Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|997
Gene name
LocationContig_137:8834..10650
Strand-
Gene length (bp)1816
Transcript length (bp)1242
Coding sequence length (bp)1242
Protein length (aa) 414

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O60078|TYR1_SCHPO Probable prephenate dehydrogenase [NADP(+)] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tyr1 PE=2 SV=1 2 412 1.0E-152
sp|P20049|TYR1_YEAST Prephenate dehydrogenase [NADP(+)] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TYR1 PE=1 SV=2 5 407 7.0E-140

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4766
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4512
Ophiocordyceps australis map64 (Brazil) OphauB2|3354
Ophiocordyceps camponoti-floridani Ophcf2|01759
Ophiocordyceps camponoti-rufipedis Ophun1|997 (this protein)
Ophiocordyceps kimflemingae Ophio5|4960
Ophiocordyceps subramaniannii Hirsu2|1006

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|997
MEDFVVGLIGMGDMGRMYAERLSAAGWNQKNIDICRNGHLVSRASDFIIYSVEAAAINTVIAHKMGAIVGGQTSC
KSPEIAAFEAHLPSDVSIVSFHSLHGPAVDPHNQPLVIIQHRAPDSAVRTVEEVLGCLRSKFVHLSALEHDRITA
DTQAVTHAAFLSMGKAWHANRQFPWEMSRYVGGMESVKINTMLRIFSQKWHVYAGLAILNPEARKQVAQYAESVT
ALYKLMLEGNLTGLRQRVYAAREKVFFRAPALSSWESGPLIEPAVLSSFSHGLPPDDEDAPPPPPNNHLSLLAMV
DCWAALGIVPYDHMLCSTPLFRLRLGVAEHLFHSTQLLDEALQTAIDDKTYRSDDLEFTFAARSWAECVSLADFE
TWRKRFESTQDFFRPRFAEARVIGERMMRAIVESTKQA*
Coding >Ophun1|997
ATGGAGGACTTCGTCGTCGGCCTCATTGGCATGGGAGACATGGGCAGAATGTATGCCGAGAGGCTCTCGGCTGCT
GGCTGGAATCAGAAGAACATCGACATCTGCCGCAATGGTCACCTCGTGTCCCGCGCCAGCGATTTCATCATCTAT
AGCGTCGAGGCCGCTGCCATCAATACCGTCATCGCCCACAAGATGGGAGCCATTGTTGGCGGCCAGACGTCGTGC
AAGTCTCCCGAGATAGCCGCCTTTGAGGCCCATCTACCGTCCGACGTGTCCATTGTCTCGTTCCATTCCCTTCAT
GGACCAGCCGTCGACCCTCATAACCAACCGCTCGTCATCATTCAGCATCGGGCTCCGGACTCGGCGGTACGGACC
GTTGAAGAGGTTCTCGGCTGTCTACGGTCCAAATTTGTTCATCTGTCGGCGCTGGAGCACGATCGAATCACGGCT
GATACGCAGGCCGTCACCCACGCGGCCTTTTTATCCATGGGCAAAGCCTGGCATGCCAACCGCCAGTTTCCGTGG
GAGATGAGCCGGTACGTGGGCGGGATGGAGAGCGTCAAGATCAACACGATGCTTCGAATCTTTAGCCAGAAGTGG
CACGTCTATGCCGGACTCGCCATCCTCAACCCGGAAGCCCGCAAGCAGGTGGCTCAGTACGCCGAGAGCGTGACG
GCCCTCTACAAGCTGATGCTCGAGGGAAACCTCACAGGCCTTCGTCAGCGCGTCTACGCCGCCCGCGAAAAGGTC
TTCTTCCGCGCACCCGCCCTCTCGTCATGGGAATCTGGCCCTCTCATCGAACCAGCCGTCCTATCATCCTTCTCC
CACGGCCTCCCCCCCGACGACGAAGACGCCCCCCCCCCTCCACCCAACAATCACCTCTCGCTGCTAGCCATGGTC
GACTGCTGGGCGGCCCTCGGCATAGTCCCCTACGACCACATGCTCTGCAGCACGCCCCTCTTCCGCCTCCGCCTC
GGCGTGGCGGAACATCTCTTCCACAGCACGCAGCTTCTCGACGAGGCGCTGCAGACGGCCATCGACGACAAGACG
TACCGCAGCGACGACCTCGAGTTTACGTTTGCGGCCCGGTCTTGGGCTGAGTGCGTTAGCCTGGCGGACTTTGAG
ACGTGGAGGAAGCGGTTTGAGAGTACGCAGGACTTCTTCCGGCCGCGGTTTGCTGAGGCGAGGGTTATTGGTGAG
CGGATGATGAGGGCGATTGTGGAGAGCACGAAGCAGGCGTAG
Transcript >Ophun1|997
ATGGAGGACTTCGTCGTCGGCCTCATTGGCATGGGAGACATGGGCAGAATGTATGCCGAGAGGCTCTCGGCTGCT
GGCTGGAATCAGAAGAACATCGACATCTGCCGCAATGGTCACCTCGTGTCCCGCGCCAGCGATTTCATCATCTAT
AGCGTCGAGGCCGCTGCCATCAATACCGTCATCGCCCACAAGATGGGAGCCATTGTTGGCGGCCAGACGTCGTGC
AAGTCTCCCGAGATAGCCGCCTTTGAGGCCCATCTACCGTCCGACGTGTCCATTGTCTCGTTCCATTCCCTTCAT
GGACCAGCCGTCGACCCTCATAACCAACCGCTCGTCATCATTCAGCATCGGGCTCCGGACTCGGCGGTACGGACC
GTTGAAGAGGTTCTCGGCTGTCTACGGTCCAAATTTGTTCATCTGTCGGCGCTGGAGCACGATCGAATCACGGCT
GATACGCAGGCCGTCACCCACGCGGCCTTTTTATCCATGGGCAAAGCCTGGCATGCCAACCGCCAGTTTCCGTGG
GAGATGAGCCGGTACGTGGGCGGGATGGAGAGCGTCAAGATCAACACGATGCTTCGAATCTTTAGCCAGAAGTGG
CACGTCTATGCCGGACTCGCCATCCTCAACCCGGAAGCCCGCAAGCAGGTGGCTCAGTACGCCGAGAGCGTGACG
GCCCTCTACAAGCTGATGCTCGAGGGAAACCTCACAGGCCTTCGTCAGCGCGTCTACGCCGCCCGCGAAAAGGTC
TTCTTCCGCGCACCCGCCCTCTCGTCATGGGAATCTGGCCCTCTCATCGAACCAGCCGTCCTATCATCCTTCTCC
CACGGCCTCCCCCCCGACGACGAAGACGCCCCCCCCCCTCCACCCAACAATCACCTCTCGCTGCTAGCCATGGTC
GACTGCTGGGCGGCCCTCGGCATAGTCCCCTACGACCACATGCTCTGCAGCACGCCCCTCTTCCGCCTCCGCCTC
GGCGTGGCGGAACATCTCTTCCACAGCACGCAGCTTCTCGACGAGGCGCTGCAGACGGCCATCGACGACAAGACG
TACCGCAGCGACGACCTCGAGTTTACGTTTGCGGCCCGGTCTTGGGCTGAGTGCGTTAGCCTGGCGGACTTTGAG
ACGTGGAGGAAGCGGTTTGAGAGTACGCAGGACTTCTTCCGGCCGCGGTTTGCTGAGGCGAGGGTTATTGGTGAG
CGGATGATGAGGGCGATTGTGGAGAGCACGAAGCAGGCGTAG
Gene >Ophun1|997
ATGGAGGACTTCGTCGTCGGCCTCATTGGCATGGGAGACATGGGCAGAATGTATGCCGAGAGGCTCTCGGCTGCT
GGCTGGAAGTGAGTCCGTTGCGCCGAGGGTTGTGTCTCCCGGTTCAAGAGTGGTAAGATGATGGAGCCCTTTTCT
GTCATTGTCTGTCTCCTCCCCTTCATCGTTGGTGATGACTAGAGCGCATTTGGCTCGAGTTTGGTTCGGGGTCGT
CTGGGGTCCGTTCCGGCTCCTAGGCAATGGCTCCGGGCTACTCGGTGATGAAAACGCTTGCTACCTATTACAACT
TTTTGTCTGACACGATGATTTACACGTTCTGTTTGGTTCTTGTCAAGACTCTGTTCTTCTCTCGTTGCTGTGCTT
GCAATAAGCTGACCGAGTTGCCATCTCACAGGGCAGATGAATAACGTAGACGCTCTATCTTGACAGGATCTTGGC
CTGCGACAGGGAAGATAGATACGATAGCCTGCGAGAGAAATACGCCGAGACAGTACGACCATGATGCCATGTACC
TGTTGCCAACGGTGCTCTGACATGAGAGTCAGAAGAACATCGACATCTGCCGCAATGGTCACCTCGTGTCCCGCG
CCAGCGATTTCATCATCTATAGCGTCGAGGCCGCTGCCATCAATACCGTCATCGCCCAGTACGGTCCTTGTACGA
GTCTCCTCCCTATGACGACGCGTCGACGGGCCATCGCCAGTCTCTCCAGACGCCAGGTTCTGACCGTCGTTGCCG
CCATGTAGCCAGCAAGATGGGAGCCATTGTTGGCGGCCAGACGTCGTGCAAGTCTCCCGAGATAGCCGCCTTTGA
GGCCCATCTACCGTCCGACGTGTCCATTGTCTCGTTCCATTCCCTTCATGGACCAGCCGTCGACCCTCATAACCA
ACCGCTCGTCATCATTCAGCATCGGGCTCCGGACTCGGCGGTACGGACCGTTGAAGAGGTTCTCGGCTGTCTACG
GTCCAAATTTGTTCATCTGTCGGCGCTGGAGCACGATCGAATCACGGCTGATACGCAGGCCGTCACCCACGCGGC
CTTTTTATCCATGGGCAAAGCCTGGCATGCCAACCGCCAGTTTCCGTGGGAGATGAGCCGGTACGTGGGCGGGAT
GGAGAGCGTCAAGATCAACACGATGCTTCGAATCTTTAGCCAGAAGTGGCACGTCTATGCCGGACTCGCCATCCT
CAACCCGGAAGCCCGCAAGCAGGTGGCTCAGTACGCCGAGAGCGTGACGGCCCTCTACAAGCTGATGCTCGAGGG
AAACCTCACAGGCCTTCGTCAGCGCGTCTACGCCGCCCGCGAAAAGGTCTTCTTCCGCGCACCCGCCCTCTCGTC
ATGGGAATCTGGCCCTCTCATCGAACCAGCCGTCCTATCATCCTTCTCCCACGGCCTCCCCCCCGACGACGAAGA
CGCCCCCCCCCCTCCACCCAACAATCACCTCTCGCTGCTAGCCATGGTCGACTGCTGGGCGGCCCTCGGCATAGT
CCCCTACGACCACATGCTCTGCAGCACGCCCCTCTTCCGCCTCCGCCTCGGCGTGGCGGAACATCTCTTCCACAG
CACGCAGCTTCTCGACGAGGCGCTGCAGACGGCCATCGACGACAAGACGTACCGCAGCGACGACCTCGAGTTTAC
GTTTGCGGCCCGGTCTTGGGCTGAGTGCGTTAGCCTGGCGGACTTTGAGACGTGGAGGAAGCGGTTTGAGAGTAC
GCAGGACTTCTTCCGGCCGCGGTTTGCTGAGGCGAGGGTTATTGGTGAGCGGATGATGAGGGCGATTGTGGAGAG
CACGAAGCAGGCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail