Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|995
Gene name
LocationContig_137:4956..6177
Strand-
Gene length (bp)1221
Transcript length (bp)903
Coding sequence length (bp)903
Protein length (aa) 301

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04117 Mpv17_PMP22 Mpv17 / PMP22 family 4.6E-10 203 258

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ZS51|PMP22_ARATH Peroxisomal membrane protein PMP22 OS=Arabidopsis thaliana GN=PMP22 PE=1 SV=1 90 273 6.0E-11
sp|Q54GD8|PX24C_DICDI PXMP2/4 family protein 3 OS=Dictyostelium discoideum GN=DDB_G0290223 PE=3 SV=1 86 266 3.0E-10
sp|Q2KIY1|PXMP2_BOVIN Peroxisomal membrane protein 2 OS=Bos taurus GN=PXMP2 PE=2 SV=3 90 263 5.0E-10
sp|Q54FR4|PX24D_DICDI PXMP2/4 family protein 4 OS=Dictyostelium discoideum GN=DDB_G0290631 PE=3 SV=1 93 262 4.0E-07
sp|Q4IPX8|SYM1_GIBZE Protein SYM1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SYM1 PE=3 SV=1 89 264 3.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ZS51|PMP22_ARATH Peroxisomal membrane protein PMP22 OS=Arabidopsis thaliana GN=PMP22 PE=1 SV=1 90 273 6.0E-11
sp|Q54GD8|PX24C_DICDI PXMP2/4 family protein 3 OS=Dictyostelium discoideum GN=DDB_G0290223 PE=3 SV=1 86 266 3.0E-10
sp|Q2KIY1|PXMP2_BOVIN Peroxisomal membrane protein 2 OS=Bos taurus GN=PXMP2 PE=2 SV=3 90 263 5.0E-10
sp|Q54FR4|PX24D_DICDI PXMP2/4 family protein 4 OS=Dictyostelium discoideum GN=DDB_G0290631 PE=3 SV=1 93 262 4.0E-07
sp|Q4IPX8|SYM1_GIBZE Protein SYM1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SYM1 PE=3 SV=1 89 264 3.0E-06
sp|Q7SCY7|SYM1_NEUCR Protein sym-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=sym-1 PE=3 SV=2 90 259 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

Domain # Start End Length
1 142 164 22
2 177 199 22
3 242 261 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|995
MTAQPQPSIAPNPDNHHPPPLSTAPDDIKPSAMSVKFERETVKQTAQSVLSSAVPEHAGIPGTSGRHPLAERVGT
ALTGGMKSAGTEGYLAAYIKQLESNPLRTKMLTAGSLAGTQELIASWLAKDRNKHGHYFTSRVPKMAAYGAIVSA
PLGHFLIWLLQSVFRGRTSLKAKVMQIVVSNLLIAPIQNSIYLVAMALIAGARTYHQVRATVKVGFWRVMRVSWI
TSPICLAFAQKFLPDELWVPFFNLVSFVIGTYINTVTKKKRLAALRRKHFGDGRNNGMGRSDDYPPPPMGPNPPY
*
Coding >Ophun1|995
ATGACCGCTCAACCTCAGCCCAGCATCGCACCCAACCCCGACAACCACCACCCACCACCCCTCTCAACAGCCCCC
GACGATATCAAGCCCAGCGCCATGTCGGTCAAGTTTGAGCGCGAGACGGTCAAGCAGACGGCCCAGAGCGTCCTC
TCCAGCGCCGTCCCGGAACATGCCGGTATCCCCGGCACCAGCGGACGGCATCCGCTTGCCGAGCGGGTCGGCACT
GCTCTTACGGGGGGGATGAAGAGCGCCGGGACTGAGGGATATCTAGCTGCGTATATCAAGCAGCTCGAGTCCAAC
CCGCTGCGGACCAAGATGCTTACCGCCGGCTCCCTCGCCGGCACGCAGGAGCTCATCGCCTCGTGGCTTGCCAAG
GATCGCAACAAGCACGGCCATTACTTTACCTCTCGCGTCCCCAAGATGGCAGCTTACGGCGCCATCGTCAGCGCG
CCCCTCGGCCATTTCCTCATCTGGCTTCTGCAGAGCGTCTTCCGCGGCCGCACCAGTCTCAAGGCAAAGGTGATG
CAGATTGTCGTCAGCAACTTGCTTATTGCGCCCATTCAAAACAGCATCTATCTGGTCGCCATGGCTCTGATCGCC
GGCGCTCGCACCTATCATCAGGTCCGCGCCACCGTCAAGGTTGGCTTCTGGCGAGTCATGCGCGTCTCATGGATC
ACATCGCCCATCTGCCTCGCCTTTGCGCAAAAGTTCCTCCCCGATGAGCTCTGGGTTCCCTTCTTCAACCTCGTG
TCCTTTGTCATCGGCACCTACATCAACACCGTCACCAAGAAGAAGCGCCTCGCCGCCCTCCGAAGGAAACACTTT
GGCGACGGCCGCAACAACGGCATGGGCCGATCCGACGATTATCCTCCGCCACCCATGGGACCCAACCCGCCTTAC
TAG
Transcript >Ophun1|995
ATGACCGCTCAACCTCAGCCCAGCATCGCACCCAACCCCGACAACCACCACCCACCACCCCTCTCAACAGCCCCC
GACGATATCAAGCCCAGCGCCATGTCGGTCAAGTTTGAGCGCGAGACGGTCAAGCAGACGGCCCAGAGCGTCCTC
TCCAGCGCCGTCCCGGAACATGCCGGTATCCCCGGCACCAGCGGACGGCATCCGCTTGCCGAGCGGGTCGGCACT
GCTCTTACGGGGGGGATGAAGAGCGCCGGGACTGAGGGATATCTAGCTGCGTATATCAAGCAGCTCGAGTCCAAC
CCGCTGCGGACCAAGATGCTTACCGCCGGCTCCCTCGCCGGCACGCAGGAGCTCATCGCCTCGTGGCTTGCCAAG
GATCGCAACAAGCACGGCCATTACTTTACCTCTCGCGTCCCCAAGATGGCAGCTTACGGCGCCATCGTCAGCGCG
CCCCTCGGCCATTTCCTCATCTGGCTTCTGCAGAGCGTCTTCCGCGGCCGCACCAGTCTCAAGGCAAAGGTGATG
CAGATTGTCGTCAGCAACTTGCTTATTGCGCCCATTCAAAACAGCATCTATCTGGTCGCCATGGCTCTGATCGCC
GGCGCTCGCACCTATCATCAGGTCCGCGCCACCGTCAAGGTTGGCTTCTGGCGAGTCATGCGCGTCTCATGGATC
ACATCGCCCATCTGCCTCGCCTTTGCGCAAAAGTTCCTCCCCGATGAGCTCTGGGTTCCCTTCTTCAACCTCGTG
TCCTTTGTCATCGGCACCTACATCAACACCGTCACCAAGAAGAAGCGCCTCGCCGCCCTCCGAAGGAAACACTTT
GGCGACGGCCGCAACAACGGCATGGGCCGATCCGACGATTATCCTCCGCCACCCATGGGACCCAACCCGCCTTAC
TAG
Gene >Ophun1|995
ATGACCGCTCAAGTATGTATTCGCAGATTCAATAGTAAACCCCCAGCCAAGTCTTTAAACCCACCCGCCAAAACC
CCGACGAACCCTGCAGATCGGCGCCTCCAGCGGATAGATACCTCTAGTGTTGAATCGGTGATACACAGACGGGTA
TTACGTGAGCCAACCCCAGCAAGGTAAACAAACTCATTGGCCAGCCTCAGCCCAGCATCGCACCCAACCCCGACA
ACCACCACCCACCACCCCTCTCAACAGCCCCCGACGATATCAAGCCCAGCGCCATGTCGGTCAAGTTTGAGCGCG
AGACGGTCAAGCAGACGGCCCAGAGCGTCCTCTCCAGCGCCGTCCCGGAACATGCCGGTATCCCCGGCACCAGCG
GACGGCATCCGCTTGCCGAGCGGGTCGGCACTGCTCTTACGGGGGGGATGAAGAGCGCCGGGACTGAGGGATATC
TAGCTGTATGTCCCAAGCTTCATTCACCCTCTTCCTTCTTCCACCAGTACATCAAAACTGACGTGCTCTTCTCCG
TAGGCGTATATCAAGCAGCTCGAGTCCAACCCGCTGCGGACCAAGATGCTTACCGCCGGCTCCCTCGCCGGCACG
CAGGAGCTCATCGCCTCGTGGCTTGCCAAGGATCGCAACAAGCACGGCCATTACTTTACCTCTCGCGTCCCCAAG
ATGGCAGCTTACGGCGCCATCGTCAGCGCGCCCCTCGGCCATTTCCTCATCTGGCTTCTGCAGAGCGTCTTCCGC
GGCCGCACCAGTCTCAAGGCAAAGGTGATGCAGATTGTCGTCAGCAACTTGCTTGTACGTTCCCTTTTTGGACAA
TTTGAACCTCTTGGATCCCTCGAACCCGACTGACGGCTTTAGATTGCGCCCATTCAAAACAGCATCTATCTGGTC
GCCATGGCTCTGATCGCCGGCGCTCGCACCTATCATCAGGTCCGCGCCACCGTCAAGGTTGGCTTCTGGCGAGTC
ATGCGCGTCTCATGGATCACATCGCCCATCTGCCTCGCCTTTGCGCAAAAGTTCCTCCCCGATGAGCTCTGGGTT
CCCTTCTTCAACCTCGTGTCCTTTGTCATCGGCACCTACATCAACACCGTCACCAAGAAGAAGCGCCTCGCCGCC
CTCCGAAGGAAACACTTTGGCGACGGCCGCAACAACGGCATGGGCCGATCCGACGATTATCCTCCGCCACCCATG
GGACCCAACCCGCCTTACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail