Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|992
Gene name
LocationContig_137:112..1377
Strand-
Gene length (bp)1265
Transcript length (bp)1167
Coding sequence length (bp)1167
Protein length (aa) 389

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00749 tRNA-synt_1c tRNA synthetases class I (E and Q), catalytic domain 1.1E-81 80 362

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B3QYR1|SYE_CHLT3 Glutamate--tRNA ligase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=gltX PE=3 SV=1 76 353 2.0E-88
sp|Q9F724|SYE_CHLTE Glutamate--tRNA ligase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=gltX PE=3 SV=2 76 360 1.0E-85
sp|Q3B256|SYE_CHLL7 Glutamate--tRNA ligase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=gltX PE=3 SV=1 78 353 4.0E-85
sp|Q66JG3|SYEM_XENTR Probable glutamate--tRNA ligase, mitochondrial OS=Xenopus tropicalis GN=ears2 PE=2 SV=1 51 385 5.0E-85
sp|B3QQC6|SYE_CHLP8 Glutamate--tRNA ligase OS=Chlorobaculum parvum (strain NCIB 8327) GN=gltX PE=3 SV=2 76 360 5.0E-85
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B3QYR1|SYE_CHLT3 Glutamate--tRNA ligase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=gltX PE=3 SV=1 76 353 2.0E-88
sp|Q9F724|SYE_CHLTE Glutamate--tRNA ligase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=gltX PE=3 SV=2 76 360 1.0E-85
sp|Q3B256|SYE_CHLL7 Glutamate--tRNA ligase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=gltX PE=3 SV=1 78 353 4.0E-85
sp|Q66JG3|SYEM_XENTR Probable glutamate--tRNA ligase, mitochondrial OS=Xenopus tropicalis GN=ears2 PE=2 SV=1 51 385 5.0E-85
sp|B3QQC6|SYE_CHLP8 Glutamate--tRNA ligase OS=Chlorobaculum parvum (strain NCIB 8327) GN=gltX PE=3 SV=2 76 360 5.0E-85
sp|O84451|SYE_CHLTR Glutamate--tRNA ligase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=gltX PE=3 SV=1 80 377 5.0E-85
sp|Q3KLQ4|SYE_CHLTA Glutamate--tRNA ligase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=gltX PE=3 SV=1 80 377 5.0E-85
sp|P59690|SYE_CHLCV Glutamate--tRNA ligase OS=Chlamydophila caviae (strain GPIC) GN=gltX PE=3 SV=1 80 374 6.0E-85
sp|B0BC83|SYE_CHLTB Glutamate--tRNA ligase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=gltX PE=3 SV=1 80 377 8.0E-85
sp|B0B818|SYE_CHLT2 Glutamate--tRNA ligase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=gltX PE=3 SV=1 80 377 8.0E-85
sp|Q9Z7Z3|SYE_CHLPN Glutamate--tRNA ligase OS=Chlamydia pneumoniae GN=gltX PE=3 SV=1 80 364 9.0E-85
sp|Q9PJU7|SYE_CHLMU Glutamate--tRNA ligase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=gltX PE=3 SV=1 80 377 1.0E-84
sp|A5WBQ0|SYE_PSYWF Glutamate--tRNA ligase OS=Psychrobacter sp. (strain PRwf-1) GN=gltX PE=3 SV=1 75 364 3.0E-84
sp|Q72LI9|SYE_THET2 Glutamate--tRNA ligase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=gltX PE=3 SV=1 80 377 3.0E-84
sp|P27000|SYE_THET8 Glutamate--tRNA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=gltX PE=1 SV=2 80 377 3.0E-84
sp|Q5ZJ66|SYEM_CHICK Probable glutamate--tRNA ligase, mitochondrial OS=Gallus gallus GN=EARS2 PE=2 SV=1 69 374 9.0E-84
sp|B4SCV6|SYE_PELPB Glutamate--tRNA ligase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=gltX PE=3 SV=1 80 360 2.0E-83
sp|P59691|SYE_CHLP6 Glutamate--tRNA ligase OS=Chlamydophila psittaci (strain ATCC VR-125 / 6BC) GN=gltX PE=3 SV=2 80 374 2.0E-83
sp|Q3ATL0|SYE_CHLCH Glutamate--tRNA ligase OS=Chlorobium chlorochromatii (strain CaD3) GN=gltX PE=3 SV=1 80 353 3.0E-83
sp|Q5L6T4|SYE_CHLAB Glutamate--tRNA ligase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=gltX PE=3 SV=1 80 374 4.0E-83
sp|Q73R87|SYE_TREDE Glutamate--tRNA ligase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=gltX PE=3 SV=1 80 376 1.0E-82
sp|P15189|SYE_RHIME Glutamate--tRNA ligase OS=Rhizobium meliloti (strain 1021) GN=gltX PE=3 SV=2 76 355 2.0E-82
sp|B3EFG9|SYE_CHLL2 Glutamate--tRNA ligase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=gltX PE=3 SV=1 80 353 2.0E-82
sp|Q253E2|SYE_CHLFF Glutamate--tRNA ligase OS=Chlamydophila felis (strain Fe/C-56) GN=gltX PE=3 SV=1 80 374 3.0E-82
sp|A4SGA5|SYE_CHLPM Glutamate--tRNA ligase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=gltX PE=3 SV=1 62 353 4.0E-82
sp|Q6MEN1|SYE_PARUW Glutamate--tRNA ligase OS=Protochlamydia amoebophila (strain UWE25) GN=gltX PE=3 SV=1 80 380 6.0E-82
sp|A6UD99|SYE_SINMW Glutamate--tRNA ligase OS=Sinorhizobium medicae (strain WSM419) GN=gltX PE=3 SV=1 76 355 3.0E-81
sp|Q4FQ04|SYE_PSYA2 Glutamate--tRNA ligase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=gltX PE=3 SV=1 75 365 4.0E-81
sp|A5FPX2|SYE_DEHMB Glutamate--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=gltX PE=3 SV=1 80 376 4.0E-81
sp|Q0P499|SYEM_DANRE Probable glutamate--tRNA ligase, mitochondrial OS=Danio rerio GN=ears2 PE=2 SV=1 80 376 6.0E-81
sp|B4S404|SYE_PROA2 Glutamate--tRNA ligase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=gltX PE=3 SV=1 80 380 6.0E-81
sp|Q2K425|SYE_RHIEC Glutamate--tRNA ligase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=gltX PE=3 SV=1 80 355 2.0E-80
sp|Q1Q845|SYE_PSYCK Glutamate--tRNA ligase OS=Psychrobacter cryohalolentis (strain K5) GN=gltX PE=3 SV=1 78 374 3.0E-80
sp|Q0AYF8|SYE1_SYNWW Glutamate--tRNA ligase 1 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=gltX1 PE=3 SV=1 80 364 3.0E-80
sp|B5ZQW4|SYE_RHILW Glutamate--tRNA ligase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=gltX PE=3 SV=1 80 355 3.0E-80
sp|A1BDK8|SYE_CHLPD Glutamate--tRNA ligase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=gltX PE=3 SV=1 81 353 4.0E-80
sp|Q1MBL0|SYE_RHIL3 Glutamate--tRNA ligase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=gltX PE=3 SV=1 80 355 5.0E-80
sp|B3Q0S3|SYE_RHIE6 Glutamate--tRNA ligase OS=Rhizobium etli (strain CIAT 652) GN=gltX PE=3 SV=1 80 355 6.0E-80
sp|Q3ZYP4|SYE_DEHMC Glutamate--tRNA ligase OS=Dehalococcoides mccartyi (strain CBDB1) GN=gltX PE=3 SV=1 80 376 6.0E-80
sp|Q8U7H5|SYE_AGRFC Glutamate--tRNA ligase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=gltX PE=3 SV=2 80 355 1.0E-79
sp|B2S3R2|SYE_TREPS Glutamate--tRNA ligase OS=Treponema pallidum subsp. pallidum (strain SS14) GN=gltX PE=3 SV=1 80 361 1.0E-79
sp|O83679|SYE_TREPA Glutamate--tRNA ligase OS=Treponema pallidum (strain Nichols) GN=gltX PE=3 SV=1 80 361 1.0E-79
sp|Q3Z6S3|SYE_DEHM1 Glutamate--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=gltX PE=3 SV=1 80 361 3.0E-79
sp|Q9CXJ1|SYEM_MOUSE Probable glutamate--tRNA ligase, mitochondrial OS=Mus musculus GN=Ears2 PE=1 SV=1 72 361 2.0E-78
sp|Q8EYM3|SYE_LEPIN Glutamate--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=gltX PE=3 SV=1 78 384 2.0E-78
sp|Q72M46|SYE_LEPIC Glutamate--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=gltX PE=3 SV=1 78 384 2.0E-78
sp|Q18CD6|SYE_PEPD6 Glutamate--tRNA ligase OS=Peptoclostridium difficile (strain 630) GN=gltX PE=3 SV=1 80 360 3.0E-78
sp|A8MLB5|SYE_ALKOO Glutamate--tRNA ligase OS=Alkaliphilus oremlandii (strain OhILAs) GN=gltX PE=3 SV=1 80 374 3.0E-78
sp|B0V8Q3|SYE_ACIBY Glutamate--tRNA ligase OS=Acinetobacter baumannii (strain AYE) GN=gltX PE=3 SV=1 80 376 4.0E-78
sp|B2I0L0|SYE_ACIBC Glutamate--tRNA ligase OS=Acinetobacter baumannii (strain ACICU) GN=gltX PE=3 SV=1 80 376 4.0E-78
sp|B0S0W2|SYE_FINM2 Glutamate--tRNA ligase OS=Finegoldia magna (strain ATCC 29328) GN=gltX PE=3 SV=1 79 374 4.0E-78
sp|B0VPF6|SYE_ACIBS Glutamate--tRNA ligase OS=Acinetobacter baumannii (strain SDF) GN=gltX PE=3 SV=1 80 376 5.0E-78
sp|Q1AS60|SYE2_RUBXD Glutamate--tRNA ligase 2 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=gltX2 PE=3 SV=1 75 364 8.0E-78
sp|Q8RDZ8|SYE_FUSNN Glutamate--tRNA ligase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=gltX PE=3 SV=2 78 361 1.0E-77
sp|B3EMG1|SYE_CHLPB Glutamate--tRNA ligase OS=Chlorobium phaeobacteroides (strain BS1) GN=gltX PE=3 SV=1 80 358 2.0E-77
sp|Q6F7C8|SYE_ACIAD Glutamate--tRNA ligase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=gltX PE=3 SV=1 80 379 2.0E-77
sp|Q5JPH6|SYEM_HUMAN Probable glutamate--tRNA ligase, mitochondrial OS=Homo sapiens GN=EARS2 PE=1 SV=2 72 364 2.0E-77
sp|Q4R4F1|SYEM_MACFA Probable glutamate--tRNA ligase, mitochondrial OS=Macaca fascicularis GN=EARS2 PE=2 SV=1 72 364 3.0E-77
sp|Q2SK84|SYE_HAHCH Glutamate--tRNA ligase OS=Hahella chejuensis (strain KCTC 2396) GN=gltX PE=3 SV=1 80 376 4.0E-77
sp|O51345|SYE_BORBU Glutamate--tRNA ligase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=gltX PE=1 SV=1 81 388 5.0E-77
sp|B0KCH7|SYE1_THEP3 Glutamate--tRNA ligase 1 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=gltX1 PE=3 SV=1 80 360 2.0E-76
sp|Q8YAB3|SYE_LISMO Glutamate--tRNA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=gltX PE=3 SV=1 75 360 2.0E-76
sp|Q661P7|SYE_BORBP Glutamate--tRNA ligase OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=gltX PE=3 SV=1 80 361 2.0E-76
sp|Q2RJE3|SYE_MOOTA Glutamate--tRNA ligase OS=Moorella thermoacetica (strain ATCC 39073) GN=gltX PE=3 SV=1 80 360 2.0E-76
sp|Q0SNE1|SYE_BORAP Glutamate--tRNA ligase OS=Borrelia afzelii (strain PKo) GN=gltX PE=3 SV=1 80 388 3.0E-76
sp|Q055X5|SYE_LEPBL Glutamate--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=gltX PE=3 SV=1 75 384 3.0E-76
sp|Q04PF0|SYE_LEPBJ Glutamate--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=gltX PE=3 SV=1 75 384 3.0E-76
sp|B0K5F4|SYE1_THEPX Glutamate--tRNA ligase 1 OS=Thermoanaerobacter sp. (strain X514) GN=gltX1 PE=3 SV=1 80 360 3.0E-76
sp|B5RRI1|SYE_BORRA Glutamate--tRNA ligase OS=Borrelia recurrentis (strain A1) GN=gltX PE=3 SV=1 80 383 3.0E-76
sp|A6TWK7|SYE_ALKMQ Glutamate--tRNA ligase OS=Alkaliphilus metalliredigens (strain QYMF) GN=gltX PE=3 SV=1 78 360 4.0E-76
sp|Q43768|SYE_HORVU Glutamate--tRNA ligase, chloroplastic/mitochondrial OS=Hordeum vulgare PE=2 SV=1 68 358 5.0E-76
sp|A4J0Y7|SYE_DESRM Glutamate--tRNA ligase OS=Desulfotomaculum reducens (strain MI-1) GN=gltX PE=3 SV=1 80 360 6.0E-76
sp|B5Y7R0|SYE_COPPD Glutamate--tRNA ligase OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=gltX PE=3 SV=1 80 364 8.0E-76
sp|Q97KC9|SYE_CLOAB Glutamate--tRNA ligase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=gltX PE=3 SV=1 76 379 8.0E-76
sp|B2S076|SYE_BORHD Glutamate--tRNA ligase OS=Borrelia hermsii (strain HS1 / DAH) GN=gltX PE=3 SV=1 80 383 9.0E-76
sp|Q8R7T1|SYE2_CALS4 Glutamate--tRNA ligase 2 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=gltX2 PE=3 SV=1 78 357 1.0E-75
sp|Q3A9N9|SYE_CARHZ Glutamate--tRNA ligase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=gltX PE=3 SV=1 80 360 1.0E-75
sp|B3PD15|SYE_CELJU Glutamate--tRNA ligase OS=Cellvibrio japonicus (strain Ueda107) GN=gltX PE=3 SV=1 80 364 2.0E-75
sp|B1IIG7|SYE_CLOBK Glutamate--tRNA ligase OS=Clostridium botulinum (strain Okra / Type B1) GN=gltX PE=3 SV=1 80 358 3.0E-75
sp|A4XHE0|SYE1_CALS8 Glutamate--tRNA ligase 1 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=gltX1 PE=3 SV=1 80 360 3.0E-75
sp|B1KYV1|SYE_CLOBM Glutamate--tRNA ligase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=gltX PE=3 SV=1 80 358 3.0E-75
sp|A7GCD9|SYE_CLOBL Glutamate--tRNA ligase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=gltX PE=3 SV=1 80 358 3.0E-75
sp|A5I0T6|SYE_CLOBH Glutamate--tRNA ligase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=gltX PE=3 SV=1 80 358 3.0E-75
sp|A7FSY9|SYE_CLOB1 Glutamate--tRNA ligase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=gltX PE=3 SV=1 80 358 3.0E-75
sp|A6VZB3|SYE_MARMS Glutamate--tRNA ligase OS=Marinomonas sp. (strain MWYL1) GN=gltX PE=3 SV=1 80 376 4.0E-75
sp|Q724H5|SYE_LISMF Glutamate--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=gltX PE=3 SV=1 75 360 6.0E-75
sp|Q896M5|SYE_CLOTE Glutamate--tRNA ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=gltX PE=3 SV=2 80 353 8.0E-75
sp|B0TBU3|SYE_HELMI Glutamate--tRNA ligase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=gltX PE=3 SV=1 80 360 1.0E-74
sp|Q0VPE1|SYE_ALCBS Glutamate--tRNA ligase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=gltX PE=3 SV=1 80 377 1.0E-74
sp|Q9HDX9|SYEM_SCHPO Glutamate--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mse1 PE=3 SV=1 80 360 2.0E-74
sp|A5N867|SYE_CLOK5 Glutamate--tRNA ligase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=gltX PE=3 SV=1 80 358 3.0E-74
sp|A9WAX3|SYE_CHLAA Glutamate--tRNA ligase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=gltX PE=3 SV=1 75 361 4.0E-74
sp|B2V5J1|SYE_SULSY Glutamate--tRNA ligase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=gltX PE=3 SV=1 81 358 4.0E-74
sp|B5RLR1|SYE_BORDL Glutamate--tRNA ligase OS=Borrelia duttonii (strain Ly) GN=gltX PE=3 SV=1 80 383 5.0E-74
sp|B2TND7|SYE_CLOBB Glutamate--tRNA ligase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=gltX PE=3 SV=1 76 358 5.0E-74
sp|Q21KM1|SYE_SACD2 Glutamate--tRNA ligase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=gltX PE=3 SV=1 80 374 5.0E-74
sp|A4XLI3|SYE2_CALS8 Glutamate--tRNA ligase 2 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=gltX2 PE=3 SV=1 80 380 5.0E-74
sp|B2V5H4|SYE_CLOBA Glutamate--tRNA ligase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=gltX PE=3 SV=1 76 353 8.0E-74
sp|A1U1V3|SYE_MARHV Glutamate--tRNA ligase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=gltX PE=3 SV=1 80 374 9.0E-74
sp|A5W6Z7|SYE_PSEP1 Glutamate--tRNA ligase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=gltX PE=3 SV=1 80 376 2.0E-73
sp|B1I4Z1|SYE_DESAP Glutamate--tRNA ligase OS=Desulforudis audaxviator (strain MP104C) GN=gltX PE=3 SV=1 80 360 2.0E-73
sp|Q88LF6|SYE_PSEPK Glutamate--tRNA ligase OS=Pseudomonas putida (strain KT2440) GN=gltX PE=3 SV=1 80 376 2.0E-73
sp|A5D5L8|SYE_PELTS Glutamate--tRNA ligase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=gltX PE=3 SV=1 80 360 3.0E-73
sp|A0PZ93|SYE_CLONN Glutamate--tRNA ligase OS=Clostridium novyi (strain NT) GN=gltX PE=3 SV=1 78 353 3.0E-73
sp|B0KF73|SYE_PSEPG Glutamate--tRNA ligase OS=Pseudomonas putida (strain GB-1) GN=gltX PE=3 SV=1 80 376 4.0E-73
sp|B1J522|SYE_PSEPW Glutamate--tRNA ligase OS=Pseudomonas putida (strain W619) GN=gltX PE=3 SV=1 80 376 5.0E-73
sp|O67271|SYE_AQUAE Glutamate--tRNA ligase OS=Aquifex aeolicus (strain VF5) GN=gltX PE=3 SV=1 80 360 5.0E-73
sp|Q5L431|SYE_GEOKA Glutamate--tRNA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=gltX PE=3 SV=1 78 360 7.0E-73
sp|B5YIG1|SYE_THEYD Glutamate--tRNA ligase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=gltX PE=3 SV=1 80 361 8.0E-73
sp|A9KRX7|SYE_CLOPH Glutamate--tRNA ligase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=gltX PE=3 SV=1 80 380 2.0E-72
sp|Q4ZV02|SYE_PSEU2 Glutamate--tRNA ligase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=gltX PE=3 SV=1 80 376 3.0E-72
sp|Q92F38|SYE_LISIN Glutamate--tRNA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=gltX PE=3 SV=1 75 360 3.0E-72
sp|A4VNT7|SYE_PSEU5 Glutamate--tRNA ligase OS=Pseudomonas stutzeri (strain A1501) GN=gltX PE=3 SV=1 80 376 3.0E-72
sp|A7HKV0|SYE1_FERNB Glutamate--tRNA ligase 1 OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=gltX1 PE=3 SV=1 80 360 3.0E-72
sp|Q839V7|SYE_ENTFA Glutamate--tRNA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=gltX PE=3 SV=1 80 360 5.0E-72
sp|A5IMM2|SYE2_THEP1 Glutamate--tRNA ligase 2 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=gltX2 PE=3 SV=1 80 383 5.0E-72
sp|Q9X172|SYE1_THEMA Glutamate--tRNA ligase 1 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=gltX1 PE=1 SV=1 80 383 5.0E-72
sp|Q1ICW8|SYE_PSEE4 Glutamate--tRNA ligase OS=Pseudomonas entomophila (strain L48) GN=gltX PE=3 SV=1 80 376 6.0E-72
sp|Q48KA5|SYE_PSE14 Glutamate--tRNA ligase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=gltX PE=3 SV=1 80 376 8.0E-72
sp|Q4KF16|SYE_PSEF5 Glutamate--tRNA ligase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=gltX PE=3 SV=1 80 376 1.0E-71
sp|Q884C8|SYE_PSESM Glutamate--tRNA ligase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=gltX PE=3 SV=1 80 376 1.0E-71
sp|Q43794|SYE_TOBAC Glutamate--tRNA ligase, chloroplastic/mitochondrial OS=Nicotiana tabacum PE=2 SV=1 55 358 1.0E-71
sp|Q2LUT2|SYE2_SYNAS Glutamate--tRNA ligase 2 OS=Syntrophus aciditrophicus (strain SB) GN=gltX2 PE=3 SV=1 75 361 2.0E-71
sp|Q1IY50|SYE_DEIGD Glutamate--tRNA ligase OS=Deinococcus geothermalis (strain DSM 11300) GN=gltX PE=3 SV=1 80 358 2.0E-71
sp|Q0AUF7|SYE2_SYNWW Glutamate--tRNA ligase 2 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=gltX2 PE=3 SV=1 73 360 3.0E-71
sp|Q3KF35|SYE_PSEPF Glutamate--tRNA ligase OS=Pseudomonas fluorescens (strain Pf0-1) GN=gltX PE=3 SV=2 80 376 3.0E-71
sp|B5YEP5|SYE_DICT6 Glutamate--tRNA ligase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=gltX PE=3 SV=1 80 358 3.0E-71
sp|A9AXJ1|SYE_HERA2 Glutamate--tRNA ligase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=gltX PE=3 SV=1 79 376 3.0E-71
sp|A6V2T9|SYE_PSEA7 Glutamate--tRNA ligase OS=Pseudomonas aeruginosa (strain PA7) GN=gltX PE=3 SV=1 80 364 3.0E-71
sp|A8F597|SYE1_PSELT Glutamate--tRNA ligase 1 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=gltX1 PE=3 SV=1 80 376 3.0E-71
sp|A6LJ42|SYE1_THEM4 Glutamate--tRNA ligase 1 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=gltX1 PE=3 SV=1 80 377 4.0E-71
sp|A8F960|SYE_BACP2 Glutamate--tRNA ligase OS=Bacillus pumilus (strain SAFR-032) GN=gltX PE=3 SV=1 80 383 4.0E-71
sp|B4U896|SYE_HYDS0 Glutamate--tRNA ligase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=gltX PE=3 SV=1 80 360 4.0E-71
sp|B1LBX4|SYE2_THESQ Glutamate--tRNA ligase 2 OS=Thermotoga sp. (strain RQ2) GN=gltX2 PE=3 SV=1 80 383 5.0E-71
sp|Q9XCL6|SYE_PSEAE Glutamate--tRNA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gltX PE=3 SV=2 80 364 9.0E-71
sp|Q02PU7|SYE_PSEAB Glutamate--tRNA ligase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=gltX PE=3 SV=1 80 364 1.0E-70
sp|Q1IVB1|SYE2_KORVE Glutamate--tRNA ligase 2 OS=Koribacter versatilis (strain Ellin345) GN=gltX2 PE=3 SV=1 72 359 1.0E-70
sp|B2KAV3|SYE_ELUMP Glutamate--tRNA ligase OS=Elusimicrobium minutum (strain Pei191) GN=gltX PE=3 SV=1 80 383 2.0E-70
sp|Q1IVP4|SYE1_KORVE Glutamate--tRNA ligase 1 OS=Koribacter versatilis (strain Ellin345) GN=gltX1 PE=3 SV=1 76 358 2.0E-70
sp|A4XVX2|SYE_PSEMY Glutamate--tRNA ligase OS=Pseudomonas mendocina (strain ymp) GN=gltX PE=3 SV=1 80 376 3.0E-70
sp|Q67TJ2|SYE_SYMTH Glutamate--tRNA ligase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=gltX PE=3 SV=1 80 379 3.0E-70
sp|A4IJG6|SYE_GEOTN Glutamate--tRNA ligase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=gltX PE=3 SV=1 78 360 3.0E-70
sp|A0AF36|SYE_LISW6 Glutamate--tRNA ligase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=gltX PE=3 SV=1 75 360 3.0E-70
sp|Q2S1L8|SYE_SALRD Glutamate--tRNA ligase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=gltX PE=3 SV=2 75 360 4.0E-70
sp|P48525|SYEM_YEAST Glutamate--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSE1 PE=1 SV=2 79 360 4.0E-70
sp|Q65PD0|SYE_BACLD Glutamate--tRNA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=gltX PE=3 SV=1 80 388 5.0E-70
sp|Q1QY92|SYE_CHRSD Glutamate--tRNA ligase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=gltX PE=3 SV=1 80 374 7.0E-70
sp|Q9RX30|SYE_DEIRA Glutamate--tRNA ligase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=gltX PE=3 SV=2 79 358 3.0E-69
sp|B3ERQ7|SYE_AMOA5 Glutamate--tRNA ligase OS=Amoebophilus asiaticus (strain 5a2) GN=gltX PE=3 SV=1 77 360 4.0E-69
sp|B2A4B3|SYE_NATTJ Glutamate--tRNA ligase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=gltX PE=3 SV=1 81 360 6.0E-69
sp|Q9FEA2|SYEM_ARATH Glutamate--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=OVA3 PE=2 SV=1 80 358 2.0E-68
sp|A5G3W1|SYE_GEOUR Glutamate--tRNA ligase OS=Geobacter uraniireducens (strain Rf4) GN=gltX PE=3 SV=1 80 375 2.0E-68
sp|A9BGT8|SYE2_PETMO Glutamate--tRNA ligase 2 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=gltX2 PE=3 SV=1 80 360 2.0E-68
sp|B0K403|SYE2_THEPX Glutamate--tRNA ligase 2 OS=Thermoanaerobacter sp. (strain X514) GN=gltX2 PE=3 SV=1 80 358 3.0E-68
sp|P22249|SYE_GEOSE Glutamate--tRNA ligase OS=Geobacillus stearothermophilus GN=gltX PE=3 SV=1 78 360 3.0E-68
sp|B0KAA6|SYE2_THEP3 Glutamate--tRNA ligase 2 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=gltX2 PE=3 SV=1 80 358 3.0E-68
sp|A7NLL2|SYE_ROSCS Glutamate--tRNA ligase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=gltX PE=3 SV=1 79 361 4.0E-68
sp|B1H0J3|SYE_UNCTG Glutamate--tRNA ligase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=gltX PE=3 SV=1 80 374 4.0E-68
sp|B1LAE7|SYE1_THESQ Glutamate--tRNA ligase 1 OS=Thermotoga sp. (strain RQ2) GN=gltX1 PE=3 SV=1 80 364 5.0E-68
sp|B1HNM5|SYE_LYSSC Glutamate--tRNA ligase OS=Lysinibacillus sphaericus (strain C3-41) GN=gltX PE=3 SV=1 78 360 6.0E-68
sp|A5IL67|SYE1_THEP1 Glutamate--tRNA ligase 1 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=gltX1 PE=3 SV=1 80 364 6.0E-68
sp|A0LSS7|SYE_ACIC1 Glutamate--tRNA ligase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=gltX PE=3 SV=1 80 375 7.0E-68
sp|A7Z0L4|SYE_BACMF Glutamate--tRNA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=gltX PE=3 SV=1 80 360 7.0E-68
sp|Q8RB93|SYE1_CALS4 Glutamate--tRNA ligase 1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=gltX1 PE=3 SV=1 80 358 7.0E-68
sp|Q3IHK6|SYE_PSEHT Glutamate--tRNA ligase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=gltX PE=3 SV=1 80 374 8.0E-68
sp|A1AUQ6|SYE_PELPD Glutamate--tRNA ligase OS=Pelobacter propionicus (strain DSM 2379) GN=gltX PE=3 SV=1 80 383 8.0E-68
sp|A7H9S6|SYE_ANADF Glutamate--tRNA ligase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=gltX PE=3 SV=1 77 360 9.0E-68
sp|Q74DU6|SYE_GEOSL Glutamate--tRNA ligase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=gltX PE=3 SV=1 80 360 1.0E-67
sp|Q9X2I8|SYE2_THEMA Glutamate--tRNA ligase 2 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=gltX2 PE=1 SV=1 80 364 1.0E-67
sp|Q1D8Y1|SYE_MYXXD Glutamate--tRNA ligase OS=Myxococcus xanthus (strain DK 1622) GN=gltX PE=3 SV=1 80 370 3.0E-67
sp|B3E399|SYE_GEOLS Glutamate--tRNA ligase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=gltX PE=3 SV=1 80 383 9.0E-67
sp|Q38YY5|SYE_LACSS Glutamate--tRNA ligase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=gltX PE=3 SV=1 76 360 1.0E-66
sp|Q07ZL0|SYE_SHEFN Glutamate--tRNA ligase OS=Shewanella frigidimarina (strain NCIMB 400) GN=gltX PE=3 SV=1 81 360 1.0E-66
sp|A5UTY2|SYE_ROSS1 Glutamate--tRNA ligase OS=Roseiflexus sp. (strain RS-1) GN=gltX PE=3 SV=1 79 361 1.0E-66
sp|A0M6K0|SYE_GRAFK Glutamate--tRNA ligase OS=Gramella forsetii (strain KT0803) GN=gltX PE=3 SV=1 80 384 2.0E-66
sp|Q9KGF6|SYE_BACHD Glutamate--tRNA ligase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=gltX PE=3 SV=1 80 360 2.0E-66
sp|A6H2H7|SYE_FLAPJ Glutamate--tRNA ligase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=gltX PE=3 SV=1 78 374 3.0E-66
sp|Q250Q8|SYE_DESHY Glutamate--tRNA ligase OS=Desulfitobacterium hafniense (strain Y51) GN=gltX PE=3 SV=1 80 360 4.0E-66
sp|P22250|SYE_BACSU Glutamate--tRNA ligase OS=Bacillus subtilis (strain 168) GN=gltX PE=3 SV=1 80 360 5.0E-66
sp|Q5WLT5|SYE_BACSK Glutamate--tRNA ligase OS=Bacillus clausii (strain KSM-K16) GN=gltX PE=3 SV=1 78 353 5.0E-66
sp|Q1WSS4|SYE_LACS1 Glutamate--tRNA ligase OS=Lactobacillus salivarius (strain UCC118) GN=gltX PE=3 SV=1 76 360 9.0E-66
sp|A1SVA7|SYE_PSYIN Glutamate--tRNA ligase OS=Psychromonas ingrahamii (strain 37) GN=gltX PE=3 SV=1 80 388 1.0E-65
sp|B0SKQ2|SYE_LEPBP Glutamate--tRNA ligase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=gltX PE=3 SV=1 80 387 1.0E-65
sp|B0SCM4|SYE_LEPBA Glutamate--tRNA ligase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=gltX PE=3 SV=1 80 387 1.0E-65
sp|B1YGS7|SYE_EXIS2 Glutamate--tRNA ligase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=gltX PE=3 SV=1 80 383 2.0E-65
sp|A6L0E8|SYE_BACV8 Glutamate--tRNA ligase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=gltX PE=3 SV=1 76 384 3.0E-65
sp|Q8EU94|SYE_MYCPE Glutamate--tRNA ligase OS=Mycoplasma penetrans (strain HF-2) GN=gltX PE=3 SV=1 75 387 4.0E-65
sp|A7HL47|SYE2_FERNB Glutamate--tRNA ligase 2 OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=gltX2 PE=3 SV=1 78 360 5.0E-65
sp|Q7NI06|SYE_GLOVI Glutamate--tRNA ligase OS=Gloeobacter violaceus (strain PCC 7421) GN=gltX PE=3 SV=1 83 357 5.0E-65
sp|Q64NI3|SYE_BACFR Glutamate--tRNA ligase OS=Bacteroides fragilis (strain YCH46) GN=gltX PE=3 SV=1 76 384 6.0E-65
sp|Q5L883|SYE_BACFN Glutamate--tRNA ligase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=gltX PE=3 SV=1 76 384 6.0E-65
sp|Q39UV7|SYE_GEOMG Glutamate--tRNA ligase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=gltX PE=3 SV=1 80 360 9.0E-65
sp|Q8A455|SYE_BACTN Glutamate--tRNA ligase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=gltX PE=3 SV=1 76 384 1.0E-64
sp|Q0A936|SYE1_ALKEH Glutamate--tRNA ligase 1 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=gltX1 PE=3 SV=1 80 360 1.0E-64
sp|A1WWI7|SYE2_HALHL Glutamate--tRNA ligase 2 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=gltX2 PE=3 SV=1 80 360 2.0E-64
sp|Q11PQ4|SYE_CYTH3 Glutamate--tRNA ligase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=gltX PE=3 SV=1 77 353 2.0E-64
sp|Q03E40|SYE_PEDPA Glutamate--tRNA ligase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=gltX PE=3 SV=1 76 383 2.0E-64
sp|A7GJZ9|SYE_BACCN Glutamate--tRNA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=gltX PE=3 SV=1 77 383 3.0E-64
sp|Q03SU7|SYE2_LACBA Glutamate--tRNA ligase 2 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=gltX2 PE=3 SV=1 76 360 5.0E-64
sp|Q6YR76|SYE_ONYPE Glutamate--tRNA ligase OS=Onion yellows phytoplasma (strain OY-M) GN=gltX PE=3 SV=1 78 379 6.0E-64
sp|Q2LQN4|SYE1_SYNAS Glutamate--tRNA ligase 1 OS=Syntrophus aciditrophicus (strain SB) GN=gltX1 PE=3 SV=1 78 360 6.0E-64
sp|Q0HWS6|SYE_SHESR Glutamate--tRNA ligase OS=Shewanella sp. (strain MR-7) GN=gltX PE=3 SV=1 81 388 7.0E-64
sp|A0KV33|SYE_SHESA Glutamate--tRNA ligase OS=Shewanella sp. (strain ANA-3) GN=gltX PE=3 SV=1 81 388 7.0E-64
sp|A1RI52|SYE_SHESW Glutamate--tRNA ligase OS=Shewanella sp. (strain W3-18-1) GN=gltX PE=3 SV=1 81 360 7.0E-64
sp|Q0HKH4|SYE_SHESM Glutamate--tRNA ligase OS=Shewanella sp. (strain MR-4) GN=gltX PE=3 SV=1 81 388 7.0E-64
sp|A9VNA0|SYE_BACWK Glutamate--tRNA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=gltX PE=3 SV=1 77 383 9.0E-64
sp|B6IST4|SYE2_RHOCS Glutamate--tRNA ligase 2 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=gltX2 PE=3 SV=1 80 383 1.0E-63
sp|Q49V37|SYE_STAS1 Glutamate--tRNA ligase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=gltX PE=3 SV=1 80 360 1.0E-63
sp|A4Y8D7|SYE_SHEPC Glutamate--tRNA ligase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=gltX PE=3 SV=1 81 360 1.0E-63
sp|A1S7Q6|SYE_SHEAM Glutamate--tRNA ligase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=gltX PE=3 SV=1 80 360 1.0E-63
sp|Q12L63|SYE_SHEDO Glutamate--tRNA ligase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=gltX PE=3 SV=1 81 360 1.0E-63
sp|B2GAB3|SYE_LACF3 Glutamate--tRNA ligase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=gltX PE=3 SV=1 80 360 2.0E-63
sp|A9KUU5|SYE_SHEB9 Glutamate--tRNA ligase OS=Shewanella baltica (strain OS195) GN=gltX PE=3 SV=1 81 360 2.0E-63
sp|A6WQ67|SYE_SHEB8 Glutamate--tRNA ligase OS=Shewanella baltica (strain OS185) GN=gltX PE=3 SV=1 81 360 2.0E-63
sp|Q7MUF7|SYE_PORGI Glutamate--tRNA ligase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=gltX PE=3 SV=1 77 384 2.0E-63
sp|A3D6C6|SYE_SHEB5 Glutamate--tRNA ligase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=gltX PE=3 SV=1 81 360 2.0E-63
sp|A5FL73|SYE_FLAJ1 Glutamate--tRNA ligase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=gltX PE=3 SV=1 78 374 3.0E-63
sp|A6LM79|SYE2_THEM4 Glutamate--tRNA ligase 2 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=gltX2 PE=3 SV=1 80 358 3.0E-63
sp|A9BJB2|SYE1_PETMO Glutamate--tRNA ligase 1 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=gltX1 PE=3 SV=1 80 358 3.0E-63
sp|B3WA39|SYE_LACCB Glutamate--tRNA ligase OS=Lactobacillus casei (strain BL23) GN=gltX PE=3 SV=1 76 360 3.0E-63
sp|Q035R5|SYE_LACC3 Glutamate--tRNA ligase OS=Lactobacillus casei (strain ATCC 334) GN=gltX PE=3 SV=1 76 360 3.0E-63
sp|Q6MKR6|SYE_BDEBA Glutamate--tRNA ligase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=gltX PE=3 SV=1 80 383 6.0E-63
sp|B2RI67|SYE_PORG3 Glutamate--tRNA ligase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=gltX PE=3 SV=1 75 384 6.0E-63
sp|B5EEE6|SYE_GEOBB Glutamate--tRNA ligase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=gltX PE=3 SV=1 80 375 6.0E-63
sp|A8FXE0|SYE_SHESH Glutamate--tRNA ligase OS=Shewanella sediminis (strain HAW-EB3) GN=gltX PE=3 SV=1 81 360 6.0E-63
sp|A3QCW8|SYE_SHELP Glutamate--tRNA ligase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=gltX PE=3 SV=1 80 360 8.0E-63
sp|Q5WVE0|SYE_LEGPL Glutamate--tRNA ligase OS=Legionella pneumophila (strain Lens) GN=gltX PE=3 SV=1 80 360 8.0E-63
sp|Q5ZU96|SYE_LEGPH Glutamate--tRNA ligase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=gltX PE=3 SV=2 80 360 8.0E-63
sp|Q73FB9|SYE_BACC1 Glutamate--tRNA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=gltX PE=3 SV=1 77 383 1.0E-62
sp|Q6HPT0|SYE_BACHK Glutamate--tRNA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=gltX PE=3 SV=1 77 383 1.0E-62
sp|Q63HB2|SYE_BACCZ Glutamate--tRNA ligase OS=Bacillus cereus (strain ZK / E33L) GN=gltX PE=3 SV=1 77 383 1.0E-62
sp|Q81VV3|SYE_BACAN Glutamate--tRNA ligase OS=Bacillus anthracis GN=gltX PE=3 SV=1 77 383 1.0E-62
sp|A0R8F9|SYE_BACAH Glutamate--tRNA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=gltX PE=3 SV=2 77 383 1.0E-62
sp|Q88YY0|SYE_LACPL Glutamate--tRNA ligase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=gltX PE=3 SV=1 76 360 1.0E-62
sp|A5ID69|SYE_LEGPC Glutamate--tRNA ligase OS=Legionella pneumophila (strain Corby) GN=gltX PE=3 SV=1 80 360 1.0E-62
sp|Q0A7N2|SYE2_ALKEH Glutamate--tRNA ligase 2 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=gltX2 PE=3 SV=1 80 379 1.0E-62
sp|Q2NIP6|SYE_AYWBP Glutamate--tRNA ligase OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=gltX PE=3 SV=1 78 379 1.0E-62
sp|Q7N6Y2|SYE_PHOLL Glutamate--tRNA ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=gltX PE=3 SV=1 80 387 1.0E-62
sp|Q3A413|SYE_PELCD Glutamate--tRNA ligase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=gltX PE=3 SV=1 80 360 1.0E-62
sp|Q601G1|SYE_MYCH2 Glutamate--tRNA ligase OS=Mycoplasma hyopneumoniae (strain 232) GN=gltX PE=3 SV=1 80 365 1.0E-62
sp|Q5QX98|SYE_IDILO Glutamate--tRNA ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=gltX PE=3 SV=1 80 360 1.0E-62
sp|Q5X3Z5|SYE_LEGPA Glutamate--tRNA ligase OS=Legionella pneumophila (strain Paris) GN=gltX PE=3 SV=1 80 360 2.0E-62
sp|O86528|SYE_STRCO Glutamate--tRNA ligase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=gltX PE=3 SV=1 72 364 2.0E-62
sp|Q3J8Y8|SYE2_NITOC Glutamate--tRNA ligase 2 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=gltX2 PE=3 SV=1 80 362 3.0E-62
sp|A8F791|SYE2_PSELT Glutamate--tRNA ligase 2 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=gltX2 PE=3 SV=1 80 360 3.0E-62
sp|B0TNB9|SYE_SHEHH Glutamate--tRNA ligase OS=Shewanella halifaxensis (strain HAW-EB4) GN=gltX PE=3 SV=1 80 360 3.0E-62
sp|Q4A8M4|SYE_MYCH7 Glutamate--tRNA ligase OS=Mycoplasma hyopneumoniae (strain 7448) GN=gltX PE=3 SV=2 80 365 4.0E-62
sp|Q81J61|SYE_BACCR Glutamate--tRNA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=gltX PE=3 SV=2 77 383 4.0E-62
sp|Q2W3G8|SYE2_MAGSA Glutamate--tRNA ligase 2 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=gltX2 PE=3 SV=1 80 383 5.0E-62
sp|A1WT90|SYE1_HALHL Glutamate--tRNA ligase 1 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=gltX1 PE=3 SV=1 80 365 6.0E-62
sp|Q4AAJ3|SYE_MYCHJ Glutamate--tRNA ligase OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=gltX PE=3 SV=2 80 388 6.0E-62
sp|B6EJQ3|SYE_ALISL Glutamate--tRNA ligase OS=Aliivibrio salmonicida (strain LFI1238) GN=gltX PE=3 SV=1 80 387 7.0E-62
sp|A8H2J4|SYE_SHEPA Glutamate--tRNA ligase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=gltX PE=3 SV=1 80 360 1.0E-61
sp|Q8KA47|SYE_BUCAP Glutamate--tRNA ligase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=gltX PE=3 SV=1 80 387 1.0E-61
sp|Q11HT5|SYE2_CHESB Glutamate--tRNA ligase 2 OS=Chelativorans sp. (strain BNC1) GN=gltX2 PE=3 SV=1 79 372 1.0E-61
sp|Q2RTZ4|SYE2_RHORT Glutamate--tRNA ligase 2 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=gltX2 PE=3 SV=1 80 383 1.0E-61
sp|B1VA59|SYE_PHYAS Glutamate--tRNA ligase OS=Phytoplasma australiense GN=gltX PE=3 SV=1 80 383 2.0E-61
sp|A7HY03|SYE2_PARL1 Glutamate--tRNA ligase 2 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=gltX2 PE=3 SV=1 78 383 2.0E-61
sp|A7MY61|SYE_VIBCB Glutamate--tRNA ligase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=gltX PE=3 SV=1 80 387 3.0E-61
sp|B5EL11|SYE2_ACIF5 Glutamate--tRNA ligase 2 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=gltX2 PE=3 SV=1 80 361 3.0E-61
sp|Q8DFH5|SYE_VIBVU Glutamate--tRNA ligase OS=Vibrio vulnificus (strain CMCP6) GN=gltX PE=3 SV=1 80 360 3.0E-61
sp|Q7MMW8|SYE_VIBVY Glutamate--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=gltX PE=3 SV=1 80 360 4.0E-61
sp|Q5HIE7|SYE_STAAC Glutamate--tRNA ligase OS=Staphylococcus aureus (strain COL) GN=gltX PE=3 SV=1 80 360 5.0E-61
sp|A6QEI0|SYE_STAAE Glutamate--tRNA ligase OS=Staphylococcus aureus (strain Newman) GN=gltX PE=3 SV=1 80 360 5.0E-61
sp|P67022|SYE_STAAW Glutamate--tRNA ligase OS=Staphylococcus aureus (strain MW2) GN=gltX PE=3 SV=1 80 360 5.0E-61
sp|A8YZM5|SYE_STAAT Glutamate--tRNA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=gltX PE=3 SV=1 80 360 5.0E-61
sp|Q6GBW0|SYE_STAAS Glutamate--tRNA ligase OS=Staphylococcus aureus (strain MSSA476) GN=gltX PE=3 SV=1 80 360 5.0E-61
sp|P99170|SYE_STAAN Glutamate--tRNA ligase OS=Staphylococcus aureus (strain N315) GN=gltX PE=1 SV=1 80 360 5.0E-61
sp|P67021|SYE_STAAM Glutamate--tRNA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=gltX PE=3 SV=1 80 360 5.0E-61
sp|A5IQ81|SYE_STAA9 Glutamate--tRNA ligase OS=Staphylococcus aureus (strain JH9) GN=gltX PE=3 SV=1 80 360 5.0E-61
sp|Q2G241|SYE_STAA8 Glutamate--tRNA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=gltX PE=3 SV=1 80 360 5.0E-61
sp|Q2FJB2|SYE_STAA3 Glutamate--tRNA ligase OS=Staphylococcus aureus (strain USA300) GN=gltX PE=3 SV=1 80 360 5.0E-61
sp|A6TZ04|SYE_STAA2 Glutamate--tRNA ligase OS=Staphylococcus aureus (strain JH1) GN=gltX PE=3 SV=1 80 360 5.0E-61
sp|A7WYU4|SYE_STAA1 Glutamate--tRNA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=gltX PE=3 SV=1 80 360 5.0E-61
sp|Q6GJE1|SYE_STAAR Glutamate--tRNA ligase OS=Staphylococcus aureus (strain MRSA252) GN=gltX PE=3 SV=1 80 360 5.0E-61
sp|A4SJD4|SYE_AERS4 Glutamate--tRNA ligase OS=Aeromonas salmonicida (strain A449) GN=gltX PE=3 SV=1 80 360 6.0E-61
sp|B1KML5|SYE_SHEWM Glutamate--tRNA ligase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=gltX PE=3 SV=1 80 360 7.0E-61
sp|Q2YSD3|SYE_STAAB Glutamate--tRNA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=gltX PE=3 SV=1 80 360 7.0E-61
sp|Q15RR1|SYE_PSEA6 Glutamate--tRNA ligase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=gltX PE=3 SV=1 83 387 9.0E-61
sp|Q045X9|SYE_LACGA Glutamate--tRNA ligase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=gltX PE=3 SV=1 76 360 9.0E-61
sp|Q82JR3|SYE_STRAW Glutamate--tRNA ligase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=gltX PE=3 SV=1 68 364 1.0E-60
sp|Q87RL6|SYE_VIBPA Glutamate--tRNA ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=gltX PE=3 SV=1 80 387 1.0E-60
sp|A0KNT0|SYE_AERHH Glutamate--tRNA ligase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=gltX PE=3 SV=1 80 387 1.0E-60
sp|Q6D206|SYE_PECAS Glutamate--tRNA ligase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=gltX PE=3 SV=1 80 387 1.0E-60
sp|A1B8E0|SYE2_PARDP Glutamate--tRNA ligase 2 OS=Paracoccus denitrificans (strain Pd 1222) GN=gltX2 PE=3 SV=1 78 364 2.0E-60
sp|P57173|SYE_BUCAI Glutamate--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=gltX PE=3 SV=1 80 361 2.0E-60
sp|A6LEA1|SYE_PARD8 Glutamate--tRNA ligase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=gltX PE=3 SV=1 78 384 2.0E-60
sp|B4UI79|SYE_ANASK Glutamate--tRNA ligase OS=Anaeromyxobacter sp. (strain K) GN=gltX PE=3 SV=1 77 360 3.0E-60
sp|P0C6Q1|SYE_VIBCH Glutamate--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=gltX PE=3 SV=1 80 358 3.0E-60
sp|A5F649|SYE_VIBC3 Glutamate--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=gltX PE=3 SV=2 80 358 3.0E-60
sp|Q31GB2|SYE_THICR Glutamate--tRNA ligase OS=Thiomicrospira crunogena (strain XCL-2) GN=gltX PE=3 SV=1 80 384 3.0E-60
sp|A8GHC5|SYE_SERP5 Glutamate--tRNA ligase OS=Serratia proteamaculans (strain 568) GN=gltX PE=3 SV=1 80 360 4.0E-60
sp|A1AWC3|SYE_RUTMC Glutamate--tRNA ligase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=gltX PE=3 SV=1 80 361 4.0E-60
sp|Q2IL38|SYE_ANADE Glutamate--tRNA ligase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=gltX PE=3 SV=1 77 360 4.0E-60
sp|A4TMF9|SYE_YERPP Glutamate--tRNA ligase OS=Yersinia pestis (strain Pestoides F) GN=gltX PE=3 SV=1 80 388 6.0E-60
sp|Q1CJV2|SYE_YERPN Glutamate--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=gltX PE=3 SV=1 80 388 6.0E-60
sp|A9QZG6|SYE_YERPG Glutamate--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=gltX PE=3 SV=1 80 388 6.0E-60
sp|Q8ZCK0|SYE_YERPE Glutamate--tRNA ligase OS=Yersinia pestis GN=gltX PE=3 SV=1 80 388 6.0E-60
sp|Q1C5Y4|SYE_YERPA Glutamate--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=gltX PE=3 SV=1 80 388 6.0E-60
sp|Q668N0|SYE_YERPS Glutamate--tRNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=gltX PE=3 SV=1 80 388 6.0E-60
sp|B2K913|SYE_YERPB Glutamate--tRNA ligase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=gltX PE=3 SV=1 80 388 6.0E-60
sp|Q8EU02|SYE_OCEIH Glutamate--tRNA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=gltX PE=3 SV=1 78 360 6.0E-60
sp|A0LI05|SYE_SYNFM Glutamate--tRNA ligase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=gltX PE=3 SV=1 78 360 7.0E-60
sp|B1JFZ4|SYE_YERPY Glutamate--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=gltX PE=3 SV=1 80 388 7.0E-60
sp|A7FGC6|SYE_YERP3 Glutamate--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=gltX PE=3 SV=1 80 388 7.0E-60
sp|Q65VB3|SYE_MANSM Glutamate--tRNA ligase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=gltX PE=3 SV=3 80 358 9.0E-60
sp|Q2SSZ1|SYE_MYCCT Glutamate--tRNA ligase OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=gltX PE=3 SV=1 80 360 9.0E-60
sp|A8YTD2|SYE_LACH4 Glutamate--tRNA ligase OS=Lactobacillus helveticus (strain DPC 4571) GN=gltX PE=3 SV=1 76 360 9.0E-60
sp|B3CST4|SYE2_ORITI Glutamate--tRNA ligase 2 OS=Orientia tsutsugamushi (strain Ikeda) GN=gltX2 PE=3 SV=2 80 364 1.0E-59
sp|B2VDY5|SYE_ERWT9 Glutamate--tRNA ligase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=gltX PE=3 SV=1 80 360 1.0E-59
sp|Q9ZFA3|SYE1_RHOS4 Glutamate--tRNA ligase 1 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=gltX1 PE=3 SV=1 75 364 1.0E-59
sp|B1VZ06|SYE_STRGG Glutamate--tRNA ligase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=gltX PE=3 SV=1 78 364 2.0E-59
sp|B6YQF6|SYE_AZOPC Glutamate--tRNA ligase OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=gltX PE=3 SV=1 81 358 2.0E-59
sp|P47700|SYE_MYCGE Glutamate--tRNA ligase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=gltX PE=3 SV=1 78 358 2.0E-59
sp|P57906|SYE_PASMU Glutamate--tRNA ligase OS=Pasteurella multocida (strain Pm70) GN=gltX PE=3 SV=1 80 358 3.0E-59
sp|B3PN19|SYE_MYCA5 Glutamate--tRNA ligase OS=Mycoplasma arthritidis (strain 158L3-1) GN=gltX PE=3 SV=1 77 358 3.0E-59
sp|A6TC43|SYE_KLEP7 Glutamate--tRNA ligase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=gltX PE=3 SV=1 80 360 4.0E-59
sp|Q1H0X9|SYE_METFK Glutamate--tRNA ligase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=gltX PE=3 SV=1 80 364 4.0E-59
sp|A3PHK2|SYE1_RHOS1 Glutamate--tRNA ligase 1 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=gltX1 PE=3 SV=1 75 364 4.0E-59
sp|Q1LT18|SYE_BAUCH Glutamate--tRNA ligase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=gltX PE=3 SV=1 80 361 4.0E-59
sp|B5XVT8|SYE_KLEP3 Glutamate--tRNA ligase OS=Klebsiella pneumoniae (strain 342) GN=gltX PE=3 SV=1 80 360 4.0E-59
sp|A5CD02|SYE1_ORITB Glutamate--tRNA ligase 1 OS=Orientia tsutsugamushi (strain Boryong) GN=gltX1 PE=3 SV=2 80 364 5.0E-59
sp|Q74L27|SYE_LACJO Glutamate--tRNA ligase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=gltX PE=3 SV=1 76 360 5.0E-59
sp|Q4L3I7|SYE_STAHJ Glutamate--tRNA ligase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=gltX PE=3 SV=1 80 360 5.0E-59
sp|A5UAL5|SYE_HAEIE Glutamate--tRNA ligase OS=Haemophilus influenzae (strain PittEE) GN=gltX PE=3 SV=1 80 358 5.0E-59
sp|B1LMJ5|SYE_ECOSM Glutamate--tRNA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=gltX PE=3 SV=1 80 360 5.0E-59
sp|Q0TF64|SYE_ECOL5 Glutamate--tRNA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=gltX PE=3 SV=1 80 387 6.0E-59
sp|Q4QNR5|SYE_HAEI8 Glutamate--tRNA ligase OS=Haemophilus influenzae (strain 86-028NP) GN=gltX PE=3 SV=1 80 358 6.0E-59
sp|P43818|SYE_HAEIN Glutamate--tRNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=gltX PE=3 SV=1 80 358 7.0E-59
sp|A7MKV5|SYE_CROS8 Glutamate--tRNA ligase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=gltX PE=3 SV=1 80 387 7.0E-59
sp|Q01WJ8|SYE_SOLUE Glutamate--tRNA ligase OS=Solibacter usitatus (strain Ellin6076) GN=gltX PE=3 SV=1 81 364 7.0E-59
sp|A8ADJ2|SYE_CITK8 Glutamate--tRNA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=gltX PE=3 SV=1 80 387 8.0E-59
sp|Q31Y73|SYE_SHIBS Glutamate--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=gltX PE=3 SV=1 80 360 8.0E-59
sp|Q32DE6|SYE_SHIDS Glutamate--tRNA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=gltX PE=3 SV=1 80 360 8.0E-59
sp|Q6A6M1|SYE_PROAC Glutamate--tRNA ligase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=gltX PE=3 SV=1 79 380 9.0E-59
sp|Q83K84|SYE_SHIFL Glutamate--tRNA ligase OS=Shigella flexneri GN=gltX PE=3 SV=1 80 360 9.0E-59
sp|Q0T2A3|SYE_SHIF8 Glutamate--tRNA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=gltX PE=3 SV=1 80 360 9.0E-59
sp|Q8FFC9|SYE_ECOL6 Glutamate--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=gltX PE=3 SV=1 80 360 1.0E-58
sp|Q1R8W9|SYE_ECOUT Glutamate--tRNA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=gltX PE=3 SV=1 80 360 1.0E-58
sp|A1ADS2|SYE_ECOK1 Glutamate--tRNA ligase OS=Escherichia coli O1:K1 / APEC GN=gltX PE=3 SV=1 80 360 1.0E-58
sp|B2TX02|SYE_SHIB3 Glutamate--tRNA ligase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=gltX PE=3 SV=1 80 360 1.0E-58
sp|B1IX65|SYE_ECOLC Glutamate--tRNA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=gltX PE=3 SV=1 80 360 1.0E-58
sp|Q3YZD6|SYE_SHISS Glutamate--tRNA ligase OS=Shigella sonnei (strain Ss046) GN=gltX PE=3 SV=1 80 360 1.0E-58
sp|A9GZS1|SYE1_GLUDA Glutamate--tRNA ligase 1 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=gltX1 PE=3 SV=1 80 358 1.0E-58
sp|B6I6U7|SYE_ECOSE Glutamate--tRNA ligase OS=Escherichia coli (strain SE11) GN=gltX PE=3 SV=1 80 360 1.0E-58
sp|P04805|SYE_ECOLI Glutamate--tRNA ligase OS=Escherichia coli (strain K12) GN=gltX PE=1 SV=1 80 360 1.0E-58
sp|A8A2Q2|SYE_ECOHS Glutamate--tRNA ligase OS=Escherichia coli O9:H4 (strain HS) GN=gltX PE=3 SV=1 80 360 1.0E-58
sp|B1X9R9|SYE_ECODH Glutamate--tRNA ligase OS=Escherichia coli (strain K12 / DH10B) GN=gltX PE=3 SV=1 80 360 1.0E-58
sp|A7ZPK7|SYE_ECO24 Glutamate--tRNA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=gltX PE=3 SV=1 80 360 1.0E-58
sp|B5EMF9|SYE1_ACIF5 Glutamate--tRNA ligase 1 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=gltX1 PE=3 SV=1 80 360 1.0E-58
sp|B6J5A0|SYE1_COXB1 Glutamate--tRNA ligase 1 OS=Coxiella burnetii (strain CbuK_Q154) GN=gltX1 PE=3 SV=2 78 384 1.0E-58
sp|A1JLB3|SYE_YERE8 Glutamate--tRNA ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=gltX PE=3 SV=1 80 360 1.0E-58
sp|A9KD63|SYE2_COXBN Glutamate--tRNA ligase 2 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=gltX2 PE=3 SV=3 78 384 1.0E-58
sp|B6J2J3|SYE2_COXB2 Glutamate--tRNA ligase 2 OS=Coxiella burnetii (strain CbuG_Q212) GN=gltX2 PE=3 SV=2 78 384 1.0E-58
sp|Q83EV3|SYE1_COXBU Glutamate--tRNA ligase 1 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=gltX1 PE=3 SV=1 78 384 1.0E-58
sp|Q67KZ3|GLUQ_SYMTH Glutamyl-Q tRNA(Asp) synthetase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=gluQ PE=3 SV=1 82 388 1.0E-58
sp|A6X0K5|SYE1_OCHA4 Glutamate--tRNA ligase 1 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=gltX1 PE=3 SV=1 78 372 1.0E-58
sp|B4EZQ7|SYE_PROMH Glutamate--tRNA ligase OS=Proteus mirabilis (strain HI4320) GN=gltX PE=3 SV=1 80 360 1.0E-58
sp|Q5FM35|SYE_LACAC Glutamate--tRNA ligase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=gltX PE=3 SV=1 76 383 2.0E-58
sp|Q0I297|SYE_HAES1 Glutamate--tRNA ligase OS=Haemophilus somnus (strain 129Pt) GN=gltX PE=3 SV=1 80 358 2.0E-58
sp|B5YZV2|SYE_ECO5E Glutamate--tRNA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=gltX PE=3 SV=1 80 360 2.0E-58
sp|Q8XBN2|SYE_ECO57 Glutamate--tRNA ligase OS=Escherichia coli O157:H7 GN=gltX PE=3 SV=1 80 360 2.0E-58
sp|B0USJ3|SYE_HISS2 Glutamate--tRNA ligase OS=Histophilus somni (strain 2336) GN=gltX PE=3 SV=1 77 358 2.0E-58
sp|Q82U77|SYE_NITEU Glutamate--tRNA ligase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=gltX PE=3 SV=1 80 384 2.0E-58
sp|Q8CTU3|SYE_STAES Glutamate--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=gltX PE=3 SV=1 80 360 2.0E-58
sp|Q5HRM5|SYE_STAEQ Glutamate--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=gltX PE=3 SV=1 80 360 2.0E-58
sp|A4WX62|SYE2_RHOS5 Glutamate--tRNA ligase 2 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=gltX2 PE=3 SV=1 72 364 2.0E-58
sp|A5UG92|SYE_HAEIG Glutamate--tRNA ligase OS=Haemophilus influenzae (strain PittGG) GN=gltX PE=3 SV=1 80 358 2.0E-58
sp|B5FGU2|SYE_VIBFM Glutamate--tRNA ligase OS=Vibrio fischeri (strain MJ11) GN=gltX PE=3 SV=1 80 360 2.0E-58
sp|Q5E3L4|SYE_VIBF1 Glutamate--tRNA ligase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=gltX PE=3 SV=1 80 360 2.0E-58
sp|Q0AIP6|SYE_NITEC Glutamate--tRNA ligase OS=Nitrosomonas eutropha (strain C91) GN=gltX PE=3 SV=1 80 384 3.0E-58
sp|Q6LTT8|SYE_PHOPR Glutamate--tRNA ligase OS=Photobacterium profundum GN=gltX PE=3 SV=1 80 360 3.0E-58
sp|Q1RJC6|SYE2_RICBR Glutamate--tRNA ligase 2 OS=Rickettsia bellii (strain RML369-C) GN=gltX2 PE=3 SV=1 80 383 5.0E-58
sp|A8GX08|SYE2_RICB8 Glutamate--tRNA ligase 2 OS=Rickettsia bellii (strain OSU 85-389) GN=gltX2 PE=3 SV=2 80 383 5.0E-58
sp|A2RNK5|SYE_LACLM Glutamate--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=gltX PE=3 SV=1 77 353 5.0E-58
sp|A9NAJ6|SYE1_COXBR Glutamate--tRNA ligase 1 OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=gltX1 PE=3 SV=1 78 384 6.0E-58
sp|Q30Y02|SYE_DESAG Glutamate--tRNA ligase OS=Desulfovibrio alaskensis (strain G20) GN=gltX PE=3 SV=1 80 361 6.0E-58
sp|A7INJ6|SYE1_XANP2 Glutamate--tRNA ligase 1 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=gltX1 PE=3 SV=1 80 360 6.0E-58
sp|A5VB94|SYE2_SPHWW Glutamate--tRNA ligase 2 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=gltX2 PE=3 SV=1 72 383 6.0E-58
sp|A0K8I0|SYE_BURCH Glutamate--tRNA ligase OS=Burkholderia cenocepacia (strain HI2424) GN=gltX PE=3 SV=1 78 360 7.0E-58
sp|B1JUI6|SYE_BURCC Glutamate--tRNA ligase OS=Burkholderia cenocepacia (strain MC0-3) GN=gltX PE=3 SV=1 78 360 7.0E-58
sp|Q7VNZ3|SYE_HAEDU Glutamate--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=gltX PE=3 SV=1 80 358 7.0E-58
sp|B5FQB0|SYE_SALDC Glutamate--tRNA ligase OS=Salmonella dublin (strain CT_02021853) GN=gltX PE=3 SV=1 80 360 7.0E-58
sp|Q1BHL9|SYE_BURCA Glutamate--tRNA ligase OS=Burkholderia cenocepacia (strain AU 1054) GN=gltX PE=3 SV=1 78 360 7.0E-58
sp|B4ECR7|SYE_BURCJ Glutamate--tRNA ligase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=gltX PE=3 SV=1 78 360 7.0E-58
sp|Q39F07|SYE_BURL3 Glutamate--tRNA ligase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=gltX PE=3 SV=2 78 360 8.0E-58
sp|Q57LU0|SYE_SALCH Glutamate--tRNA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=gltX PE=3 SV=1 80 360 8.0E-58
sp|Q60BG7|SYE1_METCA Glutamate--tRNA ligase 1 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=gltX1 PE=3 SV=1 80 361 9.0E-58
sp|Q02W76|SYE_LACLS Glutamate--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=gltX PE=3 SV=1 77 353 9.0E-58
sp|Q7NAE5|SYE_MYCGA Glutamate--tRNA ligase OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=gltX PE=3 SV=1 80 360 1.0E-57
sp|Q1G8Y5|SYE_LACDA Glutamate--tRNA ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=gltX PE=3 SV=1 76 360 1.0E-57
sp|Q2NA91|SYE1_ERYLH Glutamate--tRNA ligase 1 OS=Erythrobacter litoralis (strain HTCC2594) GN=gltX1 PE=3 SV=2 80 358 1.0E-57
sp|Q5FGW4|SYE2_EHRRG Glutamate--tRNA ligase 2 OS=Ehrlichia ruminantium (strain Gardel) GN=gltX2 PE=3 SV=1 80 383 1.0E-57
sp|B1YSK3|SYE_BURA4 Glutamate--tRNA ligase OS=Burkholderia ambifaria (strain MC40-6) GN=gltX PE=3 SV=1 78 360 1.0E-57
sp|B5RCP1|SYE_SALG2 Glutamate--tRNA ligase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=gltX PE=3 SV=2 80 360 1.0E-57
sp|B5R3U6|SYE_SALEP Glutamate--tRNA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=gltX PE=3 SV=1 80 360 1.0E-57
sp|Q7W3X9|SYE_BORPA Glutamate--tRNA ligase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=gltX PE=3 SV=1 71 364 1.0E-57
sp|Q048S3|SYE_LACDB Glutamate--tRNA ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=gltX PE=3 SV=2 76 360 1.0E-57
sp|Q0BDX9|SYE_BURCM Glutamate--tRNA ligase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=gltX PE=3 SV=1 78 360 1.0E-57
sp|A6VLT3|SYE_ACTSZ Glutamate--tRNA ligase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=gltX PE=3 SV=1 80 358 2.0E-57
sp|Q7WFA9|SYE_BORBR Glutamate--tRNA ligase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=gltX PE=3 SV=1 71 364 2.0E-57
sp|B5BB76|SYE_SALPK Glutamate--tRNA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=gltX PE=3 SV=1 80 360 2.0E-57
sp|Q5PNE5|SYE_SALPA Glutamate--tRNA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=gltX PE=3 SV=1 80 360 2.0E-57
sp|Q3JEF2|SYE1_NITOC Glutamate--tRNA ligase 1 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=gltX1 PE=3 SV=1 80 360 2.0E-57
sp|P0A2K3|SYE_SALTY Glutamate--tRNA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gltX PE=3 SV=1 80 360 2.0E-57
sp|P0A2K4|SYE_SALTI Glutamate--tRNA ligase OS=Salmonella typhi GN=gltX PE=3 SV=1 80 360 2.0E-57
sp|B4TQE9|SYE_SALSV Glutamate--tRNA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=gltX PE=3 SV=1 80 360 2.0E-57
sp|A9N372|SYE_SALPB Glutamate--tRNA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=gltX PE=3 SV=1 80 360 2.0E-57
sp|B4SZT6|SYE_SALNS Glutamate--tRNA ligase OS=Salmonella newport (strain SL254) GN=gltX PE=3 SV=1 80 360 2.0E-57
sp|B4TCE7|SYE_SALHS Glutamate--tRNA ligase OS=Salmonella heidelberg (strain SL476) GN=gltX PE=3 SV=1 80 360 2.0E-57
sp|B5F0E6|SYE_SALA4 Glutamate--tRNA ligase OS=Salmonella agona (strain SL483) GN=gltX PE=3 SV=1 80 360 2.0E-57
sp|Q4FM56|SYE_PELUB Glutamate--tRNA ligase OS=Pelagibacter ubique (strain HTCC1062) GN=gltX PE=3 SV=1 80 383 2.0E-57
sp|A8I819|SYE_AZOC5 Glutamate--tRNA ligase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=gltX PE=3 SV=2 80 360 2.0E-57
sp|Q8DLI5|SYE_THEEB Glutamate--tRNA ligase OS=Thermosynechococcus elongatus (strain BP-1) GN=gltX PE=1 SV=1 80 360 2.0E-57
sp|Q5NY25|SYE_AROAE Glutamate--tRNA ligase OS=Aromatoleum aromaticum (strain EbN1) GN=gltX PE=3 SV=1 80 370 2.0E-57
sp|B0CGU5|SYE2_BRUSI Glutamate--tRNA ligase 2 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=gltX2 PE=3 SV=1 78 372 3.0E-57
sp|A5VQR9|SYE2_BRUO2 Glutamate--tRNA ligase 2 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=gltX2 PE=3 SV=1 78 372 3.0E-57
sp|A9M5G0|SYE2_BRUC2 Glutamate--tRNA ligase 2 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=gltX2 PE=3 SV=1 78 372 3.0E-57
sp|A9MIG3|SYE_SALAR Glutamate--tRNA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=gltX PE=3 SV=1 80 387 3.0E-57
sp|Q6KIT3|SYE_MYCMO Glutamate--tRNA ligase OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=gltX PE=3 SV=1 80 362 3.0E-57
sp|Q2NSC4|SYE_SODGM Glutamate--tRNA ligase OS=Sodalis glossinidius (strain morsitans) GN=gltX PE=3 SV=1 80 360 3.0E-57
sp|Q8G0E8|SYE2_BRUSU Glutamate--tRNA ligase 2 OS=Brucella suis biovar 1 (strain 1330) GN=gltX2 PE=3 SV=1 78 372 3.0E-57
sp|A8LMK2|SYE1_DINSH Glutamate--tRNA ligase 1 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=gltX1 PE=3 SV=1 79 364 3.0E-57
sp|Q0APU9|SYE2_MARMM Glutamate--tRNA ligase 2 OS=Maricaulis maris (strain MCS10) GN=gltX2 PE=3 SV=1 74 360 3.0E-57
sp|Q058C8|SYE_BUCCC Glutamate--tRNA ligase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=gltX PE=3 SV=1 79 383 4.0E-57
sp|Q57CZ2|SYE2_BRUAB Glutamate--tRNA ligase 2 OS=Brucella abortus biovar 1 (strain 9-941) GN=gltX2 PE=3 SV=1 78 372 4.0E-57
sp|Q2YRQ9|SYE2_BRUA2 Glutamate--tRNA ligase 2 OS=Brucella abortus (strain 2308) GN=gltX2 PE=3 SV=1 78 372 4.0E-57
sp|B2S5Z7|SYE2_BRUA1 Glutamate--tRNA ligase 2 OS=Brucella abortus (strain S19) GN=gltX2 PE=3 SV=1 78 372 4.0E-57
sp|Q8YHG4|SYE1_BRUME Glutamate--tRNA ligase 1 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gltX1 PE=3 SV=2 78 372 4.0E-57
sp|Q6MUA6|SYE_MYCMS Glutamate--tRNA ligase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=gltX PE=3 SV=1 80 360 4.0E-57
sp|A9AHQ3|SYE_BURM1 Glutamate--tRNA ligase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=gltX PE=3 SV=1 78 360 4.0E-57
sp|B0BQK7|SYE_ACTPJ Glutamate--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=gltX PE=3 SV=1 80 358 4.0E-57
sp|B3H248|SYE_ACTP7 Glutamate--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=gltX PE=3 SV=1 80 358 4.0E-57
sp|Q1CU52|SYE1_HELPH Glutamate--tRNA ligase 1 OS=Helicobacter pylori (strain HPAG1) GN=gltX1 PE=3 SV=1 80 362 5.0E-57
sp|Q2Y8L6|SYE_NITMU Glutamate--tRNA ligase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=gltX PE=3 SV=1 80 360 5.0E-57
sp|B6JH82|SYE_OLICO Glutamate--tRNA ligase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=gltX PE=3 SV=1 78 360 6.0E-57
sp|A9NEI5|SYE_ACHLI Glutamate--tRNA ligase OS=Acholeplasma laidlawii (strain PG-8A) GN=gltX PE=3 SV=1 78 364 6.0E-57
sp|Q63SX4|SYE_BURPS Glutamate--tRNA ligase OS=Burkholderia pseudomallei (strain K96243) GN=gltX PE=3 SV=1 78 360 6.0E-57
sp|Q3JQY8|SYE_BURP1 Glutamate--tRNA ligase OS=Burkholderia pseudomallei (strain 1710b) GN=gltX PE=3 SV=2 78 360 6.0E-57
sp|A3NWS4|SYE_BURP0 Glutamate--tRNA ligase OS=Burkholderia pseudomallei (strain 1106a) GN=gltX PE=3 SV=2 78 360 6.0E-57
sp|A1V5B3|SYE_BURMS Glutamate--tRNA ligase OS=Burkholderia mallei (strain SAVP1) GN=gltX PE=3 SV=1 78 360 6.0E-57
sp|Q62J82|SYE_BURMA Glutamate--tRNA ligase OS=Burkholderia mallei (strain ATCC 23344) GN=gltX PE=3 SV=1 78 360 6.0E-57
sp|A2SB31|SYE_BURM9 Glutamate--tRNA ligase OS=Burkholderia mallei (strain NCTC 10229) GN=gltX PE=3 SV=1 78 360 6.0E-57
sp|A3MKY8|SYE_BURM7 Glutamate--tRNA ligase OS=Burkholderia mallei (strain NCTC 10247) GN=gltX PE=3 SV=1 78 360 6.0E-57
sp|Q98MD0|SYE1_RHILO Glutamate--tRNA ligase 1 OS=Rhizobium loti (strain MAFF303099) GN=gltX1 PE=3 SV=1 80 364 6.0E-57
sp|Q2JRD6|SYE_SYNJA Glutamate--tRNA ligase OS=Synechococcus sp. (strain JA-3-3Ab) GN=gltX PE=3 SV=1 80 375 7.0E-57
sp|P59423|SYE_BUCBP Glutamate--tRNA ligase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=gltX PE=3 SV=1 80 360 7.0E-57
sp|A3NAZ3|SYE_BURP6 Glutamate--tRNA ligase OS=Burkholderia pseudomallei (strain 668) GN=gltX PE=3 SV=2 78 360 7.0E-57
sp|Q5NL22|SYE2_ZYMMO Glutamate--tRNA ligase 2 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=gltX2 PE=3 SV=1 73 383 8.0E-57
sp|A0L669|SYE_MAGMM Glutamate--tRNA ligase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=gltX PE=3 SV=1 80 360 9.0E-57
sp|Q5FRG7|SYE1_GLUOX Glutamate--tRNA ligase 1 OS=Gluconobacter oxydans (strain 621H) GN=gltX1 PE=3 SV=1 80 383 1.0E-56
sp|Q7NWP4|SYE_CHRVO Glutamate--tRNA ligase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=gltX PE=3 SV=1 80 358 1.0E-56
sp|Q9CDZ7|SYE_LACLA Glutamate--tRNA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=gltX PE=3 SV=1 77 353 1.0E-56
sp|A8ZWA3|SYE_DESOH Glutamate--tRNA ligase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=gltX PE=3 SV=1 78 360 1.0E-56
sp|P96551|SYE1_HELPY Glutamate--tRNA ligase 1 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=gltX1 PE=3 SV=2 80 362 1.0E-56
sp|Q5NHY6|SYE_FRATT Glutamate--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=gltX PE=3 SV=1 80 360 2.0E-56
sp|Q14JD8|SYE_FRAT1 Glutamate--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=gltX PE=3 SV=1 80 360 2.0E-56
sp|B2JIQ8|SYE_BURP8 Glutamate--tRNA ligase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=gltX PE=3 SV=1 79 360 2.0E-56
sp|B5Z6J9|SYE1_HELPG Glutamate--tRNA ligase 1 OS=Helicobacter pylori (strain G27) GN=gltX1 PE=3 SV=1 80 362 2.0E-56
sp|A5IZ19|SYE_MYCAP Glutamate--tRNA ligase OS=Mycoplasma agalactiae (strain PG2) GN=gltX PE=3 SV=1 80 358 2.0E-56
sp|A0Q4G6|SYE_FRATN Glutamate--tRNA ligase OS=Francisella tularensis subsp. novicida (strain U112) GN=gltX PE=3 SV=1 80 360 2.0E-56
sp|B6J4I8|SYE2_COXB1 Glutamate--tRNA ligase 2 OS=Coxiella burnetii (strain CbuK_Q154) GN=gltX2 PE=3 SV=1 80 364 2.0E-56
sp|B4SPM7|SYE_STRM5 Glutamate--tRNA ligase OS=Stenotrophomonas maltophilia (strain R551-3) GN=gltX PE=3 SV=1 81 360 2.0E-56
sp|Q4UME8|SYE2_RICFE Glutamate--tRNA ligase 2 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=gltX2 PE=3 SV=1 80 383 2.0E-56
sp|A4IZU9|SYE_FRATW Glutamate--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=gltX PE=3 SV=1 80 360 2.0E-56
sp|B2SE01|SYE_FRATM Glutamate--tRNA ligase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=gltX PE=3 SV=1 80 360 2.0E-56
sp|Q83BL6|SYE2_COXBU Glutamate--tRNA ligase 2 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=gltX2 PE=3 SV=2 80 364 2.0E-56
sp|A9N925|SYE2_COXBR Glutamate--tRNA ligase 2 OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=gltX2 PE=3 SV=1 80 364 2.0E-56
sp|Q728Q1|SYE_DESVH Glutamate--tRNA ligase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=gltX PE=3 SV=1 80 360 2.0E-56
sp|B6IZ09|SYE1_COXB2 Glutamate--tRNA ligase 1 OS=Coxiella burnetii (strain CbuG_Q212) GN=gltX1 PE=3 SV=1 80 364 2.0E-56
sp|A3N1S5|SYE_ACTP2 Glutamate--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=gltX PE=3 SV=1 80 358 3.0E-56
sp|B2UN91|SYE_AKKM8 Glutamate--tRNA ligase OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=gltX PE=3 SV=1 80 364 3.0E-56
sp|Q0BNU3|SYE_FRATO Glutamate--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=gltX PE=3 SV=1 80 360 3.0E-56
sp|Q2A5I8|SYE_FRATH Glutamate--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=gltX PE=3 SV=1 80 360 3.0E-56
sp|A7N9Q8|SYE_FRATF Glutamate--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=gltX PE=3 SV=1 80 360 3.0E-56
sp|A1VBA3|SYE_DESVV Glutamate--tRNA ligase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=gltX PE=3 SV=1 80 360 3.0E-56
sp|B6JL62|SYE1_HELP2 Glutamate--tRNA ligase 1 OS=Helicobacter pylori (strain P12) GN=gltX1 PE=3 SV=1 80 362 3.0E-56
sp|A8EY39|SYE1_RICCK Glutamate--tRNA ligase 1 OS=Rickettsia canadensis (strain McKiel) GN=gltX1 PE=3 SV=1 80 364 3.0E-56
sp|A9KBJ3|SYE1_COXBN Glutamate--tRNA ligase 1 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=gltX1 PE=3 SV=1 80 364 3.0E-56
sp|Q2JKY3|SYE_SYNJB Glutamate--tRNA ligase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=gltX PE=3 SV=1 80 375 4.0E-56
sp|A3DD54|SYE_CLOTH Glutamate--tRNA ligase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=gltX PE=3 SV=1 82 362 4.0E-56
sp|A1K5J1|SYE_AZOSB Glutamate--tRNA ligase OS=Azoarcus sp. (strain BH72) GN=gltX PE=3 SV=1 76 370 5.0E-56
sp|Q3BR75|SYE_XANC5 Glutamate--tRNA ligase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=gltX PE=3 SV=1 81 360 5.0E-56
sp|B0RQU0|SYE_XANCB Glutamate--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain B100) GN=gltX PE=3 SV=1 81 360 7.0E-56
sp|A4JFB2|SYE_BURVG Glutamate--tRNA ligase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=gltX PE=3 SV=1 78 360 7.0E-56
sp|A4WD15|SYE_ENT38 Glutamate--tRNA ligase OS=Enterobacter sp. (strain 638) GN=gltX PE=3 SV=1 80 360 8.0E-56
sp|Q8P7C5|SYE_XANCP Glutamate--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=gltX PE=3 SV=1 81 360 9.0E-56
sp|Q4UWS6|SYE_XANC8 Glutamate--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=gltX PE=3 SV=1 81 360 9.0E-56
sp|Q8D375|SYE_WIGBR Glutamate--tRNA ligase OS=Wigglesworthia glossinidia brevipalpis GN=gltX PE=3 SV=1 80 361 9.0E-56
sp|Q6G3V8|SYE1_BARHE Glutamate--tRNA ligase 1 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=gltX1 PE=3 SV=1 79 374 1.0E-55
sp|A0JXY5|SYE_ARTS2 Glutamate--tRNA ligase OS=Arthrobacter sp. (strain FB24) GN=gltX PE=3 SV=1 75 364 1.0E-55
sp|B4RBX8|SYE_PHEZH Glutamate--tRNA ligase OS=Phenylobacterium zucineum (strain HLK1) GN=gltX PE=3 SV=1 77 358 1.0E-55
sp|A9ISQ6|SYE1_BART1 Glutamate--tRNA ligase 1 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=gltX1 PE=3 SV=1 80 364 1.0E-55
sp|Q7UNF9|SYE_RHOBA Glutamate--tRNA ligase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=gltX PE=3 SV=2 80 331 1.0E-55
sp|Q7VUU5|SYE_BORPE Glutamate--tRNA ligase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=gltX PE=3 SV=1 80 364 1.0E-55
sp|Q6FZN9|SYE2_BARQU Glutamate--tRNA ligase 2 OS=Bartonella quintana (strain Toulouse) GN=gltX2 PE=3 SV=1 80 374 1.0E-55
sp|B0JY53|SYE_MICAN Glutamate--tRNA ligase OS=Microcystis aeruginosa (strain NIES-843) GN=gltX PE=3 SV=1 80 366 2.0E-55
sp|B1XUR6|SYE_POLNS Glutamate--tRNA ligase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=gltX PE=3 SV=1 80 360 2.0E-55
sp|Q2KUY9|SYE_BORA1 Glutamate--tRNA ligase OS=Bordetella avium (strain 197N) GN=gltX PE=3 SV=1 78 360 2.0E-55
sp|Q73HV5|SYE1_WOLPM Glutamate--tRNA ligase 1 OS=Wolbachia pipientis wMel GN=gltX1 PE=3 SV=1 80 383 2.0E-55
[Show less]

GO

GO Term Description Terminal node
GO:0004812 aminoacyl-tRNA ligase activity Yes
GO:0005524 ATP binding Yes
GO:0043039 tRNA aminoacylation Yes
GO:0043038 amino acid activation No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0140098 catalytic activity, acting on RNA No
GO:0030554 adenyl nucleotide binding No
GO:0090304 nucleic acid metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0043436 oxoacid metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0019752 carboxylic acid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0008152 metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:0008150 biological_process No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0006807 nitrogen compound metabolic process No
GO:0006399 tRNA metabolic process No
GO:0000166 nucleotide binding No
GO:0016070 RNA metabolic process No
GO:0016874 ligase activity No
GO:0071704 organic substance metabolic process No
GO:0044281 small molecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0046483 heterocycle metabolic process No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006520 cellular amino acid metabolic process No
GO:0003674 molecular_function No
GO:0034660 ncRNA metabolic process No
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4974
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4507
Ophiocordyceps australis map64 (Brazil) OphauB2|3357
Ophiocordyceps camponoti-floridani Ophcf2|01754
Ophiocordyceps camponoti-rufipedis Ophun1|992 (this protein)
Ophiocordyceps kimflemingae Ophio5|4955
Ophiocordyceps subramaniannii Hirsu2|212

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|992
MSLLLTTSRLPAPIIRPRRTSLHLHPPSLSRLHQASTGPDPQPKPSTATGIKGLWRRSILRNKLDETTRTILGQS
ADKPIRARFAPSPTGYLHLGSLRTALFNNLAARASKGGAFILRIEDTDQSRLVHDAEERLLSDLKWAGLSWDEGP
DRGGPYGPYRQSERLRFYAHQARYLLDRDRAYRCFCTPSEIESQKRLLHDQGLPTTYNQKCRPIPPPESDRRAQA
GEPHVLRFKSDGHAHTRFRDAVYGVVQMNKALEDFVLVKSDGFPTYHFANVVDDHAMGITHVIRGEEWLISTSKH
IALYRAFGYKPPIFAHLGLLVDDNGAKLSKRHDSVSLATYQDGIVFPLALLSWLAHLGSSFKPDATTPRSIENLA
DAVRRSPSSTPTH*
Coding >Ophun1|992
ATGTCCCTCCTCCTCACCACCTCAAGGCTCCCAGCCCCAATCATCCGCCCCCGACGCACCTCCCTCCATCTCCAT
CCCCCATCCCTCTCCCGCCTTCACCAAGCCTCCACCGGCCCCGACCCCCAACCGAAGCCCAGCACAGCAACCGGC
ATCAAAGGCCTATGGCGCCGAAGCATCCTCCGAAACAAGCTCGATGAAACGACGCGCACCATCCTCGGCCAGAGC
GCAGACAAACCCATCAGAGCGAGGTTCGCGCCTTCGCCCACGGGTTATCTCCACCTCGGATCTCTGCGAACAGCC
TTGTTCAACAATCTAGCTGCCCGCGCTTCAAAGGGCGGCGCCTTTATCCTCAGGATAGAAGATACCGATCAGAGT
CGTCTGGTCCATGACGCAGAGGAGCGTCTACTCAGCGATCTTAAATGGGCAGGACTATCATGGGATGAAGGCCCC
GACCGAGGCGGTCCCTACGGTCCTTACAGACAGTCCGAAAGACTCCGCTTCTACGCACACCAAGCAAGGTACCTC
CTCGACAGAGACCGAGCCTACCGCTGCTTCTGCACGCCCTCAGAAATCGAATCGCAAAAGCGCCTCCTCCACGAC
CAAGGCCTCCCAACAACCTACAACCAAAAATGCCGCCCCATCCCCCCCCCAGAATCAGACCGTCGCGCCCAAGCC
GGTGAACCGCACGTGCTACGCTTCAAAAGCGATGGCCATGCCCACACGCGCTTCCGCGACGCCGTCTACGGTGTG
GTGCAGATGAATAAGGCGCTTGAAGACTTCGTCCTCGTCAAGTCAGATGGGTTTCCAACCTATCACTTTGCCAAT
GTCGTTGATGATCACGCCATGGGCATCACACACGTCATTCGCGGCGAGGAATGGCTCATCTCGACGTCGAAGCAC
ATAGCCCTCTACCGCGCCTTCGGCTATAAGCCCCCCATCTTCGCACACTTGGGCCTCCTCGTCGACGACAACGGC
GCAAAGCTCAGCAAGCGTCATGACAGCGTCAGCCTCGCCACTTACCAAGACGGCATCGTCTTCCCCCTCGCACTG
CTCTCCTGGCTCGCCCATCTCGGCTCTTCCTTCAAGCCAGACGCCACCACACCCCGTTCCATCGAGAACTTGGCC
GACGCTGTACGCCGATCTCCCTCTTCAACTCCAACTCACTAA
Transcript >Ophun1|992
ATGTCCCTCCTCCTCACCACCTCAAGGCTCCCAGCCCCAATCATCCGCCCCCGACGCACCTCCCTCCATCTCCAT
CCCCCATCCCTCTCCCGCCTTCACCAAGCCTCCACCGGCCCCGACCCCCAACCGAAGCCCAGCACAGCAACCGGC
ATCAAAGGCCTATGGCGCCGAAGCATCCTCCGAAACAAGCTCGATGAAACGACGCGCACCATCCTCGGCCAGAGC
GCAGACAAACCCATCAGAGCGAGGTTCGCGCCTTCGCCCACGGGTTATCTCCACCTCGGATCTCTGCGAACAGCC
TTGTTCAACAATCTAGCTGCCCGCGCTTCAAAGGGCGGCGCCTTTATCCTCAGGATAGAAGATACCGATCAGAGT
CGTCTGGTCCATGACGCAGAGGAGCGTCTACTCAGCGATCTTAAATGGGCAGGACTATCATGGGATGAAGGCCCC
GACCGAGGCGGTCCCTACGGTCCTTACAGACAGTCCGAAAGACTCCGCTTCTACGCACACCAAGCAAGGTACCTC
CTCGACAGAGACCGAGCCTACCGCTGCTTCTGCACGCCCTCAGAAATCGAATCGCAAAAGCGCCTCCTCCACGAC
CAAGGCCTCCCAACAACCTACAACCAAAAATGCCGCCCCATCCCCCCCCCAGAATCAGACCGTCGCGCCCAAGCC
GGTGAACCGCACGTGCTACGCTTCAAAAGCGATGGCCATGCCCACACGCGCTTCCGCGACGCCGTCTACGGTGTG
GTGCAGATGAATAAGGCGCTTGAAGACTTCGTCCTCGTCAAGTCAGATGGGTTTCCAACCTATCACTTTGCCAAT
GTCGTTGATGATCACGCCATGGGCATCACACACGTCATTCGCGGCGAGGAATGGCTCATCTCGACGTCGAAGCAC
ATAGCCCTCTACCGCGCCTTCGGCTATAAGCCCCCCATCTTCGCACACTTGGGCCTCCTCGTCGACGACAACGGC
GCAAAGCTCAGCAAGCGTCATGACAGCGTCAGCCTCGCCACTTACCAAGACGGCATCGTCTTCCCCCTCGCACTG
CTCTCCTGGCTCGCCCATCTCGGCTCTTCCTTCAAGCCAGACGCCACCACACCCCGTTCCATCGAGAACTTGGCC
GACGCTGTACGCCGATCTCCCTCTTCAACTCCAACTCACTAA
Gene >Ophun1|992
ATGTCCCTCCTCCTCACCACCTCAAGGCTCCCAGCCCCAATCATCCGCCCCCGACGCACCTCCCTCCATCTCCAT
CCCCCATCCCTCTCCCGCCTTCACCAAGCCTCCACCGGCCCCGACCCCCAACCGAAGCCCAGCACAGCAACCGGC
ATCAAAGGCCTATGGCGCCGAAGCATCCTCCGAAACAAGCTCGATGAAACGACGCGCACCATCCTCGGCCAGAGC
GCAGACAAACCCATCAGAGCGAGGTTCGCGCCTTCGCCCACGGGTTATCTCCACCTCGGATCTCTGCGAACAGCC
TTGTTCAACAATCTAGCTGCCCGCGCTTCAAAGGGCGGCGCCTTTATCCTCAGGATAGAAGATACCGATCAGAGT
CGTCTGGTCCATGACGCAGAGGAGCGTCTACTCAGCGATCTTAAATGGGCAGGACTATCATGGGATGAAGGCCCC
GACCGAGGCGGTCCCTACGGTCCTTACAGACAGGTGAGCTTCATCCTCACCCCAACCCCAAGTCCACCTCTCAAC
CCCCCCAGTCCGAAAGACTCCGCTTCTACGCACACCAAGCAAGGTACCTCCTCGACAGAGACCGAGCCTACCGCT
GCTTCTGCACGCCCTCAGAAATCGAATCGCAAAAGCGCCTCCTCCACGACCAAGGCCTCCCAACAACCTACAACC
AAAAATGCCGCCCCATCCCCCCCCCAGAATCAGACCGTCGCGCCCAAGCCGGTGAACCGCACGTGCTACGCTTCA
AAAGCGATGGCCATGCCCACACGCGCTTCCGCGACGCCGTCTACGGTGTGGTGCAGATGAATAAGGCGCTTGAAG
ACTTCGTCCTCGTCAAGTCAGATGGGTTTCCAACCTATCACTTTGCCAATGTCGTTGATGATCACGCCATGGGCA
TCACACACGTCATTCGCGGCGAGGTGATACCCCCCCCTCTTCCCTTGCTACCTTCAAGCTCACTCCTCTAGGAAT
GGCTCATCTCGACGTCGAAGCACATAGCCCTCTACCGCGCCTTCGGCTATAAGCCCCCCATCTTCGCACACTTGG
GCCTCCTCGTCGACGACAACGGCGCAAAGCTCAGCAAGCGTCATGACAGCGTCAGCCTCGCCACTTACCAAGACG
GCATCGTCTTCCCCCTCGCACTGCTCTCCTGGCTCGCCCATCTCGGCTCTTCCTTCAAGCCAGACGCCACCACAC
CCCGTTCCATCGAGAACTTGGCCGACGCTGTACGCCGATCTCCCTCTTCAACTCCAACTCACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail