Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|976
Gene name
LocationContig_1359:104..1504
Strand+
Gene length (bp)1400
Transcript length (bp)1344
Coding sequence length (bp)1344
Protein length (aa) 448

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14378 PAP2_3 PAP2 superfamily 2.7E-24 160 338
PF01569 PAP2 PAP2 superfamily 3.6E-08 229 340

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q10142|AUR1_SCHPO Inositol phosphorylceramide synthase catalytic subunit aur1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aur1 PE=1 SV=1 49 364 2.0E-101
sp|O13332|AUR1_CANAL Inositol phosphorylceramide synthase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=AUR1 PE=1 SV=2 47 382 2.0E-94
sp|P36107|AUR1_YEAST Inositol phosphorylceramide synthase catalytic subunit AUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUR1 PE=1 SV=1 40 362 2.0E-86
sp|P38954|IPT1_YEAST Inositolphosphotransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IPT1 PE=1 SV=2 173 293 2.0E-16

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 73 95 22
2 115 137 22
3 144 166 22
4 176 198 22
5 205 224 19
6 271 293 22
7 300 317 17
8 322 339 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|976
MDSPGSPPRKPVLPTLWTDILSDSGRRQHRPRSRSDVKALRYNPPDVASLQRSFSLWDGVRDLQRRRWRPADVQY
LFLAALTLFSLAIAPPAPVLKASALVAASWILLMPATRQFFLPSVTIWVWLVYFFCSRFIPYDYRPHIWVRVLPA
LENVLYGANLSNILSAHQHAVLDILAWMPYGIIHFGAPATCSLLMFIFAAPGTTAVFARTFGWMSILGVTIQLVF
PCTPPWYENEHGLVPATYGMPGSPAGLARIDAIFGIDLYTTNFTAAPLPFGAFPSLHGGYAVLEALFMSHCFPQF
RVFFIGYAGWIWWSTMYLSHHYAIDLVGGGLIAMAFFYSARARWLPRRQPDKLTRWDYDYVEIGTRARVADEEYG
MGPVAAGHYLGLGLLHRRPSSSDGWTIGSSSSYSTLSGTISPTSSDSSSGVFADMDQQASWESDAEVPPPQR*
Coding >Ophun1|976
ATGGACAGCCCGGGCTCGCCCCCGAGGAAGCCGGTCCTCCCGACCCTGTGGACCGACATCCTGTCCGACTCCGGC
CGTCGCCAACACCGTCCCAGGAGTCGCTCCGACGTCAAGGCCCTGCGTTACAACCCTCCCGATGTCGCCTCGCTG
CAGCGTTCCTTTAGCCTGTGGGATGGCGTCCGCGACCTGCAGAGGCGACGCTGGCGGCCCGCCGACGTCCAGTAC
CTCTTCCTCGCCGCCCTCACCCTCTTCTCTCTCGCCATCGCTCCGCCCGCTCCCGTCCTCAAGGCTTCGGCTCTC
GTCGCCGCCTCCTGGATCCTCCTCATGCCCGCCACCCGCCAGTTCTTCCTACCCTCCGTCACCATCTGGGTTTGG
CTCGTCTACTTCTTCTGCAGCCGCTTCATTCCCTACGACTACCGCCCTCACATCTGGGTCCGCGTCCTGCCTGCC
TTGGAAAACGTCCTCTATGGCGCCAACCTATCAAACATTCTCTCCGCCCACCAGCATGCCGTCCTCGACATCCTC
GCCTGGATGCCCTACGGCATCATCCATTTCGGTGCCCCGGCCACGTGCTCGCTGCTTATGTTTATTTTCGCCGCT
CCCGGCACCACGGCCGTCTTCGCCCGCACCTTTGGCTGGATGAGCATCCTCGGCGTCACCATCCAGCTCGTCTTC
CCCTGCACTCCGCCCTGGTACGAGAACGAGCACGGTCTGGTGCCCGCCACCTACGGCATGCCCGGTTCGCCCGCC
GGCCTGGCCCGCATCGACGCCATCTTCGGCATCGATCTCTACACCACAAACTTCACCGCTGCGCCTCTGCCCTTT
GGCGCCTTTCCCTCGCTGCATGGGGGCTACGCCGTGCTCGAGGCTCTCTTCATGAGCCACTGCTTCCCGCAGTTC
CGCGTCTTCTTCATCGGCTACGCCGGCTGGATCTGGTGGTCTACCATGTACCTGAGCCATCACTACGCCATCGAC
CTCGTCGGCGGCGGCCTCATCGCCATGGCCTTCTTCTACTCAGCCCGCGCCCGCTGGCTGCCGCGCCGCCAACCC
GACAAGCTGACACGCTGGGACTACGACTACGTCGAGATCGGCACCCGTGCTCGCGTCGCCGACGAAGAGTACGGC
ATGGGCCCCGTTGCCGCCGGTCACTACCTTGGCCTCGGTCTGCTTCACCGTCGCCCCAGCTCGAGCGACGGCTGG
ACCATAGGAAGCAGTTCCAGCTACAGCACATTAAGCGGCACCATCAGCCCGACCTCGTCCGACTCGTCCTCGGGC
GTCTTCGCAGACATGGACCAACAAGCATCCTGGGAAAGCGACGCCGAAGTCCCGCCTCCCCAGCGGTGA
Transcript >Ophun1|976
ATGGACAGCCCGGGCTCGCCCCCGAGGAAGCCGGTCCTCCCGACCCTGTGGACCGACATCCTGTCCGACTCCGGC
CGTCGCCAACACCGTCCCAGGAGTCGCTCCGACGTCAAGGCCCTGCGTTACAACCCTCCCGATGTCGCCTCGCTG
CAGCGTTCCTTTAGCCTGTGGGATGGCGTCCGCGACCTGCAGAGGCGACGCTGGCGGCCCGCCGACGTCCAGTAC
CTCTTCCTCGCCGCCCTCACCCTCTTCTCTCTCGCCATCGCTCCGCCCGCTCCCGTCCTCAAGGCTTCGGCTCTC
GTCGCCGCCTCCTGGATCCTCCTCATGCCCGCCACCCGCCAGTTCTTCCTACCCTCCGTCACCATCTGGGTTTGG
CTCGTCTACTTCTTCTGCAGCCGCTTCATTCCCTACGACTACCGCCCTCACATCTGGGTCCGCGTCCTGCCTGCC
TTGGAAAACGTCCTCTATGGCGCCAACCTATCAAACATTCTCTCCGCCCACCAGCATGCCGTCCTCGACATCCTC
GCCTGGATGCCCTACGGCATCATCCATTTCGGTGCCCCGGCCACGTGCTCGCTGCTTATGTTTATTTTCGCCGCT
CCCGGCACCACGGCCGTCTTCGCCCGCACCTTTGGCTGGATGAGCATCCTCGGCGTCACCATCCAGCTCGTCTTC
CCCTGCACTCCGCCCTGGTACGAGAACGAGCACGGTCTGGTGCCCGCCACCTACGGCATGCCCGGTTCGCCCGCC
GGCCTGGCCCGCATCGACGCCATCTTCGGCATCGATCTCTACACCACAAACTTCACCGCTGCGCCTCTGCCCTTT
GGCGCCTTTCCCTCGCTGCATGGGGGCTACGCCGTGCTCGAGGCTCTCTTCATGAGCCACTGCTTCCCGCAGTTC
CGCGTCTTCTTCATCGGCTACGCCGGCTGGATCTGGTGGTCTACCATGTACCTGAGCCATCACTACGCCATCGAC
CTCGTCGGCGGCGGCCTCATCGCCATGGCCTTCTTCTACTCAGCCCGCGCCCGCTGGCTGCCGCGCCGCCAACCC
GACAAGCTGACACGCTGGGACTACGACTACGTCGAGATCGGCACCCGTGCTCGCGTCGCCGACGAAGAGTACGGC
ATGGGCCCCGTTGCCGCCGGTCACTACCTTGGCCTCGGTCTGCTTCACCGTCGCCCCAGCTCGAGCGACGGCTGG
ACCATAGGAAGCAGTTCCAGCTACAGCACATTAAGCGGCACCATCAGCCCGACCTCGTCCGACTCGTCCTCGGGC
GTCTTCGCAGACATGGACCAACAAGCATCCTGGGAAAGCGACGCCGAAGTCCCGCCTCCCCAGCGGTGA
Gene >Ophun1|976
ATGGACAGCCCGGGCTCGCCCCCGAGGAAGCCGGTCCTCCCGACCCTGTGGACCGACATCCTGTCCGACTCCGGC
CGTCGCCAACACCGTCCCAGGAGTCGCTCCGACGTCAAGGCCCTGCGTTACAACCCTCCCGATGTCGCCTCGCTG
CAGCGTTCCTTTAGCCTGTGGGATGGCGTCCGCGACCTGCAGAGGCGACGCTGGCGGCCCGCCGACGTCCAGTAC
CTCTTCCTCGCCGCCCTCACCCTCTTCTCTCTCGCCATCGCTCCGCCCGCTCCCGTCCTCAAGGCTTCGGCTCTC
GTCGCCGCCTCCTGGATCCTCCTCATGCCCGCCACCCGCCAGTTCTTCCTACCCTCCGTCACCATCTGGGTTTGG
CTCGTCTACTTCTTCTGCAGCCGGTGAGTCTAAACTCTGTCCGTATCATCGTTGCATCCATTCGCTGACCAGACC
ACAGCTTCATTCCCTACGACTACCGCCCTCACATCTGGGTCCGCGTCCTGCCTGCCTTGGAAAACGTCCTCTATG
GCGCCAACCTATCAAACATTCTCTCCGCCCACCAGCATGCCGTCCTCGACATCCTCGCCTGGATGCCCTACGGCA
TCATCCATTTCGGTGCCCCGGCCACGTGCTCGCTGCTTATGTTTATTTTCGCCGCTCCCGGCACCACGGCCGTCT
TCGCCCGCACCTTTGGCTGGATGAGCATCCTCGGCGTCACCATCCAGCTCGTCTTCCCCTGCACTCCGCCCTGGT
ACGAGAACGAGCACGGTCTGGTGCCCGCCACCTACGGCATGCCCGGTTCGCCCGCCGGCCTGGCCCGCATCGACG
CCATCTTCGGCATCGATCTCTACACCACAAACTTCACCGCTGCGCCTCTGCCCTTTGGCGCCTTTCCCTCGCTGC
ATGGGGGCTACGCCGTGCTCGAGGCTCTCTTCATGAGCCACTGCTTCCCGCAGTTCCGCGTCTTCTTCATCGGCT
ACGCCGGCTGGATCTGGTGGTCTACCATGTACCTGAGCCATCACTACGCCATCGACCTCGTCGGCGGCGGCCTCA
TCGCCATGGCCTTCTTCTACTCAGCCCGCGCCCGCTGGCTGCCGCGCCGCCAACCCGACAAGCTGACACGCTGGG
ACTACGACTACGTCGAGATCGGCACCCGTGCTCGCGTCGCCGACGAAGAGTACGGCATGGGCCCCGTTGCCGCCG
GTCACTACCTTGGCCTCGGTCTGCTTCACCGTCGCCCCAGCTCGAGCGACGGCTGGACCATAGGAAGCAGTTCCA
GCTACAGCACATTAAGCGGCACCATCAGCCCGACCTCGTCCGACTCGTCCTCGGGCGTCTTCGCAGACATGGACC
AACAAGCATCCTGGGAAAGCGACGCCGAAGTCCCGCCTCCCCAGCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail