAGTGTTTATCGACCACCACCGTCGCTGACTTCCTT
AATGTGATGTCCGCTGATCCAGACGTGCGACGAGCCCAAGAAGGCAGGGAGAACCAGGTCCCACGAACGGCGGAG
GAGTTTGAGCGTGCTTTCAGTGCGAGTCCTATCTACCAGGAAATGCAAGTGTCGGTACAAGTGGCCAAGGAGCGT
TCCCAAGCCCATCCCAGTCCCCTTGTCAAAACATCGGCCTTTGCTCTCCCCATCTGGCATCAGATTTGGTACTGT
GCCAGTCGCCAATTTCGCATCGTCACCAGTGATTATAGCTTGTGGGCGGTGGAGCTCGCCACAATCGTCGTTCAA
AGTCTGGTGTTGGGCACGCTGTTCCGAAATCAGCAGCGAACGACCAATTCATTGTTCATTTTCGCGTCTTCTTTA
TTCTACTCTGTCTTAGTCCCGGCACTGCAGTCCATGGCTGAATTTGGCAATGGATTCGCTCAGCGACCGCTCATC
CTGAAGCAGAAGCGATACCAGATCTCTCGCCCGATTGCATACGCTCTCGGCTTGGTCACCACGGATGTTGTGTGG
AAGGTGGCAGCGATCTGTTACAATATCCCCCTGTACTTCCTGACCGGATTTCAGCGGACGCCCGGAAATTTCTTC
ACCTGGTTTCTGATTATCTACCTTGAGCATCTCGCCCTGTCTATGTTCTTTCGCTCGGTGGCCATATTTTCTCCC
AACATGCATCGGGCTGTGCTGCCGGTGGGGATTTTCTTTAATATGTATGTCCTCTATACGGGGCTTTACGTTCCT
GCACCACAGATGCAGGTATGGCTTGGGTGGCTGCGATATCTAAATCCCTTGTATTATGCATTCGAGTCCGTTATG
GTGAATGAATTCGGAGATCTGAGCTATCAGTGCAGTATCTCGGATCTGGTCCCATCAGGGCCAGGATATACCGAT
ATAGCCCACCAGGTCTGTACCGTGGTGGGATCTCAACCCGGGGATCGTCTTCTGTCCGGGGATTCGTACATCCAC
GCCCAGTATGGATTCAAAACCTCCCACCTCTGGCGGAATGTAGGGATTAACGCGGCCCTATTCGTTTTCTTTGCC
CTTTGTTCAGGGATCGGGATGGAGATGCTCAGAACACCCGCAGGTCAACTAGCCACAGTTTTCTACAAGAGCAGC
TCACGAGGAATTCACCGCCGCGATAAAATCGATAATGAAACAGGATCAGTCCACGGAAACGACATTTTGGACGCA
TCGGCTGGCCAAGGCAACGACGCAAATCGGTCACAAGCAAGTCAGAGTAACGCCCTTTCATGGACCAGTCTCTGT
CTTGACATCAAAACCAGAGATGGCGATCAGCGTCTGCTTAACAATCTGAGTGGCTCGATCAAGAGTGGACAACTC
AAGGCTCTAATGGGGGTCTCGGGTGCCGGGAAGACAACCCTGCTGAACGCACTGGCTGGTCGTTCCACCATTGGG
ACTCTCACAGGAACTCTGGCGCTCAATAGTCAATTGCTTCCCACGTTCTTCCGAAGTCGAATGGGCTACGTGCAA
CAGCAGGACATTCATCTTCCTACTCAGACAGTGCGCGAAGCATTGCAAATGACGGCGCGACTTCGACGCCCAGAG
TCCATCCCTCTGGTGGAAAAAAATGCCTACGTTGAAAAGGTGATTGAGTGGTTGAATATGGAGCACATTGCGGAT
GCCCTAGTTGGTGTCCCCGGGGCCGGCCTCAATCTCGAACAACGGAAGAAAGTCAGTATTGGCGTGGAGATGGCA
TCCAAACCAGAAATCCTATTCCTGGATGAACCGACCTCGGGTCTCGATGGCCAATCCGCGATGCTGATCGCTCGC
TTGCTTCGTCGTCTGGCAGACTCGGGACAGGCCATCCTGTGCACGATCCATCAACCGGCAGCAGAGCTCATCGAC
CAGTTTGACAAGTTGTATCTGCTGAGCCGCGGAGGGAACTTGGTCTATGATGGTCCTCTTGGAACTCGCTGCCAC
GAGGCAATCGAGTATTTCCAGTCTCGGAGTCGCCCCTACGGCTCAGAAGAGAACCCGGCAGAATATTTCCTGGAG
GTTATTGGGGCTGGGTCTCGAAACGACGCCCATATGGATTGGGCTAGTCTCTGGCATGACAGCCAGCAGGGCAAG
GAGCGAGAGAAGGCAGAACAAAGTCTGGTCCCTGCCGCAGAACACTCCCCACCGCTGGAGCAACAGTCCCTGTAT
TCGGTGCCGTTCCATGTCCAGCTGTGGGTGGTGGTTCAGCGAACATGGCTTTATTATTGGAGAGAACCAGATTAT
GTCACATCGAAGCTCTGGATGAGCGTCGGAAACTCCCTCCTCAACTCCCTCACCTACTTACAGTCTCCCAACACA
GAGCGAGGGGCATATAATCGGGTCTTCTCTGCTTTCATGTCTCTCATCGTGGGCCCCCCTCTAGGGCTTCAGGTG
CAACCACGCTTCGTGACCCTGCGGGATATTTTCGTCCACCGAGAGCGAGAGAGCTTGACCTATCACTGGCTAGCA
TTTGTCTTATCTGCATTCATCGTGGAACTACCCTTCACATTTCTCAGCTCGCTAGTCTATTGGTTGTTGTGGTAC
TTCCCCGTTGGCTATTTCTACGCCCCCTCGCGCGCAGGGTACAGTTTTCTCATGTATGAACTCTTTGGAGTCTTT
GCTACTAGCCTAGCCCAGCTGTGCGCATCGCTGATGCCCAACATCGAGGCAGCCTTTGCCGCCAACGGATTCTTC
TTCATGTTTTGTAACACCTTTGCGGGGACGCTTTCTCCAAAGCCAGTGACACCCTCGGGTTGGCGCTGGTTTTAC
AATATCTCTCCCCTCTTCTATTTGGGCGAGGGTGTCACCGTGGACGTGCTACAAGATTTACCCATCCGATGCGAG
CAGTCGGAGGTTTCAATCTTCTACGCGGCGAATGGCACGACCTGTGGTCAGTATGCCAAGGATTTCCTGGAAATT
GCTACGGGATATTTGGTTAATCCCACCAGCACGGCGGAGTGTCAATATTGCCGGTATCGCGACGGACAATCATAC
TACCAACAATACGGCTATGAGTTTGCTCATCGGCATCGGAACATTGGCGTTTTCATCGGGTTTATCGCGTTCAAT
TTCACGATGGTTCTGGTGATGACCTATCTTACCAAAACACGCCGCCAGTGA
Gene >Pro_DTO006G7_3|g9502.t1
ATGGTAGAAAATCATCATTCGTCTTTAGAGGAGGCAAATACACCCGTCCAGTCCGATGGTGATGTGCAGAAATCC
GAGTTGGCTGAAATTGATGGACCATCGTCGAAATCTTCACGGATTGCAGCAGGGGAATCGATTGCAGACAGCGTT
CGCAACTTCCTTGAAATACGCCAGGGTGGCATTCCCGGTGACACTGGAGTGGTCTTTCACAAGATCTCAGCCATT
GGAAGCGGAACCGGAGTGAGTACATCTAATCCAACCGAAAGAATCAGGATTGACGCTTGATAGTCACAAGATGCA
CCCACCGTCTCATCGGCAGCCGAGTCGGCTTTTGGGCTGTTGAGTCCTCTACAAAATCGACAAAGGAAACAGTAT
TCTCGACCCATTCTCAGCGGATTCTCAGGCACGATCGACCCCGGAGAAATGTTGTTGGTACTAGGTAAACCCGGG
AGCGGGTGTACAACTTTCCTGAAGACCCTGTCGGGCCTGTGGGATGAATATAAGGAAATCCAGGGTGAACTCACT
GTGGATGGTCACCCACTGCTAGATGTGATGGCACAGCGACCACAGGATATTCTCTTCTGCGGTTAGTCATCGTTT
GATGTTTGTCGTTTTGAACACACACTGACCGACATGTCTTCCTTAGCCGAGTCTGATGACCATTTTCCCACGTTG
ACTGTGGCGGAGACCCTACGCTTTGCGACCAGAGCACGATGCGGCCCCGAAGTCTCGGCCACTAAAATTGACACG
ATGGTTGCTCAGCTAGCCAAGCTAGTTGGTCTTGAAACCGTCTTGAATACGAAAGTGGGAGATGCGAAGATACGA
GGAGTCAGCGGCGGAGAGCGACGGCGAGTGTCTTTGGCGGAGGCCCTGGCCACTTGTGCCCAGTAAGTGATATCT
TCTGCTCATTCAAGTACCAAACTAGCGATTCCTCGACTCACACATCCTTACAGTCTGATTTGCCTGGATAATCCA
ACACAAGGACTGGACTCATCCACTGCGGTCGAATTCATGGAAATGATGCGTGAGTGGACGACACAAAGTCGATGT
GTGGCCGCGATGAGCGTCTACCAAGCCAGTGATGCAATTGTCTCCTATTTTGACAAAGTCCTGGTGATCAACTCT
GGCCGTCAGATCTTCTATGGCCGTGTACAGGAAGCGAAGGCATATTTTGAAGATCTCGGGTTTGAGTGTTTATCG
ACCACCACCGTCGCTGACTTCCTTAATGTGATGTCCGCTGATCCAGACGTGCGACGAGCCCAAGAAGGCAGGGAG
AACCAGGTCCCACGAACGGCGGAGGAGTTTGAGCGTGCTTTCAGTGCGAGTCCTATCTACCAGGAAATGCAAGTG
TCGGTACAAGTGGCCAAGGAGCGTTCCCAAGCCCATCCCAGTCCCCTTGTCAAAACATCGGCCTTTGCTCTCCCC
ATCTGGCATCAGATTTGGTACTGTGCCAGTCGCCAATTTCGCATCGTCACCAGTGATTATAGCTTGTGGGCGGTG
GAGCTCGCCACAATCGTCGTTCAAAGTCTGGTGTTGGGCACGCTGTTCCGAAATCAGCAGCGAACGACCAATTCA
TTGTTCATTTTCGCGTCTTCTTTATTCTACTCTGTCTTAGTCCCGGCACTGCAGTCCATGGCTGAATTTGGCAAT
GGATTCGCTCAGCGACCGCTCATCCTGAAGCAGAAGCGATACCAGATCTCTCGCCCGATTGCATACGCTCTCGGC
TTGGTCACCACGGATGTTGTGTGGAAGGTGGCAGCGATCTGTTACAATATCCCCCTGTACTTCCTGACCGGATTT
CAGCGGACGCCCGGAAATTTCTTCACCTGGTTTCTGATTATCTACCTTGAGCATCTCGCCCTGTCTATGTTCTTT
CGCTCGGTGGCCATATTTTCTCCCAACATGCATCGGGCTGTGCTGCCGGTGGGGATTTTCTTTAATATGTATGTC
CTCTATACGGGGCTTTACGTTCCTGCACCACAGATGCAGGTATGGCTTGGGTGGCTGCGATATCTAAATGTCAGT
GGGTATCATATTATGGGGTTTGGACAAATGCTAACATGTGACAGCCCTTGTATTATGCATTCGAGTCCGTTATGG
TGAATGAATTCGGAGATCTGAGCTATCAGTGCAGTATCTCGGATCTGGTCCCATCAGGGCCAGGATATACCGATA
TAGCCCACCAGGTCTGTACCGTGGTGGGATCTCAACCCGGGGATCGTCTTCTGTCCGGGGATTCGTACATCCACG
CCCAGTATGGATTCAAAACCTCCCACCTCTGGCGGAATGTAGGGATTAACGCGGCCCTATTCGTTTTCTTTGCCC
TTTGTTCAGGGTAAGTTATCAGACGCTCAAGCCTAGTTCATGAGAAAAATCTACGACTGACACTGGGATTTAACA
GGATCGGGATGGAGATGCTCAGAACACCCGCAGGTCAACTAGCCACAGTTTTCTACAAGAGCAGCTCACGAGGAA
TTCACCGCCGCGATAAAATCGATAATGAAACAGGATCAGTCCACGGAAACGACATTTTGGACGCATCGGCTGGCC
AAGGCAACGACGCAAATCGGTCACAAGCAAGTCAGAGTAACGCCCTTTCATGGACCAGTCTCTGTCTTGACATCA
AAACCAGAGATGGCGATCAGCGTCTGCTTAACAATCTGAGTGGCTCGATCAAGAGTGGACAACTCAAGGCTCTAA
TGGGGGTCTCGGGTGCCGGGAAGACAACCCTGCTGAACGCACTGGCTGGTCGTTCCACCATTGGGACTCTCACAG
GAACTCTGGCGCTCAATAGTCAATTGCTTCCCACGTTCTTCCGAAGTCGAATGGGCTACGTGCAACAGCAGGACA
TTCATCTTCCTACTCAGACAGTGCGCGAAGCATTGCAAATGACGGCGCGACTTCGACGCCCAGAGTCCATCCCTC
TGGTGGAAAAAAATGCCTACGTTGAAAAGGTGATTGAGTGGTTGAATATGGAGCACATTGCGGATGCCCTAGTTG
GTGTCCCCGGGGCCGGCCTCAATCTCGAACAACGGAAGAAAGTCAGTATTGGCGTGGAGATGGCATCCAAACCAG
AAATCCTATTCCTGGATGAACCGACCTCGGGTCTCGATGGCCAATCCGCGATGCTGATCGCTCGCTTGCTTCGTC
GTCTGGCAGACTCGGGACAGGCCATCCTGTGCACGATCCATCAACCGGCAGCAGAGCTCATCGACCAGTTTGACA
AGTTGTATCTGCTGAGCCGCGGAGGGAACTTGGTCTATGATGGTCCTCTTGGAACTCGCTGCCACGAGGCAATCG
AGTATTTCCAGTCTCGGAGTCGCCCCTACGGCTCAGAAGAGAACCCGGCAGAATATTTCCTGGAGGTTATTGGGG
CTGGGTCTCGAAACGACGCCCATATGGATTGGGCTAGTCTCTGGCATGACAGCCAGCAGGGCAAGGAGCGAGAGA
AGGCAGAACAAAGTCTGGTCCCTGCCGCAGAACACTCCCCACCGCTGGAGCAACAGTCCCTGTATTCGGTGCCGT
TCCATGTCCAGCTGTGGGTGGTGGTTCAGCGAACATGGCTTTATTATTGGAGAGAACCAGATTATGTCACATCGA
AGCTCTGGATGAGCGTCGGAAACTCCCTCCTCAACTCCCTCACCTACTTACAGTCTCCCAACACAGAGCGAGGGG
CATATAATCGGGTCTTCTCTGCTTTCATGTCTCTCATCGTGGGCCCCCCTCTAGGGCTTCAGGTGCAACCACGCT
TCGTGACCCTGCGGGATATTTTCGTCCACCGAGAGCGAGAGAGCTTGACCTATCACTGGCTAGCATTTGTCTTAT
CTGCATTCATCGTGGAACTACCCTTCACATTTCTCAGCTCGCTAGTCTATTGGTTGTTGTGGTACTTCCCCGTTG
GCTATTTCTACGCCCCCTCGCGCGCAGGGTACAGTTTTCTCATGTATGAACTCTTTGGAGTCTTTGCTACTAGCC
TAGCCCAGCTGTGCGCATCGCTGATGCCCAACATCGAGGCAGCCTTTGCCGCCAACGGATTCTTCTTCATGTTTT
GTAACACCTTTGCGGGGACGCTTTCTCCAAAGCCAGTGACACCCTCGGGTTGGCGCTGGTTTTACAATATCTCTC
CCCTCTTCTATTTGGGCGAGGGTGTCACCGTGGACGTGCTACAAGATTTACCCATCCGATGCGAGCAGTCGGAGG
TTTCAATCTTCTACGCGGCGAATGGCACGACCTGTGGTCAGTATGCCAAGGATTTCCTGGAAATTGCTACGGGAT
ATTTGGTTAATCCCACCAGCACGGCGGAGTGTCAATATTGCCGGTATCGCGACGGACAATCATACGTAAGTCCTA
GTCAGGAGAGAGCAAGGAAATGGATCTGGTCTTGAAACTAATCATCAGTAGTACCAACAATACGGCTATGAGTTT
GCTCATCGGCATCGGAACATTGGCGTTTTCATCGGGTTTATCGCGTTCAATTTCACGATGGTTCTGGTGATGACC
TATCTTACCAAAACACGCCGCCAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail