Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|983
Gene name
LocationContig_136:17602..19514
Strand-
Gene length (bp)1912
Transcript length (bp)1857
Coding sequence length (bp)1857
Protein length (aa) 619

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00250 Forkhead Forkhead domain 1.4E-34 299 383
PF00498 FHA FHA domain 5.1E-08 121 199

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5A7S7|FKH2_CANAL Fork-head transcriptional regulator 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=FKH2 PE=2 SV=1 99 385 1.0E-58
sp|P40466|FKH1_YEAST Fork head protein homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FKH1 PE=1 SV=1 64 401 2.0E-54
sp|O60129|FKH2_SCHPO Fork head protein homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fkh2 PE=1 SV=1 81 539 1.0E-51
sp|Q3UCQ1|FOXK2_MOUSE Forkhead box protein K2 OS=Mus musculus GN=Foxk2 PE=1 SV=3 101 412 2.0E-31
sp|Q7ZX03|FOXK2_XENLA Forkhead box protein K2 OS=Xenopus laevis GN=foxk2 PE=2 SV=2 99 467 3.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5A7S7|FKH2_CANAL Fork-head transcriptional regulator 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=FKH2 PE=2 SV=1 99 385 1.0E-58
sp|P40466|FKH1_YEAST Fork head protein homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FKH1 PE=1 SV=1 64 401 2.0E-54
sp|O60129|FKH2_SCHPO Fork head protein homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fkh2 PE=1 SV=1 81 539 1.0E-51
sp|Q3UCQ1|FOXK2_MOUSE Forkhead box protein K2 OS=Mus musculus GN=Foxk2 PE=1 SV=3 101 412 2.0E-31
sp|Q7ZX03|FOXK2_XENLA Forkhead box protein K2 OS=Xenopus laevis GN=foxk2 PE=2 SV=2 99 467 3.0E-30
sp|Q01167|FOXK2_HUMAN Forkhead box protein K2 OS=Homo sapiens GN=FOXK2 PE=1 SV=3 101 412 7.0E-30
sp|P41813|FKH2_YEAST Fork head protein homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FKH2 PE=1 SV=1 289 442 9.0E-30
sp|P85037|FOXK1_HUMAN Forkhead box protein K1 OS=Homo sapiens GN=FOXK1 PE=1 SV=1 101 434 1.0E-28
sp|P42128|FOXK1_MOUSE Forkhead box protein K1 OS=Mus musculus GN=Foxk1 PE=1 SV=2 299 434 5.0E-25
sp|Q63247|FOXJ1_RAT Forkhead box protein J1 OS=Rattus norvegicus GN=Foxj1 PE=2 SV=1 250 390 4.0E-23
sp|Q61660|FOXJ1_MOUSE Forkhead box protein J1 OS=Mus musculus GN=Foxj1 PE=2 SV=2 250 390 5.0E-23
sp|F1QDF8|FXJ1A_DANRE Forkhead box protein J1-A OS=Danio rerio GN=foxj1a PE=2 SV=1 255 393 6.0E-23
sp|Q92949|FOXJ1_HUMAN Forkhead box protein J1 OS=Homo sapiens GN=FOXJ1 PE=2 SV=3 277 393 1.0E-22
sp|Q9UPW0|FOXJ3_HUMAN Forkhead box protein J3 OS=Homo sapiens GN=FOXJ3 PE=1 SV=2 299 385 6.0E-22
sp|Q8BUR3|FOXJ3_MOUSE Forkhead box protein J3 OS=Mus musculus GN=Foxj3 PE=1 SV=1 299 385 8.0E-22
sp|Q32NH9|FXJ12_XENLA Forkhead box protein J1.2 OS=Xenopus laevis GN=foxj1.2 PE=2 SV=1 265 376 9.0E-22
sp|Q9PVY8|FXC2B_XENLA Forkhead box protein C2-B OS=Xenopus laevis GN=foxc2-b PE=2 SV=2 298 391 2.0E-21
sp|Q9PVY9|FXC2A_XENLA Forkhead box protein C2-A OS=Xenopus laevis GN=foxc2-a PE=2 SV=1 298 391 2.0E-21
sp|Q6NVT7|FOXC2_XENTR Forkhead box protein C2 OS=Xenopus tropicalis GN=foxc2 PE=2 SV=2 298 391 2.0E-21
sp|Q66IG8|FXJ12_XENTR Forkhead box protein J1.2 OS=Xenopus tropicalis GN=foxj1.2 PE=2 SV=1 265 376 2.0E-21
sp|Q32NP8|FXC1B_XENLA Forkhead box protein C1-B OS=Xenopus laevis GN=foxc1-b PE=2 SV=1 298 388 3.0E-21
sp|P56260|QIN_AVIS3 Transforming protein Qin OS=Avian sarcoma virus (strain 31) GN=V-QIN PE=2 SV=1 284 376 3.0E-21
sp|Q9PVZ3|FXC1A_XENLA Forkhead box protein C1-A OS=Xenopus laevis GN=foxc1-a PE=2 SV=1 298 388 3.0E-21
sp|Q90964|FOXG1_CHICK Forkhead box protein G1 OS=Gallus gallus GN=FOXG1 PE=2 SV=1 284 376 3.0E-21
sp|Q9YHC5|FOXG1_XENLA Forkhead box protein G1 OS=Xenopus laevis GN=foxg1 PE=2 SV=1 296 376 4.0E-21
sp|F1R8Z9|FXJ1B_DANRE Forkhead box protein J1-B OS=Danio rerio GN=foxj1b PE=2 SV=1 254 393 5.0E-21
sp|Q63246|FOXC2_RAT Forkhead box protein C2 OS=Rattus norvegicus GN=Foxc2 PE=1 SV=2 298 391 5.0E-21
sp|Q61850|FOXC2_MOUSE Forkhead box protein C2 OS=Mus musculus GN=Foxc2 PE=1 SV=2 298 391 5.0E-21
sp|Q61572|FOXC1_MOUSE Forkhead box protein C1 OS=Mus musculus GN=Foxc1 PE=1 SV=3 298 388 5.0E-21
sp|Q99958|FOXC2_HUMAN Forkhead box protein C2 OS=Homo sapiens GN=FOXC2 PE=1 SV=1 298 388 5.0E-21
sp|Q60987|FOXG1_MOUSE Forkhead box protein G1 OS=Mus musculus GN=Foxg1 PE=2 SV=1 296 385 6.0E-21
sp|Q00939|FOXG1_RAT Forkhead box protein G1 OS=Rattus norvegicus GN=Foxg1 PE=2 SV=1 296 385 6.0E-21
sp|Q5NDM2|FXI2A_XENLA Forkhead box protein I2-A OS=Xenopus laevis GN=foxi2-a PE=2 SV=1 261 388 8.0E-21
sp|Q12948|FOXC1_HUMAN Forkhead box protein C1 OS=Homo sapiens GN=FOXC1 PE=1 SV=3 298 388 8.0E-21
sp|Q1A1A6|FOXG1_CEBCA Forkhead box protein G1 OS=Cebus capucinus GN=FOXG1 PE=3 SV=1 299 376 8.0E-21
sp|Q1A1A1|FOXG1_CERSI Forkhead box protein G1 OS=Ceratotherium simum GN=FOXG1 PE=3 SV=1 299 376 8.0E-21
sp|Q1A1A3|FOXG1_EPOGA Forkhead box protein G1 OS=Epomophorus gambianus GN=FOXG1 PE=3 SV=1 299 376 9.0E-21
sp|P55316|FOXG1_HUMAN Forkhead box protein G1 OS=Homo sapiens GN=FOXG1 PE=1 SV=2 299 376 9.0E-21
sp|Q1A1A5|FOXG1_CHLPG Forkhead box protein G1 OS=Chlorocebus pygerythrus GN=FOXG1 PE=3 SV=1 299 376 9.0E-21
sp|Q68F77|FOXC1_XENTR Forkhead box protein C1 OS=Xenopus tropicalis GN=foxc1 PE=2 SV=1 298 388 1.0E-20
sp|Q1A1A2|FOXG1_EQUBU Forkhead box protein G1 OS=Equus burchelli GN=FOXG1 PE=3 SV=1 299 376 1.0E-20
sp|Q9DE25|FXC1A_DANRE Forkhead box C1-A OS=Danio rerio GN=foxc1a PE=2 SV=1 298 391 1.0E-20
sp|Q28HT3|FOXI2_XENTR Forkhead box protein I2 OS=Xenopus tropicalis GN=foxi2 PE=2 SV=1 261 388 1.0E-20
sp|Q1A1A4|FOXG1_PIPRU Forkhead box protein G1 OS=Pipistrellus rusticus GN=FOXG1 PE=3 SV=1 299 376 1.0E-20
sp|Q63ZH2|FXI2B_XENLA Forkhead box protein I2-B OS=Xenopus laevis GN=foxi2-b PE=2 SV=2 261 388 1.0E-20
sp|Q708W2|FXJ1A_XENLA Forkhead box protein J1-A OS=Xenopus laevis GN=foxj1-a PE=2 SV=1 242 393 1.0E-20
sp|Q8JIT5|FXI1C_XENLA Forkhead box protein I1c OS=Xenopus laevis GN=foxi1c PE=2 SV=1 243 388 1.0E-20
sp|Q5M7N6|FOXJ1_XENTR Forkhead box protein J1 OS=Xenopus tropicalis GN=foxj1 PE=2 SV=2 266 393 2.0E-20
sp|Q28EM1|FOXJ2_XENTR Forkhead box protein J2 OS=Xenopus tropicalis GN=foxj2 PE=2 SV=1 299 384 2.0E-20
sp|Q68EZ2|FOXJ2_XENLA Forkhead box protein J2 OS=Xenopus laevis GN=foxj2 PE=2 SV=1 299 384 2.0E-20
sp|P32027|CROC_DROME Fork head domain-containing protein crocodile OS=Drosophila melanogaster GN=croc PE=2 SV=2 286 388 3.0E-20
sp|Q9DE24|FXC1B_DANRE Forkhead box C1-B OS=Danio rerio GN=foxc1b PE=2 SV=1 298 391 3.0E-20
sp|Q708W1|FXJ1B_XENLA Forkhead box protein J1-B OS=Xenopus laevis GN=foxj1-b PE=2 SV=1 297 393 4.0E-20
sp|Q3SYB3|FX4L6_HUMAN Forkhead box protein D4-like 6 OS=Homo sapiens GN=FOXD4L6 PE=1 SV=2 285 505 6.0E-20
sp|P32030|SLP1_DROME Fork head domain transcription factor slp1 OS=Drosophila melanogaster GN=slp1 PE=2 SV=1 299 385 1.0E-19
sp|Q12951|FOXI1_HUMAN Forkhead box protein I1 OS=Homo sapiens GN=FOXI1 PE=1 SV=3 298 388 1.0E-19
sp|P41813|FKH2_YEAST Fork head protein homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FKH2 PE=1 SV=1 99 227 2.0E-19
sp|Q28D67|FXI1C_XENTR Forkhead box protein I1c OS=Xenopus tropicalis GN=foxi1c PE=2 SV=1 298 388 2.0E-19
sp|Q9P0K8|FOXJ2_HUMAN Forkhead box protein J2 OS=Homo sapiens GN=FOXJ2 PE=1 SV=1 290 429 2.0E-19
sp|P32031|SLP2_DROME Fork head domain transcription factor slp2 OS=Drosophila melanogaster GN=slp2 PE=2 SV=2 299 385 2.0E-19
sp|Q64731|FOXL1_MOUSE Forkhead box protein L1 OS=Mus musculus GN=Foxl1 PE=2 SV=2 299 388 2.0E-19
sp|Q8WXT5|FX4L4_HUMAN Forkhead box protein D4-like 4 OS=Homo sapiens GN=FOXD4L4 PE=2 SV=2 285 464 3.0E-19
sp|Q6ZQN5|FOXI2_HUMAN Forkhead box protein I2 OS=Homo sapiens GN=FOXI2 PE=2 SV=2 298 387 3.0E-19
sp|Q61574|FOXS1_MOUSE Forkhead box protein S1 OS=Mus musculus GN=Foxs1 PE=2 SV=2 299 391 4.0E-19
sp|Q7ZYQ0|FXI1E_XENLA Forkhead box protein I1-ema OS=Xenopus laevis GN=foxi1e PE=2 SV=1 298 388 4.0E-19
sp|Q922I5|FOXI1_MOUSE Forkhead box protein I1 OS=Mus musculus GN=Foxi1 PE=2 SV=2 298 388 4.0E-19
sp|Q6VB84|FX4L3_HUMAN Forkhead box protein D4-like 3 OS=Homo sapiens GN=FOXD4L3 PE=2 SV=2 285 505 4.0E-19
sp|Q6P8A3|FXI1E_XENTR Forkhead box protein I1-ema OS=Xenopus tropicalis GN=foxi1e PE=2 SV=1 298 388 5.0E-19
sp|A8MTJ6|FOXI3_HUMAN Forkhead box protein I3 OS=Homo sapiens GN=FOXI3 PE=2 SV=3 292 388 5.0E-19
sp|O43638|FOXS1_HUMAN Forkhead box protein S1 OS=Homo sapiens GN=FOXS1 PE=2 SV=2 299 391 7.0E-19
sp|Q5VV16|FX4L5_HUMAN Forkhead box protein D4-like 5 OS=Homo sapiens GN=FOXD4L5 PE=3 SV=1 285 505 7.0E-19
sp|O00358|FOXE1_HUMAN Forkhead box protein E1 OS=Homo sapiens GN=FOXE1 PE=1 SV=3 296 388 8.0E-19
sp|B5RHS5|FOXI3_CANLF Forkhead box protein I3 OS=Canis lupus familiaris GN=FOXI3 PE=3 SV=1 292 388 8.0E-19
sp|Q9ES18|FOXJ2_MOUSE Forkhead box protein J2 OS=Mus musculus GN=Foxj2 PE=2 SV=1 296 386 9.0E-19
sp|Q8ITI5|FOXG1_MNELE Forkhead box protein G1 OS=Mnemiopsis leidyi GN=FOXG1 PE=2 SV=1 299 403 9.0E-19
sp|Q12952|FOXL1_HUMAN Forkhead box protein L1 OS=Homo sapiens GN=FOXL1 PE=2 SV=2 299 388 9.0E-19
sp|Q9NU39|FX4L1_HUMAN Forkhead box protein D4-like 1 OS=Homo sapiens GN=FOXD4L1 PE=2 SV=1 285 388 1.0E-18
sp|Q91905|FXI1B_XENLA Forkhead box protein I1-B OS=Xenopus laevis GN=foxi1-b PE=2 SV=1 298 388 1.0E-18
sp|Q3I5G5|FOXI2_MOUSE Forkhead box protein I2 OS=Mus musculus GN=Foxi2 PE=2 SV=1 264 388 2.0E-18
sp|P79772|FOXD3_CHICK Forkhead box protein D3 OS=Gallus gallus GN=FOXD3 PE=2 SV=1 298 388 3.0E-18
sp|Q91904|FXI1A_XENLA Forkhead box protein I1-A OS=Xenopus laevis GN=foxi1-a PE=1 SV=1 298 388 3.0E-18
sp|P32183|FOXA3_RAT Hepatocyte nuclear factor 3-gamma OS=Rattus norvegicus GN=Foxa3 PE=1 SV=1 276 404 3.0E-18
sp|P55317|FOXA1_HUMAN Hepatocyte nuclear factor 3-alpha OS=Homo sapiens GN=FOXA1 PE=1 SV=2 297 393 3.0E-18
sp|Q9PTK2|FOXE4_XENLA Forkhead box protein E4 OS=Xenopus laevis GN=foxe4 PE=2 SV=1 296 388 3.0E-18
sp|P35582|FOXA1_MOUSE Hepatocyte nuclear factor 3-alpha OS=Mus musculus GN=Foxa1 PE=1 SV=2 297 393 4.0E-18
sp|P35584|FOXA3_MOUSE Hepatocyte nuclear factor 3-gamma OS=Mus musculus GN=Foxa3 PE=1 SV=1 275 404 4.0E-18
sp|Q5M7L9|FOXD3_XENTR Forkhead box protein D3 OS=Xenopus tropicalis GN=foxd3 PE=2 SV=1 298 388 4.0E-18
sp|Q8R2I0|FOXE1_MOUSE Forkhead box protein E1 OS=Mus musculus GN=Foxe1 PE=1 SV=2 296 388 4.0E-18
sp|Q6P2Z3|FOXI1_XENTR Forkhead box protein I1 OS=Xenopus tropicalis GN=foxi1 PE=2 SV=1 298 388 4.0E-18
sp|P23512|FOXA1_RAT Hepatocyte nuclear factor 3-alpha OS=Rattus norvegicus GN=Foxa1 PE=1 SV=1 297 393 4.0E-18
sp|Q60688|FOXD4_MOUSE Forkhead box protein D4 OS=Mus musculus GN=Foxd4 PE=2 SV=1 273 388 7.0E-18
sp|Q12950|FOXD4_HUMAN Forkhead box protein D4 OS=Homo sapiens GN=FOXD4 PE=2 SV=4 285 393 8.0E-18
sp|Q8AWH1|FOXA1_XENTR Forkhead box protein A1 OS=Xenopus tropicalis GN=foxa1 PE=2 SV=1 297 393 8.0E-18
sp|Q63248|FOXI2_RAT Forkhead box protein I2 (Fragment) OS=Rattus norvegicus GN=Foxi2 PE=2 SV=1 298 376 9.0E-18
sp|Q3Y598|FOXA3_BOVIN Hepatocyte nuclear factor 3-gamma OS=Bos taurus GN=FOXA3 PE=2 SV=1 297 393 9.0E-18
sp|P55318|FOXA3_HUMAN Hepatocyte nuclear factor 3-gamma OS=Homo sapiens GN=FOXA3 PE=1 SV=2 297 393 9.0E-18
sp|O43058|SEP1_SCHPO Forkhead protein sep1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sep1 PE=1 SV=1 285 402 1.0E-17
sp|Q9DEN3|FXD3B_XENLA Forkhead box protein D3-B OS=Xenopus laevis GN=foxd3-b PE=2 SV=1 298 391 1.0E-17
sp|Q63249|FOXD4_RAT Forkhead box protein D4 (Fragment) OS=Rattus norvegicus GN=Foxd4 PE=2 SV=1 299 388 1.0E-17
sp|Q9DEN4|FXD3A_XENLA Forkhead box protein D3-A OS=Xenopus laevis GN=foxd3-a PE=1 SV=1 298 391 1.0E-17
sp|Q17241|SGF1_BOMMO Silk gland factor 1 OS=Bombyx mori GN=SGF1 PE=2 SV=1 297 393 1.0E-17
sp|Q9UJU5|FOXD3_HUMAN Forkhead box protein D3 OS=Homo sapiens GN=FOXD3 PE=1 SV=1 298 388 1.0E-17
sp|Q61060|FOXD3_MOUSE Forkhead box protein D3 OS=Mus musculus GN=Foxd3 PE=2 SV=3 298 388 1.0E-17
sp|Q6LD29|FXA1A_XENLA Forkhead box protein A1-A OS=Xenopus laevis GN=foxa1-a PE=2 SV=2 297 407 1.0E-17
sp|Q91765|FXA2A_XENLA Forkhead box protein A2-A OS=Xenopus laevis GN=foxa2-a PE=1 SV=1 226 393 2.0E-17
sp|Q5WM45|FOXD5_XENTR Forkhead box protein D5 OS=Xenopus tropicalis GN=foxd5 PE=2 SV=1 298 388 2.0E-17
sp|Q5J3Q5|FOXE1_XENLA Forkhead box protein E1 OS=Xenopus laevis GN=foxe1 PE=2 SV=1 295 385 2.0E-17
sp|P32315|FXA1B_XENLA Forkhead box protein A1-B OS=Xenopus laevis GN=foxa1-b PE=2 SV=1 297 393 3.0E-17
sp|Q9PT68|FXD5B_XENLA Forkhead box protein D5-B OS=Xenopus laevis GN=foxd5-b PE=2 SV=1 298 388 3.0E-17
sp|Q9PRJ8|FXD5A_XENLA Forkhead box protein D5-A OS=Xenopus laevis GN=foxd5-a PE=2 SV=1 298 388 4.0E-17
sp|P14734|FKH_DROME Protein fork head OS=Drosophila melanogaster GN=fkh PE=1 SV=1 297 393 4.0E-17
sp|Q9QY14|FOXE3_MOUSE Forkhead box protein E3 OS=Mus musculus GN=Foxe3 PE=1 SV=1 296 388 6.0E-17
sp|Q63250|FOXE3_RAT Forkhead box protein E3 OS=Rattus norvegicus GN=Foxe3 PE=2 SV=2 296 388 6.0E-17
sp|P33206|FXA4B_XENLA Forkhead box protein A4-B OS=Xenopus laevis GN=foxa4-b PE=2 SV=1 297 393 6.0E-17
sp|Q6P839|FOXA4_XENTR Forkhead box protein A4 OS=Xenopus tropicalis GN=foxa4 PE=2 SV=1 297 393 7.0E-17
sp|Q9Y261|FOXA2_HUMAN Hepatocyte nuclear factor 3-beta OS=Homo sapiens GN=FOXA2 PE=1 SV=1 272 393 8.0E-17
sp|Q7T1R4|FOXA2_XENTR Forkhead box protein A2 OS=Xenopus tropicalis GN=foxa2 PE=2 SV=1 226 393 8.0E-17
sp|Q13461|FOXE3_HUMAN Forkhead box protein E3 OS=Homo sapiens GN=FOXE3 PE=1 SV=2 299 387 1.0E-16
sp|P33205|FXA4A_XENLA Forkhead box protein A4-A OS=Xenopus laevis GN=foxa4-a PE=1 SV=3 297 393 1.0E-16
sp|P35583|FOXA2_MOUSE Hepatocyte nuclear factor 3-beta OS=Mus musculus GN=Foxa2 PE=1 SV=2 272 393 1.0E-16
sp|Q63245|FOXD3_RAT Forkhead box protein D3 (Fragment) OS=Rattus norvegicus GN=Foxd3 PE=1 SV=1 298 388 1.0E-16
sp|Q02361|FD3_DROME Fork head domain-containing protein FD3 OS=Drosophila melanogaster GN=fd59A PE=2 SV=2 298 393 1.0E-16
sp|O14270|FHL1_SCHPO Fork head transcription factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fhl1 PE=3 SV=2 299 376 2.0E-16
sp|Q6F2E4|FOXD1_XENTR Forkhead box protein D1 OS=Xenopus tropicalis GN=foxd1 PE=2 SV=1 298 387 2.0E-16
sp|O35392|FOXD2_MOUSE Forkhead box protein D2 OS=Mus musculus GN=Foxd2 PE=2 SV=1 298 387 2.0E-16
sp|P84961|FXA2B_XENLA Forkhead box protein A2-B OS=Xenopus laevis GN=foxa2-b PE=2 SV=1 244 393 4.0E-16
sp|Q9PT67|FXD5C_XENLA Forkhead box protein D5-C OS=Xenopus laevis GN=foxd5-c PE=2 SV=1 298 388 4.0E-16
sp|O60548|FOXD2_HUMAN Forkhead box protein D2 OS=Homo sapiens GN=FOXD2 PE=2 SV=2 298 387 5.0E-16
sp|Q16676|FOXD1_HUMAN Forkhead box protein D1 OS=Homo sapiens GN=FOXD1 PE=2 SV=1 298 387 5.0E-16
sp|Q98937|FOXD1_CHICK Forkhead box protein D1 OS=Gallus gallus GN=FOXD1 PE=2 SV=1 298 387 6.0E-16
sp|Q07342|FOXA2_DANRE Forkhead box protein A2 OS=Danio rerio GN=foxa2 PE=2 SV=1 297 393 7.0E-16
sp|Q9PSY4|FOXD1_XENLA Forkhead box protein D1 OS=Xenopus laevis GN=foxd1 PE=2 SV=2 298 388 7.0E-16
sp|Q02360|FD2_DROME Fork head domain-containing protein FD2 OS=Drosophila melanogaster GN=fd64A PE=2 SV=2 288 389 7.0E-16
sp|P32028|FD4_DROME Fork head domain-containing protein FD4 OS=Drosophila melanogaster GN=fd96Ca PE=2 SV=2 299 393 7.0E-16
sp|Q90WN4|FOXD2_XENLA Forkhead box protein D2 OS=Xenopus laevis GN=foxd2 PE=2 SV=1 298 388 7.0E-16
sp|Q61345|FOXD1_MOUSE Forkhead box protein D1 OS=Mus musculus GN=Foxd1 PE=2 SV=2 298 387 8.0E-16
sp|Q64732|FOXB1_MOUSE Forkhead box protein B1 OS=Mus musculus GN=Foxb1 PE=2 SV=2 299 393 9.0E-16
sp|Q99853|FOXB1_HUMAN Forkhead box protein B1 OS=Homo sapiens GN=FOXB1 PE=1 SV=3 299 393 9.0E-16
sp|O42097|FOXA2_ORYLA Hepatocyte nuclear factor 3-beta OS=Oryzias latipes GN=foxa2 PE=2 SV=1 297 409 9.0E-16
sp|Q64733|FOXB2_MOUSE Forkhead box protein B2 OS=Mus musculus GN=Foxb2 PE=2 SV=1 299 393 1.0E-15
sp|Q5VYV0|FOXB2_HUMAN Forkhead box protein B2 OS=Homo sapiens GN=FOXB2 PE=3 SV=1 299 393 1.0E-15
sp|P25364|HCM1_YEAST Forkhead transcription factor HCM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HCM1 PE=1 SV=3 299 398 5.0E-15
sp|Q17381|PHA4_CAEEL Defective pharyngeal development protein 4 OS=Caenorhabditis elegans GN=pha-4 PE=1 SV=1 265 393 6.0E-15
sp|P32182|FOXA2_RAT Hepatocyte nuclear factor 3-beta OS=Rattus norvegicus GN=Foxa2 PE=1 SV=1 272 393 7.0E-15
sp|Q63251|FOXD1_RAT Forkhead box protein D1 (Fragment) OS=Rattus norvegicus GN=Foxd1 PE=2 SV=1 298 388 1.0E-14
sp|Q8JIT6|FOXB2_XENLA Forkhead box protein B2 OS=Xenopus laevis GN=foxb2 PE=2 SV=1 299 391 2.0E-14
sp|O93529|FOXB1_XENLA Forkhead box protein B1 OS=Xenopus laevis GN=foxb1 PE=2 SV=1 299 393 4.0E-14
sp|O54743|FOXF2_MOUSE Forkhead box protein F2 OS=Mus musculus GN=Foxf2 PE=2 SV=2 299 376 5.0E-14
sp|Q12947|FOXF2_HUMAN Forkhead box protein F2 OS=Homo sapiens GN=FOXF2 PE=1 SV=2 299 376 5.0E-14
sp|Q12946|FOXF1_HUMAN Forkhead box protein F1 OS=Homo sapiens GN=FOXF1 PE=1 SV=2 299 376 6.0E-14
sp|Q9VS05|FOXF_DROME Forkhead box protein biniou OS=Drosophila melanogaster GN=bin PE=1 SV=2 299 376 6.0E-14
sp|O13606|MEI4_SCHPO Meiosis-specific transcription factor mei4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mei4 PE=3 SV=1 299 385 7.0E-14
sp|A1L1S5|FOXF1_DANRE Forkhead box protein F1 OS=Danio rerio GN=foxf1 PE=2 SV=1 299 376 7.0E-14
sp|Q61080|FOXF1_MOUSE Forkhead box protein F1 OS=Mus musculus GN=Foxf1 PE=2 SV=2 299 376 8.0E-14
sp|P34683|LIN31_CAEEL Protein lin-31 OS=Caenorhabditis elegans GN=lin-31 PE=3 SV=1 299 380 1.0E-13
sp|O08696|FOXM1_MOUSE Forkhead box protein M1 OS=Mus musculus GN=Foxm1 PE=1 SV=2 282 376 1.0E-13
sp|O14270|FHL1_SCHPO Fork head transcription factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fhl1 PE=3 SV=2 99 229 2.0E-13
sp|Q9W707|FXF1B_XENLA Forkhead box protein F1-B OS=Xenopus laevis GN=foxf1-b PE=2 SV=1 299 376 2.0E-13
sp|Q9W706|FXF1A_XENLA Forkhead box protein F1-A OS=Xenopus laevis GN=foxf1-a PE=2 SV=1 299 376 2.0E-13
sp|Q28BS5|FOXF1_XENTR Forkhead box protein F1 OS=Xenopus tropicalis GN=foxf1 PE=2 SV=1 299 376 2.0E-13
sp|O88470|FOXL2_MOUSE Forkhead box protein L2 OS=Mus musculus GN=Foxl2 PE=1 SV=2 299 386 3.0E-13
sp|Q6VFT6|FOXL2_PIG Forkhead box protein L2 OS=Sus scrofa GN=FOXL2 PE=3 SV=1 299 386 4.0E-13
sp|Q6VFT5|FOXL2_RABIT Forkhead box protein L2 OS=Oryctolagus cuniculus GN=FOXL2 PE=3 SV=1 299 386 4.0E-13
sp|Q4VUF1|FOXL2_ELLLU Forkhead box protein L2 OS=Ellobius lutescens GN=FOXL2 PE=3 SV=1 299 386 4.0E-13
sp|P58012|FOXL2_HUMAN Forkhead box protein L2 OS=Homo sapiens GN=FOXL2 PE=1 SV=1 299 386 4.0E-13
sp|P32029|FD5_DROME Fork head domain-containing protein FD5 OS=Drosophila melanogaster GN=fd96Cb PE=2 SV=2 285 393 5.0E-13
sp|Q8MIP2|FOXL2_CAPHI Forkhead box protein L2 OS=Capra hircus GN=FOXL2 PE=1 SV=1 299 386 5.0E-13
sp|Q6VFT7|FOXL2_BOVIN Forkhead box protein L2 OS=Bos taurus GN=FOXL2 PE=2 SV=1 299 386 6.0E-13
sp|Q33BP8|FOXN3_PIG Forkhead box protein N3 OS=Sus scrofa GN=FOXN3 PE=2 SV=1 297 415 6.0E-13
sp|A4IFD2|FOXP1_BOVIN Forkhead box protein P1 OS=Bos taurus GN=FOXP1 PE=2 SV=1 298 376 6.0E-13
sp|Q498D1|FOXP1_RAT Forkhead box protein P1 OS=Rattus norvegicus GN=Foxp1 PE=1 SV=1 298 376 6.0E-13
sp|P58462|FOXP1_MOUSE Forkhead box protein P1 OS=Mus musculus GN=Foxp1 PE=1 SV=1 298 376 7.0E-13
sp|Q499D0|FOXN3_MOUSE Forkhead box protein N3 OS=Mus musculus GN=Foxn3 PE=1 SV=1 285 386 7.0E-13
sp|Q58NQ4|FOXP1_CHICK Forkhead box protein P1 OS=Gallus gallus GN=FOXP1 PE=2 SV=1 298 376 7.0E-13
sp|Q9H334|FOXP1_HUMAN Forkhead box protein P1 OS=Homo sapiens GN=FOXP1 PE=1 SV=1 298 376 8.0E-13
sp|O00409|FOXN3_HUMAN Forkhead box protein N3 OS=Homo sapiens GN=FOXN3 PE=1 SV=1 289 386 9.0E-13
sp|Q8K3Q3|FOXN4_MOUSE Forkhead box protein N4 OS=Mus musculus GN=Foxn4 PE=1 SV=1 299 408 9.0E-13
sp|Q2LE08|FXP1B_DANRE Forkhead box protein P1-B OS=Danio rerio GN=foxp1b PE=2 SV=1 298 376 1.0E-12
sp|O15409|FOXP2_HUMAN Forkhead box protein P2 OS=Homo sapiens GN=FOXP2 PE=1 SV=2 298 376 1.0E-12
sp|Q9DBY0|FOXP4_MOUSE Forkhead box protein P4 OS=Mus musculus GN=Foxp4 PE=1 SV=1 298 391 1.0E-12
sp|Q8IVH2|FOXP4_HUMAN Forkhead box protein P4 OS=Homo sapiens GN=FOXP4 PE=1 SV=1 298 391 1.0E-12
sp|P0CF24|FOXP2_RAT Forkhead box protein P2 OS=Rattus norvegicus GN=Foxp2 PE=3 SV=1 298 376 1.0E-12
sp|Q8MJ98|FOXP2_PONPY Forkhead box protein P2 OS=Pongo pygmaeus GN=FOXP2 PE=2 SV=3 298 376 1.0E-12
sp|Q4VYS1|FOXP2_XENLA Forkhead box protein P2 OS=Xenopus laevis GN=foxp2 PE=2 SV=1 298 391 1.0E-12
sp|Q4VYR7|FOXP4_XENLA Forkhead box protein P4 OS=Xenopus laevis GN=foxp4 PE=2 SV=1 298 376 1.0E-12
sp|Q5QL03|FOXP2_HYLLA Forkhead box protein P2 OS=Hylobates lar GN=FOXP2 PE=3 SV=1 298 376 1.0E-12
sp|Q8MJ99|FOXP2_GORGO Forkhead box protein P2 OS=Gorilla gorilla gorilla GN=FOXP2 PE=2 SV=1 298 376 1.0E-12
sp|P58463|FOXP2_MOUSE Forkhead box protein P2 OS=Mus musculus GN=Foxp2 PE=1 SV=2 298 376 1.0E-12
sp|Q8MJ97|FOXP2_MACMU Forkhead box protein P2 OS=Macaca mulatta GN=FOXP2 PE=2 SV=1 298 376 1.0E-12
sp|Q8MJA0|FOXP2_PANTR Forkhead box protein P2 OS=Pan troglodytes GN=FOXP2 PE=2 SV=1 298 376 1.0E-12
sp|Q8HZ00|FOXP2_PANPA Forkhead box protein P2 OS=Pan paniscus GN=FOXP2 PE=2 SV=1 298 376 1.0E-12
sp|Q28G71|FOXN3_XENTR Forkhead box protein N3 OS=Xenopus tropicalis GN=foxn3 PE=2 SV=1 285 386 1.0E-12
sp|P97691|FOXM1_RAT Forkhead box protein M1 OS=Rattus norvegicus GN=Foxm1 PE=2 SV=2 282 376 2.0E-12
sp|Q61575|FOXN1_MOUSE Forkhead box protein N1 OS=Mus musculus GN=Foxn1 PE=1 SV=1 299 393 2.0E-12
sp|O15353|FOXN1_HUMAN Forkhead box protein N1 OS=Homo sapiens GN=FOXN1 PE=2 SV=1 299 393 2.0E-12
sp|Q5W1J5|FOXP1_XENLA Forkhead box protein P1 OS=Xenopus laevis GN=foxp1 PE=1 SV=1 298 376 2.0E-12
sp|Q3BJS3|FOXN3_XENLA Forkhead box protein N3 OS=Xenopus laevis GN=foxn3 PE=2 SV=1 285 386 2.0E-12
sp|Q96NZ1|FOXN4_HUMAN Forkhead box protein N4 OS=Homo sapiens GN=FOXN4 PE=2 SV=2 299 393 3.0E-12
sp|Q28F43|FOXN2_XENTR Forkhead box protein N2 OS=Xenopus tropicalis GN=foxn2 PE=2 SV=1 289 386 8.0E-12
sp|P32314|FOXN2_HUMAN Forkhead box protein N2 OS=Homo sapiens GN=FOXN2 PE=1 SV=3 299 386 8.0E-12
sp|Q66J77|FOXN2_XENLA Forkhead box protein N2 OS=Xenopus laevis GN=foxn2 PE=2 SV=1 289 386 1.0E-11
sp|Q08050|FOXM1_HUMAN Forkhead box protein M1 OS=Homo sapiens GN=FOXM1 PE=1 SV=3 299 376 2.0E-11
sp|Q9WVH3|FOXO4_MOUSE Forkhead box protein O4 OS=Mus musculus GN=Foxo4 PE=1 SV=1 303 416 2.0E-11
sp|Q3BJS1|FOXN4_XENLA Forkhead box protein N4 OS=Xenopus laevis GN=foxn4 PE=2 SV=1 299 376 2.0E-11
sp|Q99JB6|FOXP3_MOUSE Forkhead box protein P3 OS=Mus musculus GN=Foxp3 PE=1 SV=1 289 376 3.0E-11
sp|Q9BZS1|FOXP3_HUMAN Forkhead box protein P3 OS=Homo sapiens GN=FOXP3 PE=1 SV=1 289 376 3.0E-11
sp|Q6U8D7|FOXP3_MACFA Forkhead box protein P3 OS=Macaca fascicularis GN=FOXP3 PE=2 SV=1 289 376 3.0E-11
sp|A2BGM5|FOXN4_DANRE Forkhead box protein N4 OS=Danio rerio GN=foxn4 PE=1 SV=1 299 376 4.0E-11
sp|P39521|FHL1_YEAST Pre-rRNA-processing protein FHL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FHL1 PE=1 SV=1 63 211 6.0E-11
sp|P98177|FOXO4_HUMAN Forkhead box protein O4 OS=Homo sapiens GN=FOXO4 PE=1 SV=5 303 376 6.0E-11
sp|Q5W1J6|FOXM1_XENLA Forkhead box protein M1 OS=Xenopus laevis GN=foxm1 PE=2 SV=1 299 376 8.0E-11
sp|Q63244|FOXQ1_RAT Forkhead box protein Q1 OS=Rattus norvegicus GN=Foxq1 PE=1 SV=3 299 376 1.0E-10
sp|B4JSC2|FOXO_DROGR Forkhead box protein O OS=Drosophila grimshawi GN=foxo PE=3 SV=1 303 381 1.0E-10
sp|O70220|FOXQ1_MOUSE Forkhead box protein Q1 OS=Mus musculus GN=Foxq1 PE=2 SV=3 299 376 1.0E-10
sp|Q9C009|FOXQ1_HUMAN Forkhead box protein Q1 OS=Homo sapiens GN=FOXQ1 PE=2 SV=2 299 376 1.0E-10
sp|B4MB78|FOXO_DROVI Forkhead box protein O OS=Drosophila virilis GN=foxo PE=3 SV=1 303 381 1.0E-10
sp|B4KBF6|FOXO_DROMO Forkhead box protein O OS=Drosophila mojavensis GN=foxo PE=3 SV=1 303 381 1.0E-10
sp|Q70KY4|FOXO6_MOUSE Forkhead box protein O6 OS=Mus musculus GN=Foxo6 PE=1 SV=1 303 376 4.0E-10
sp|O16850|FOXO_CAEEL Forkhead box protein O OS=Caenorhabditis elegans GN=daf-16 PE=1 SV=3 303 381 5.0E-10
sp|A8MYZ6|FOXO6_HUMAN Forkhead box protein O6 OS=Homo sapiens GN=FOXO6 PE=1 SV=1 303 376 6.0E-10
sp|B4HF64|FOXO_DROSE Forkhead box protein O OS=Drosophila sechellia GN=foxo PE=3 SV=2 303 381 7.0E-10
sp|B4PTD3|FOXO_DROYA Forkhead box protein O OS=Drosophila yakuba GN=foxo PE=3 SV=2 303 381 7.0E-10
sp|Q95V55|FOXO_DROME Forkhead box protein O OS=Drosophila melanogaster GN=foxo PE=1 SV=1 303 381 7.0E-10
sp|B3P0K6|FOXO_DROER Forkhead box protein O OS=Drosophila erecta GN=foxo PE=3 SV=2 303 381 7.0E-10
sp|B3LYS5|FOXO_DROAN Forkhead box protein O OS=Drosophila ananassae GN=foxo PE=3 SV=2 303 381 8.0E-10
sp|B4NFR1|FOXO_DROWI Forkhead box protein O OS=Drosophila willistoni GN=foxo PE=3 SV=1 303 381 8.0E-10
sp|Q59ZC8|FHL1_CANAL Fork-head transcriptional regulator FHL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=FHL1 PE=1 SV=1 99 278 8.0E-10
sp|B4G4S8|FOXO_DROPE Forkhead box protein O OS=Drosophila persimilis GN=foxo PE=3 SV=2 303 381 8.0E-10
sp|Q298W7|FOXO_DROPS Forkhead box protein O OS=Drosophila pseudoobscura pseudoobscura GN=foxo PE=3 SV=2 303 381 9.0E-10
sp|O43524|FOXO3_HUMAN Forkhead box protein O3 OS=Homo sapiens GN=FOXO3 PE=1 SV=1 302 380 1.0E-09
sp|O88621|FOXH1_MOUSE Forkhead box protein H1 OS=Mus musculus GN=Foxh1 PE=1 SV=1 296 433 1.0E-09
sp|Q9WVH4|FOXO3_MOUSE Forkhead box protein O3 OS=Mus musculus GN=Foxo3 PE=1 SV=1 302 380 1.0E-09
sp|O75593|FOXH1_HUMAN Forkhead box protein H1 OS=Homo sapiens GN=FOXH1 PE=1 SV=1 296 414 2.0E-09
sp|Q66JJ0|FOXO1_XENTR Forkhead box protein O1 OS=Xenopus tropicalis GN=foxo1 PE=2 SV=1 303 376 2.0E-09
sp|A3RK74|FX1AA_DANRE Forkhead box protein O1-A OS=Danio rerio GN=foxo1a PE=2 SV=1 303 376 2.0E-09
sp|Q6EUW2|FOXO1_XENLA Forkhead box protein O1 OS=Xenopus laevis GN=foxo1 PE=2 SV=1 303 376 2.0E-09
sp|A3RK75|FX1AB_DANRE Forkhead box protein O1-B OS=Danio rerio GN=foxo1b PE=2 SV=1 303 376 3.0E-09
sp|Q8JIT7|FAST3_XENLA Forkhead activin signal transducer 3 OS=Xenopus laevis GN=fast3 PE=1 SV=1 296 376 4.0E-09
sp|Q6EUW1|FOXO3_XENLA Forkhead box protein O3 OS=Xenopus laevis GN=foxo3 PE=2 SV=1 303 376 9.0E-09
sp|E1BPQ1|FOXO1_BOVIN Forkhead box protein O1 OS=Bos taurus GN=FOXO1 PE=3 SV=2 303 376 1.0E-08
sp|A4L7N3|FOXO1_PIG Forkhead box protein O1 OS=Sus scrofa GN=FOXO1 PE=2 SV=1 303 376 1.0E-08
sp|Q12778|FOXO1_HUMAN Forkhead box protein O1 OS=Homo sapiens GN=FOXO1 PE=1 SV=2 303 376 1.0E-08
sp|Q9R1E0|FOXO1_MOUSE Forkhead box protein O1 OS=Mus musculus GN=Foxo1 PE=1 SV=2 303 376 1.0E-08
sp|G3V7R4|FOXO1_RAT Forkhead box protein O1 OS=Rattus norvegicus GN=Foxo1 PE=1 SV=1 303 376 1.0E-08
sp|Q810W5|FOXO1_ICTTR Forkhead box protein O1 OS=Ictidomys tridecemlineatus GN=FOXO1 PE=1 SV=1 303 376 1.0E-08
sp|Q28GC4|FOXH1_XENTR Forkhead box protein H1 OS=Xenopus tropicalis GN=foxh1 PE=2 SV=1 296 376 2.0E-08
sp|Q9I9E1|FOXH1_DANRE Forkhead box protein H1 OS=Danio rerio GN=foxh1 PE=1 SV=1 296 376 3.0E-08
sp|Q9SFV6|FHA1_ARATH FHA domain-containing protein FHA1 OS=Arabidopsis thaliana GN=FHA1 PE=2 SV=1 101 209 5.0E-08
sp|Q28H65|FOXN5_XENTR Forkhead box protein N5 OS=Xenopus tropicalis GN=foxn5 PE=2 SV=1 299 360 5.0E-08
sp|Q945P0|FHA1_TOBAC Transcriptional activator FHA1 OS=Nicotiana tabacum GN=FHA1 PE=1 SV=1 101 209 7.0E-08
sp|Q3BJS0|FOXN5_XENLA Forkhead box protein N5 OS=Xenopus laevis GN=foxn5 PE=2 SV=1 299 360 9.0E-08
sp|Q9SFV2|FHA2_ARATH FHA domain-containing protein FHA2 OS=Arabidopsis thaliana GN=FHA2 PE=1 SV=1 101 209 1.0E-07
sp|P70056|FOXH1_XENLA Forkhead box protein H1 OS=Xenopus laevis GN=foxh1 PE=1 SV=3 296 376 5.0E-07
sp|Q3UM89|FOXR2_MOUSE Forkhead box protein R2 OS=Mus musculus GN=Foxr2 PE=2 SV=1 241 380 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0043565 sequence-specific DNA binding Yes
GO:0003700 DNA-binding transcription factor activity Yes
GO:0005515 protein binding Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0003677 DNA binding No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:1901363 heterocyclic compound binding No
GO:0140110 transcription regulator activity No
GO:0009889 regulation of biosynthetic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0010468 regulation of gene expression No
GO:2001141 regulation of RNA biosynthetic process No
GO:0019222 regulation of metabolic process No
GO:0051252 regulation of RNA metabolic process No
GO:0031323 regulation of cellular metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0050794 regulation of cellular process No
GO:0003676 nucleic acid binding No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0065007 biological regulation No
GO:0080090 regulation of primary metabolic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0050789 regulation of biological process No
GO:0031326 regulation of cellular biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Forkhead

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|983
MPLSAKRSQRVRRDLRNKDRAVDADAEPDQSSPSRPTKRRKKAPSPDGGASTAAVDPDETRGTDDDQVVSQVTQH
LKSQPVQAAKDHANAIYEANKDGVKAYAKVAAQDWTFYITKLSVNIGRASELPQTEDDHCDQLQVNIDLGPSKMV
SRDHAAIIFDPKDQKWLLEVKGRNGAKIDGQLLKPHGSRSLTSGQVIEIANVEMMFVLPSEISPLHVHSSFLKRC
GLAPELSSQPTALHKHTPGTSADSGYVRPGTPPSVQRQTGPSTGKSPFAAASTPAVVMGPHGVDLSHDDCQHIKP
QYSYAQMITQAIDNAPDGKLNLNGIYTFITKNYSYYRHQQAAGWQNSIRHNLSLNKAFDKVARSTDEPGKGMKWQ
IVADAKEDMIRNAYKLGRGGHRGSSAPSSPNQLNYVTHGPRDMALREPLSIRKHQGSPLASPPPRPLTQSTPERV
GGRRATLIADGSPLPRQRKAGAAPNSSLSAFSLQSPTLTSSFLQDDGPSLVTPAPPRIHPKLAPPSTAQRPSQHM
PTSSPAPFWKYAEIGSTPLRPTQYEASPSKVAGRIPSNSSSPPCVGKSPPSSPLRPQKSAITHDHVEAAETTEEQ
GFDLTKLAPVQYTLRNIG*
Coding >Ophun1|983
ATGCCCTTGTCGGCCAAACGATCCCAGCGCGTCCGTCGCGACCTGCGTAACAAGGATCGAGCCGTTGACGCCGAC
GCCGAACCTGACCAGTCGTCTCCCAGCCGCCCGACGAAGCGCCGCAAGAAGGCCCCATCTCCTGACGGTGGTGCA
TCGACAGCCGCCGTCGACCCGGACGAGACTCGGGGCACCGATGACGATCAGGTTGTTTCCCAAGTCACGCAGCAT
CTCAAGAGCCAGCCTGTTCAGGCCGCAAAAGACCATGCCAATGCCATTTACGAAGCAAACAAAGATGGCGTCAAA
GCCTATGCCAAGGTGGCCGCTCAGGACTGGACCTTTTACATCACCAAGCTTTCCGTCAACATCGGCCGCGCCTCG
GAGCTACCTCAGACCGAAGACGACCATTGCGACCAGTTACAGGTTAACATCGATCTTGGCCCCAGTAAAATGGTT
TCACGCGATCACGCGGCCATCATCTTCGACCCCAAAGACCAGAAGTGGCTGCTCGAGGTCAAGGGCCGCAATGGC
GCAAAGATTGATGGCCAGTTGCTCAAGCCGCACGGATCACGCTCCCTCACCAGCGGCCAGGTCATCGAGATTGCC
AACGTCGAGATGATGTTTGTCTTGCCGTCCGAAATCAGCCCTCTTCATGTCCACTCTTCGTTCCTCAAGCGATGC
GGTTTGGCCCCTGAACTGTCATCGCAGCCGACCGCGCTCCATAAACATACGCCTGGGACCTCGGCCGACTCCGGC
TACGTGCGCCCGGGAACGCCCCCTTCGGTGCAGCGCCAGACGGGCCCGTCAACAGGGAAATCCCCATTTGCCGCT
GCCAGCACCCCTGCAGTCGTCATGGGCCCTCATGGCGTCGACTTGAGCCACGACGATTGCCAGCACATCAAACCC
CAGTACAGCTACGCCCAGATGATTACTCAAGCCATCGACAACGCGCCCGATGGCAAACTCAATCTCAACGGCATC
TACACCTTCATCACCAAAAACTACTCGTACTATCGCCACCAACAGGCAGCGGGCTGGCAGAACTCCATCCGGCAT
AATTTATCGCTGAACAAGGCGTTTGATAAGGTGGCCAGGTCAACTGACGAGCCCGGAAAGGGCATGAAGTGGCAA
ATTGTGGCCGATGCCAAGGAGGACATGATACGCAATGCATATAAGCTGGGTCGCGGCGGCCACCGAGGCTCTTCG
GCTCCGTCCTCGCCCAATCAACTCAACTACGTCACCCACGGCCCCAGGGACATGGCGCTGAGGGAACCGCTGTCC
ATCCGAAAACACCAAGGCTCGCCCCTCGCGTCACCGCCTCCGCGTCCGTTGACGCAATCGACGCCGGAGCGAGTT
GGCGGCCGAAGGGCTACTTTGATTGCCGACGGGAGCCCGTTGCCTCGACAGCGCAAAGCCGGGGCCGCGCCCAAC
TCGTCACTCTCAGCCTTTAGCCTTCAATCACCCACGTTAACATCGTCATTCCTGCAGGACGACGGACCGTCCCTT
GTGACCCCTGCGCCGCCCAGAATTCACCCTAAGCTGGCGCCGCCCAGCACCGCTCAAAGGCCCAGCCAGCACATG
CCAACCAGCTCGCCCGCCCCATTCTGGAAGTACGCCGAGATCGGCAGCACGCCTTTGAGGCCGACCCAGTACGAA
GCCAGCCCCTCAAAGGTGGCTGGCAGGATACCCTCCAACAGCAGCAGTCCTCCGTGCGTCGGCAAGTCGCCTCCG
AGCAGCCCCTTGCGGCCCCAAAAGTCGGCAATCACCCATGATCACGTCGAGGCAGCAGAGACAACGGAGGAACAA
GGCTTCGATCTGACCAAGTTAGCACCGGTGCAATATACTCTACGGAACATTGGCTGA
Transcript >Ophun1|983
ATGCCCTTGTCGGCCAAACGATCCCAGCGCGTCCGTCGCGACCTGCGTAACAAGGATCGAGCCGTTGACGCCGAC
GCCGAACCTGACCAGTCGTCTCCCAGCCGCCCGACGAAGCGCCGCAAGAAGGCCCCATCTCCTGACGGTGGTGCA
TCGACAGCCGCCGTCGACCCGGACGAGACTCGGGGCACCGATGACGATCAGGTTGTTTCCCAAGTCACGCAGCAT
CTCAAGAGCCAGCCTGTTCAGGCCGCAAAAGACCATGCCAATGCCATTTACGAAGCAAACAAAGATGGCGTCAAA
GCCTATGCCAAGGTGGCCGCTCAGGACTGGACCTTTTACATCACCAAGCTTTCCGTCAACATCGGCCGCGCCTCG
GAGCTACCTCAGACCGAAGACGACCATTGCGACCAGTTACAGGTTAACATCGATCTTGGCCCCAGTAAAATGGTT
TCACGCGATCACGCGGCCATCATCTTCGACCCCAAAGACCAGAAGTGGCTGCTCGAGGTCAAGGGCCGCAATGGC
GCAAAGATTGATGGCCAGTTGCTCAAGCCGCACGGATCACGCTCCCTCACCAGCGGCCAGGTCATCGAGATTGCC
AACGTCGAGATGATGTTTGTCTTGCCGTCCGAAATCAGCCCTCTTCATGTCCACTCTTCGTTCCTCAAGCGATGC
GGTTTGGCCCCTGAACTGTCATCGCAGCCGACCGCGCTCCATAAACATACGCCTGGGACCTCGGCCGACTCCGGC
TACGTGCGCCCGGGAACGCCCCCTTCGGTGCAGCGCCAGACGGGCCCGTCAACAGGGAAATCCCCATTTGCCGCT
GCCAGCACCCCTGCAGTCGTCATGGGCCCTCATGGCGTCGACTTGAGCCACGACGATTGCCAGCACATCAAACCC
CAGTACAGCTACGCCCAGATGATTACTCAAGCCATCGACAACGCGCCCGATGGCAAACTCAATCTCAACGGCATC
TACACCTTCATCACCAAAAACTACTCGTACTATCGCCACCAACAGGCAGCGGGCTGGCAGAACTCCATCCGGCAT
AATTTATCGCTGAACAAGGCGTTTGATAAGGTGGCCAGGTCAACTGACGAGCCCGGAAAGGGCATGAAGTGGCAA
ATTGTGGCCGATGCCAAGGAGGACATGATACGCAATGCATATAAGCTGGGTCGCGGCGGCCACCGAGGCTCTTCG
GCTCCGTCCTCGCCCAATCAACTCAACTACGTCACCCACGGCCCCAGGGACATGGCGCTGAGGGAACCGCTGTCC
ATCCGAAAACACCAAGGCTCGCCCCTCGCGTCACCGCCTCCGCGTCCGTTGACGCAATCGACGCCGGAGCGAGTT
GGCGGCCGAAGGGCTACTTTGATTGCCGACGGGAGCCCGTTGCCTCGACAGCGCAAAGCCGGGGCCGCGCCCAAC
TCGTCACTCTCAGCCTTTAGCCTTCAATCACCCACGTTAACATCGTCATTCCTGCAGGACGACGGACCGTCCCTT
GTGACCCCTGCGCCGCCCAGAATTCACCCTAAGCTGGCGCCGCCCAGCACCGCTCAAAGGCCCAGCCAGCACATG
CCAACCAGCTCGCCCGCCCCATTCTGGAAGTACGCCGAGATCGGCAGCACGCCTTTGAGGCCGACCCAGTACGAA
GCCAGCCCCTCAAAGGTGGCTGGCAGGATACCCTCCAACAGCAGCAGTCCTCCGTGCGTCGGCAAGTCGCCTCCG
AGCAGCCCCTTGCGGCCCCAAAAGTCGGCAATCACCCATGATCACGTCGAGGCAGCAGAGACAACGGAGGAACAA
GGCTTCGATCTGACCAAGTTAGCACCGGTGCAATATACTCTACGGAACATTGGCTGA
Gene >Ophun1|983
ATGCCCTTGTCGGCCAAACGATCCCAGCGCGTCCGTCGCGACCTGCGTAACAAGGATCGAGCCGTTGACGCCGAC
GCCGAACCTGACCAGTCGTCTCCCAGCCGCCCGACGAAGCGCCGCAAGAAGGCCCCATCTCCTGACGGTGGTGCA
TCGACAGCCGCCGTCGACCCGGACGAGACTCGGGGCACCGATGACGATCAGGTTGTTTCCCAAGTCACGCAGCAT
CTCAAGAGCCAGCCTGTTCAGGCCGCAAAAGACCATGCCAATGCCATTTACGAAGCAAACAAAGATGGCGTCAAA
GCCTATGCCAAGGTGGCCGCTCAGGACTGGACCTTTTACATCACCAAGCTTTCCGTCAACATCGGCCGCGCCTCG
GAGCTACCTCAGACCGAAGACGACCATTGCGACCAGTTACAGGTTAACATCGATCTTGGCCCCAGTAAAATGGTT
TCACGCGATCACGCGGCCATCATCTTCGACCCCAAAGACCAGAAGTGGCTGCTCGAGGTCAAGGGCCGCAATGGC
GCAAAGATTGATGGCCAGTTGCTCAAGCCGCACGGATCACGCTCCCTCACCAGCGGCCAGGTCATCGAGATTGCC
AACGTCGAGATGATGTTTGTCTTGCCGTCCGAAATCAGCCCTCTTCATGTCCACTCTTCGTTCCTCAAGCGATGC
GGTTTGGCCCCTGAACTGTCATCGCAGCCGACCGCGCTCCATAAACATACGCCTGGGACCTCGGCCGACTCCGGC
TACGTGCGCCCGGGAACGCCCCCTTCGGTGCAGCGCCAGACGGGCCCGTCAACAGGGAAATCCCCATTTGCCGCT
GCCAGCACCCCTGCAGTCGTCATGGGCCCTCATGGCGTCGACTTGAGCCACGACGATTGCCAGCACATCAAACCC
CAGTACAGCTACGCCCAGATGATTACTCAAGCCATCGACAACGCGCCCGATGGCAAACTCAATCTCAACGGCATC
TACACCTTCATCACCAAAAACTACTCGTACTATCGCCACCAACAGGCAGCGGGCTGGCAGGTGAGTGAGAATGCT
GAACGCTGCTTCACAGCGCATACTGACTTTTCGTCAACAGAACTCCATCCGGCATAATTTATCGCTGAACAAGGC
GTTTGATAAGGTGGCCAGGTCAACTGACGAGCCCGGAAAGGGCATGAAGTGGCAAATTGTGGCCGATGCCAAGGA
GGACATGATACGCAATGCATATAAGCTGGGTCGCGGCGGCCACCGAGGCTCTTCGGCTCCGTCCTCGCCCAATCA
ACTCAACTACGTCACCCACGGCCCCAGGGACATGGCGCTGAGGGAACCGCTGTCCATCCGAAAACACCAAGGCTC
GCCCCTCGCGTCACCGCCTCCGCGTCCGTTGACGCAATCGACGCCGGAGCGAGTTGGCGGCCGAAGGGCTACTTT
GATTGCCGACGGGAGCCCGTTGCCTCGACAGCGCAAAGCCGGGGCCGCGCCCAACTCGTCACTCTCAGCCTTTAG
CCTTCAATCACCCACGTTAACATCGTCATTCCTGCAGGACGACGGACCGTCCCTTGTGACCCCTGCGCCGCCCAG
AATTCACCCTAAGCTGGCGCCGCCCAGCACCGCTCAAAGGCCCAGCCAGCACATGCCAACCAGCTCGCCCGCCCC
ATTCTGGAAGTACGCCGAGATCGGCAGCACGCCTTTGAGGCCGACCCAGTACGAAGCCAGCCCCTCAAAGGTGGC
TGGCAGGATACCCTCCAACAGCAGCAGTCCTCCGTGCGTCGGCAAGTCGCCTCCGAGCAGCCCCTTGCGGCCCCA
AAAGTCGGCAATCACCCATGATCACGTCGAGGCAGCAGAGACAACGGAGGAACAAGGCTTCGATCTGACCAAGTT
AGCACCGGTGCAATATACTCTACGGAACATTGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail