Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|989
Gene name
LocationContig_1361:94..1803
Strand-
Gene length (bp)1709
Transcript length (bp)1641
Coding sequence length (bp)1641
Protein length (aa) 547

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9NWF9|RN216_HUMAN E3 ubiquitin-protein ligase RNF216 OS=Homo sapiens GN=RNF216 PE=1 SV=3 216 383 4.0E-08
sp|P58283|RN216_MOUSE E3 ubiquitin-protein ligase RNF216 OS=Mus musculus GN=Rnf216 PE=1 SV=3 459 533 2.0E-07
sp|P58283|RN216_MOUSE E3 ubiquitin-protein ligase RNF216 OS=Mus musculus GN=Rnf216 PE=1 SV=3 218 383 7.0E-07
sp|Q9NWF9|RN216_HUMAN E3 ubiquitin-protein ligase RNF216 OS=Homo sapiens GN=RNF216 PE=1 SV=3 459 533 8.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 407 429 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|989
MVFSGLLSPSSDKASTASRSRSGSDGLIYDEAQLPCVPPERPNLRDLNNSLEALAAVFPDVQTDVFRELLTKFDG
ESRLALVAEALLKNRVAWVKGRWRTVTEDGGGGVCKADSFRSPEYAQAVRALAWHEFRGLSRSTMNAVLAESNHS
YLEARRTLVALSSQSWRFTISSMLRRRKPMATGEAERHPLVVWRAIGGEGVVMPAIRPTGSAELDRELFDALVRP
LQTRERKARDAADRRLALGMNRDEAERVGAVHECACCFSTAVFEQFTCCNEAGHMMCFRCVLHATKEALFGQSWL
SSFRMDTGTLRCLAVEGDGCSGYIPADQLRRALTADDDDDDDDDDEDEHTPGADMVRRLDERLAEHNLATSRLAL
TRCPFCSYSEVDEATLTGARPRFTTGAMAVLAVVAALLLLSLPVALVSALACAVMGSERSAWRMLRQSWQRAMHR
VQRRRRGLRFRCQSPRCGRQSCLSCHKPWTDVHICHESSLLALRTQVETAMSMAIKRVCPRCDTSFVKNSGCNKL
TCPCGYKIGGCGPGLSRVSPL*
Coding >Ophun1|989
ATGGTCTTCTCCGGCCTGCTCTCCCCCAGCAGCGATAAGGCATCGACAGCGAGCCGCAGCCGGTCCGGAAGCGAC
GGACTGATCTACGACGAGGCACAGCTGCCATGCGTACCGCCAGAGCGACCCAACCTGCGAGATCTCAACAACAGC
CTGGAGGCGCTGGCAGCCGTCTTCCCGGACGTGCAGACGGACGTGTTCCGCGAGCTGCTGACCAAGTTCGACGGG
GAGTCGCGGCTGGCTCTCGTGGCCGAGGCGCTGCTCAAGAACCGCGTGGCTTGGGTCAAGGGACGGTGGCGGACG
GTGACGGAGGATGGAGGCGGGGGAGTCTGCAAGGCGGATTCGTTTCGCAGTCCGGAGTATGCGCAGGCGGTTCGC
GCGCTGGCGTGGCACGAGTTTCGCGGGTTGTCGCGGTCGACGATGAATGCGGTGCTGGCCGAGTCGAATCATTCG
TATCTCGAGGCGAGGCGGACGCTGGTGGCGCTGTCGTCGCAGTCGTGGCGCTTCACCATCTCGTCGATGCTGCGG
AGACGGAAGCCCATGGCCACGGGCGAGGCGGAACGACACCCACTGGTCGTGTGGCGGGCGATTGGCGGCGAAGGA
GTCGTGATGCCTGCGATTCGTCCGACGGGAAGCGCTGAGCTGGACCGCGAACTCTTCGACGCTCTCGTTCGGCCG
CTTCAGACGAGGGAGCGGAAGGCTCGTGATGCGGCGGATCGTCGACTTGCCCTCGGGATGAATCGGGATGAGGCG
GAGAGGGTTGGGGCGGTTCACGAGTGCGCGTGCTGCTTCTCCACGGCTGTGTTTGAGCAGTTTACGTGCTGTAAC
GAGGCGGGACACATGATGTGCTTCCGCTGCGTGCTGCACGCCACCAAGGAGGCTCTGTTCGGACAGTCTTGGCTA
AGCAGCTTCAGGATGGACACGGGCACTCTCCGATGCCTAGCCGTTGAAGGCGACGGCTGCAGCGGCTACATTCCC
GCCGATCAGCTTCGACGCGCCCTGACAGCCGATGATGATGACGACGACGACGACGACGACGAAGACGAGCACACG
CCTGGTGCCGACATGGTGCGACGACTGGACGAGCGGCTGGCGGAGCACAACCTGGCGACGTCGAGGCTGGCTCTG
ACGCGGTGTCCCTTTTGCAGCTACAGCGAGGTGGACGAGGCGACCTTGACGGGAGCACGGCCGCGGTTCACGACG
GGGGCCATGGCGGTGCTGGCGGTTGTGGCCGCCCTGCTGCTCCTCTCCCTGCCCGTCGCCCTCGTCTCAGCCCTG
GCCTGCGCCGTCATGGGCTCCGAAAGATCAGCGTGGCGGATGCTGCGACAGAGCTGGCAACGAGCCATGCACCGC
GTCCAACGCCGAAGACGCGGCCTCCGCTTCCGCTGCCAGAGCCCCCGCTGCGGCCGCCAATCCTGCCTCTCCTGC
CACAAACCCTGGACCGACGTCCACATCTGCCACGAATCCTCCCTGCTGGCGCTGCGAACGCAGGTGGAAACGGCC
ATGAGCATGGCCATCAAGCGCGTGTGCCCCCGCTGCGACACCTCGTTCGTCAAGAACTCGGGCTGCAACAAGCTG
ACGTGTCCCTGCGGCTACAAGATAGGGGGATGCGGCCCTGGCCTGTCGCGAGTGTCGCCGCTGTAA
Transcript >Ophun1|989
ATGGTCTTCTCCGGCCTGCTCTCCCCCAGCAGCGATAAGGCATCGACAGCGAGCCGCAGCCGGTCCGGAAGCGAC
GGACTGATCTACGACGAGGCACAGCTGCCATGCGTACCGCCAGAGCGACCCAACCTGCGAGATCTCAACAACAGC
CTGGAGGCGCTGGCAGCCGTCTTCCCGGACGTGCAGACGGACGTGTTCCGCGAGCTGCTGACCAAGTTCGACGGG
GAGTCGCGGCTGGCTCTCGTGGCCGAGGCGCTGCTCAAGAACCGCGTGGCTTGGGTCAAGGGACGGTGGCGGACG
GTGACGGAGGATGGAGGCGGGGGAGTCTGCAAGGCGGATTCGTTTCGCAGTCCGGAGTATGCGCAGGCGGTTCGC
GCGCTGGCGTGGCACGAGTTTCGCGGGTTGTCGCGGTCGACGATGAATGCGGTGCTGGCCGAGTCGAATCATTCG
TATCTCGAGGCGAGGCGGACGCTGGTGGCGCTGTCGTCGCAGTCGTGGCGCTTCACCATCTCGTCGATGCTGCGG
AGACGGAAGCCCATGGCCACGGGCGAGGCGGAACGACACCCACTGGTCGTGTGGCGGGCGATTGGCGGCGAAGGA
GTCGTGATGCCTGCGATTCGTCCGACGGGAAGCGCTGAGCTGGACCGCGAACTCTTCGACGCTCTCGTTCGGCCG
CTTCAGACGAGGGAGCGGAAGGCTCGTGATGCGGCGGATCGTCGACTTGCCCTCGGGATGAATCGGGATGAGGCG
GAGAGGGTTGGGGCGGTTCACGAGTGCGCGTGCTGCTTCTCCACGGCTGTGTTTGAGCAGTTTACGTGCTGTAAC
GAGGCGGGACACATGATGTGCTTCCGCTGCGTGCTGCACGCCACCAAGGAGGCTCTGTTCGGACAGTCTTGGCTA
AGCAGCTTCAGGATGGACACGGGCACTCTCCGATGCCTAGCCGTTGAAGGCGACGGCTGCAGCGGCTACATTCCC
GCCGATCAGCTTCGACGCGCCCTGACAGCCGATGATGATGACGACGACGACGACGACGACGAAGACGAGCACACG
CCTGGTGCCGACATGGTGCGACGACTGGACGAGCGGCTGGCGGAGCACAACCTGGCGACGTCGAGGCTGGCTCTG
ACGCGGTGTCCCTTTTGCAGCTACAGCGAGGTGGACGAGGCGACCTTGACGGGAGCACGGCCGCGGTTCACGACG
GGGGCCATGGCGGTGCTGGCGGTTGTGGCCGCCCTGCTGCTCCTCTCCCTGCCCGTCGCCCTCGTCTCAGCCCTG
GCCTGCGCCGTCATGGGCTCCGAAAGATCAGCGTGGCGGATGCTGCGACAGAGCTGGCAACGAGCCATGCACCGC
GTCCAACGCCGAAGACGCGGCCTCCGCTTCCGCTGCCAGAGCCCCCGCTGCGGCCGCCAATCCTGCCTCTCCTGC
CACAAACCCTGGACCGACGTCCACATCTGCCACGAATCCTCCCTGCTGGCGCTGCGAACGCAGGTGGAAACGGCC
ATGAGCATGGCCATCAAGCGCGTGTGCCCCCGCTGCGACACCTCGTTCGTCAAGAACTCGGGCTGCAACAAGCTG
ACGTGTCCCTGCGGCTACAAGATAGGGGGATGCGGCCCTGGCCTGTCGCGAGTGTCGCCGCTGTAA
Gene >Ophun1|989
ATGGTCTTCTCCGGCCTGCTCTCCCCCAGCAGCGATAAGGCATCGACAGCGAGCCGCAGCCGGTCCGGAAGCGAC
GGACTGATCTACGACGAGGCACAGCTGCCATGCGTACCGCCAGAGCGACCCAACCTGCGAGATCTCAACAACAGC
CTGGAGGCGCTGGCAGCCGTCTTCCCGGACGTGCAGACGGACGTGTTCCGCGAGCTGCTGACCAAGTTCGACGGG
GAGTCGCGGCTGGCTCTCGTGGCCGAGGCGCTGCTCAAGAACCGCGTGGCTTGGGTCAAGGGACGGTGGCGGACG
GTGACGGAGGATGGAGGCGGGGGAGTCTGCAAGGCGGATTCGTTTCGCAGTCCGGAGTATGCGCAGGCGGTTCGC
GCGCTGGCGTGGCACGAGTTTCGCGGGTTGTCGCGGTCGACGATGAATGCGGTGCTGGCCGAGTCGAATCATTCG
TATCTCGAGGCGAGGCGGACGCTGGTGGCGCTGTCGTCGCAGTCGTGGCGCTTCACCATCTCGTCGATGCTGCGG
AGACGGAAGCCCATGGCCACGGGCGAGGCGGAACGACACCCACTGGTCGTGTGGCGGGCGATTGGCGGCGAAGGA
GTCGTGATGCCTGCGATTCGTCCGACGGGAAGCGCTGAGCTGGACCGCGAACTCTTCGACGCTCTCGTTCGGCCG
CTTCAGACGAGGGAGCGGAAGGCTCGTGATGCGGCGGATCGTCGACTTGCCCTCGGGATGAATCGGGATGAGGCG
GAGAGGGTTGGGGCGGTTCACGAGTGCGCGTGCTGCTTCTCCACGGCTGTGTTTGAGCAGTTTACGTGCTGTAAC
GAGGCGGGACACATGATGTGCTTCCGCTGCGTGCTGCACGCCACCAAGGAGGCTCTGTTCGGACAGTCTTGGCTA
AGCAGCTTCAGGATGGACACGGGCACTCTCCGATGCCTAGCCGTTGAAGGCGACGGCTGCAGCGGCTACATTCCC
GCCGATCAGCTTCGACGCGCCCTGACAGCCGATGATGATGACGACGACGACGACGACGACGAAGACGAGCACACG
CCTGGTGCCGACATGGTGCGACGACTGGACGAGCGGCTGGCGGAGCACAACCTGGCGACGTCGAGGCTGGCTCTG
ACGCGGTGTCCCTTTTGCAGCTACAGCGAGGTGGACGAGGCGACCTTGACGGGAGCACGGCCGCGGTTCACGACG
GGGGCCATGGCGGTGCTGGCGGTTGTGGCCGCCCTGCTGCTCCTCTCCCTGCCCGTCGCCCTCGTCTCAGCCCTG
GCCTGCGCCGTCATGGGCTCCGAAAGATCAGCGTGGCGGATGCTGCGACAGAGCTGGCAACGAGCCATGCACCGC
GTCCAACGCCGAAGACGCGGCCTCCGCTTCCGCTGCCAGAGCCCCCGCTGCGGCCGCCAATCCTGCCTCTCCTGC
CACAAACCCTGGACCGACGTCCACATCTGCCACGAATCCTCCCTGCTGGCGCTGCGAACGCAGGTGGAAACGGCC
ATGAGCATGGCCATCAAGCGCGTGTGCCCCCGCTGCGACACCTCGTTCGTCAAGAACTCGGGCTGCAACAAGCTG
ACGTGTCCCTGCGGCTACAAGATGTGCTACGTCTGCCGCGCGGACCTGAGCGTGGTTGGGTACCGCCATTTCTGC
GATCATTTCCGGCCAGAGGGGGATGCGGCCCTGGCCTGTCGCGAGTGTCGCCGCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail