Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|972
Gene name
LocationContig_135:24578..27141
Strand+
Gene length (bp)2563
Transcript length (bp)2505
Coding sequence length (bp)2505
Protein length (aa) 835

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13855 LRR_8 Leucine rich repeat 1.2E-09 458 516

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUG2|YFT6_SCHPO Uncharacterized leucine-rich repeat-containing protein C926.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC926.06c PE=1 SV=1 4 322 2.0E-47
sp|Q9UUG2|YFT6_SCHPO Uncharacterized leucine-rich repeat-containing protein C926.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC926.06c PE=1 SV=1 468 794 2.0E-31
sp|Q8NEP3|DAAF1_HUMAN Dynein assembly factor 1, axonemal OS=Homo sapiens GN=DNAAF1 PE=1 SV=5 454 598 8.0E-12
sp|Q9D2H9|DAAF1_MOUSE Dynein assembly factor 1, axonemal OS=Mus musculus GN=Dnaaf1 PE=1 SV=1 454 598 3.0E-11
sp|Q5F479|S11IP_CHICK Serine/threonine-protein kinase 11-interacting protein OS=Gallus gallus GN=STK11IP PE=2 SV=1 455 632 3.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUG2|YFT6_SCHPO Uncharacterized leucine-rich repeat-containing protein C926.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC926.06c PE=1 SV=1 4 322 2.0E-47
sp|Q9UUG2|YFT6_SCHPO Uncharacterized leucine-rich repeat-containing protein C926.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC926.06c PE=1 SV=1 468 794 2.0E-31
sp|Q8NEP3|DAAF1_HUMAN Dynein assembly factor 1, axonemal OS=Homo sapiens GN=DNAAF1 PE=1 SV=5 454 598 8.0E-12
sp|Q9D2H9|DAAF1_MOUSE Dynein assembly factor 1, axonemal OS=Mus musculus GN=Dnaaf1 PE=1 SV=1 454 598 3.0E-11
sp|Q5F479|S11IP_CHICK Serine/threonine-protein kinase 11-interacting protein OS=Gallus gallus GN=STK11IP PE=2 SV=1 455 632 3.0E-11
sp|Q9Y2I1|NISCH_HUMAN Nischarin OS=Homo sapiens GN=NISCH PE=1 SV=3 427 602 4.0E-11
sp|Q6AYH9|DAAF1_RAT Dynein assembly factor 1, axonemal OS=Rattus norvegicus GN=Dnaaf1 PE=1 SV=1 454 598 5.0E-11
sp|Q80TM9|NISCH_MOUSE Nischarin OS=Mus musculus GN=Nisch PE=1 SV=2 427 602 1.0E-10
sp|B6D5P6|DAAF1_PERCA Dynein assembly factor 1, axonemal OS=Peromyscus californicus GN=Dnaaf1 PE=2 SV=1 454 598 1.0E-10
sp|B6D5P3|DAAF1_PERLE Dynein assembly factor 1, axonemal OS=Peromyscus leucopus GN=Dnaaf1 PE=2 SV=1 454 598 1.0E-10
sp|B6D5P1|DAAF1_PERPL Dynein assembly factor 1, axonemal OS=Peromyscus polionotus GN=Dnaaf1 PE=2 SV=1 454 598 1.0E-10
sp|Q8CDN9|LRRC9_MOUSE Leucine-rich repeat-containing protein 9 OS=Mus musculus GN=Lrrc9 PE=1 SV=2 458 601 1.0E-10
sp|Q4G017|NISCH_RAT Nischarin OS=Rattus norvegicus GN=Nisch PE=2 SV=2 427 602 3.0E-10
sp|Q3SYS4|DAAF1_BOVIN Dynein assembly factor 1, axonemal OS=Bos taurus GN=DNAAF1 PE=2 SV=2 458 595 5.0E-10
sp|Q6P4K6|S11IP_XENTR Serine/threonine-protein kinase 11-interacting protein OS=Xenopus tropicalis GN=stk11ip PE=2 SV=1 455 595 2.0E-09
sp|Q6IRN0|S11IP_XENLA Serine/threonine-protein kinase 11-interacting protein OS=Xenopus laevis GN=stk11ip PE=2 SV=1 455 595 2.0E-09
sp|Q6ZRR7|LRRC9_HUMAN Leucine-rich repeat-containing protein 9 OS=Homo sapiens GN=LRRC9 PE=2 SV=2 458 601 2.0E-09
sp|Q80TH2|LAP2_MOUSE Protein LAP2 OS=Mus musculus GN=Erbb2ip PE=1 SV=3 458 588 5.0E-09
sp|Q9V780|LAP1_DROME Protein lap1 OS=Drosophila melanogaster GN=Lap1 PE=2 SV=1 456 593 9.0E-09
sp|Q8N1F8|S11IP_HUMAN Serine/threonine-protein kinase 11-interacting protein OS=Homo sapiens GN=STK11IP PE=1 SV=3 455 587 2.0E-08
sp|Q09JZ4|DAAF1_CHLRE Leucine-rich repeat-containing protein ODA7 OS=Chlamydomonas reinhardtii GN=ODA7 PE=1 SV=1 458 629 5.0E-08
sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 458 587 9.0E-08
sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 458 587 1.0E-07
sp|F1MCA7|LRRC7_BOVIN Leucine-rich repeat-containing protein 7 OS=Bos taurus GN=LRRC7 PE=3 SV=3 458 587 1.0E-07
sp|A0JM56|LRRC9_XENTR Leucine-rich repeat-containing protein 9 OS=Xenopus tropicalis GN=lrrc9 PE=2 SV=2 426 611 1.0E-07
sp|B4GT53|DAAF1_DROPE Dynein assembly factor 1, axonemal homolog OS=Drosophila persimilis GN=dtr PE=3 SV=1 454 599 4.0E-07
sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 458 587 4.0E-07
sp|Q29KL8|DAAF1_DROPS Dynein assembly factor 1, axonemal homolog OS=Drosophila pseudoobscura pseudoobscura GN=dtr PE=3 SV=2 454 599 4.0E-07
sp|Q9HB75|PIDD1_HUMAN p53-induced death domain-containing protein 1 OS=Homo sapiens GN=PIDD1 PE=1 SV=2 446 588 7.0E-07
sp|Q16RY9|DAAF1_AEDAE Dynein assembly factor 1, axonemal homolog OS=Aedes aegypti GN=AAEL010772 PE=3 SV=1 458 599 8.0E-07
sp|A0JM56|LRRC9_XENTR Leucine-rich repeat-containing protein 9 OS=Xenopus tropicalis GN=lrrc9 PE=2 SV=2 458 589 2.0E-06
sp|Q9LRV8|PIRL2_ARATH Plant intracellular Ras-group-related LRR protein 2 OS=Arabidopsis thaliana GN=PIRL2 PE=2 SV=1 447 574 3.0E-06
sp|Q505F5|LRC47_MOUSE Leucine-rich repeat-containing protein 47 OS=Mus musculus GN=Lrrc47 PE=1 SV=1 447 585 4.0E-06
sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 454 587 5.0E-06
sp|Q96CX6|LRC58_HUMAN Leucine-rich repeat-containing protein 58 OS=Homo sapiens GN=LRRC58 PE=1 SV=2 418 588 7.0E-06
sp|Q9XHH2|DNAL1_CHLRE Dynein light chain 1, axonemal OS=Chlamydomonas reinhardtii GN=LC1 PE=1 SV=1 474 597 8.0E-06
sp|Q3TAA7|S11IP_MOUSE Serine/threonine-protein kinase 11-interacting protein OS=Mus musculus GN=Stk11ip PE=1 SV=1 529 587 9.0E-06
sp|O02833|ALS_PAPHA Insulin-like growth factor-binding protein complex acid labile subunit OS=Papio hamadryas GN=IGFALS PE=2 SV=1 458 586 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2487
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6227
Ophiocordyceps australis map64 (Brazil) OphauB2|4091
Ophiocordyceps camponoti-floridani Ophcf2|04489
Ophiocordyceps camponoti-rufipedis Ophun1|972 (this protein)
Ophiocordyceps kimflemingae Ophio5|1598
Ophiocordyceps subramaniannii Hirsu2|3595

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|972
MSEDGEYFIKRLVAFVRTHEKSIANALQFQRREVRHRASQSTGSASLSLSPSLPERPSTSSVSNSLAAALSFGSI
NFTSHNAKSVRLALTPHHLFYLLSRFEELNIQVGPMKVRLEDLHDSSSTIYVSFLGNTGRSRSRSSDVGSIHSVT
SMRSVMSGMTALWTSFGIGASISAARTERHKAALHADLKYLYSAFTKIPCLRLAPDWRARLIKGYEEFPFDSAVP
LYVFKNLQALEIRSLDFRQFFGWDRLADQLRSLSLRRAGIEDPADILIDIVLDDMDKRRRRSSKSQASPTATLAA
NGSPRRSPTIPHLGLVRAASAPGSPDARSALADLRVGSMTASDPAVEDTDASDAGRTPVARDEAEAARHHRNHRD
HHHHHHQHYRSPTRRSRPRSNSPTRPTSSRNHSHNVRSSQRIRRSGSGSSHSSMSDSWHHHSRGSTGNLLAMGVL
PSTKWRFLRHLSLADNALTSIPQASLAPLCNTLRSLDLSSNLFSQMPDSLASLTALRALNLSHCMIDSLHSLTRS
PLPAMTALNLRANRLRSLAGVEKLYSLERLDLRDNQLTDPRELARLTGMPDLREIWVEGNPLARTHKNYRVTIFN
LFRSTPGYTVDVIVDGRGPGYSERRHLVERAPIPESVPVVKPKAPDAPVVVEVGKAVPTEVGAGSTRRRNKTSSK
RRIVDLASGDVSLPPLAVDTDVADRVQEATKVQVSEVSPSDGYRTSRPTESVLLPPVKLSPSGETGYGGGRRADD
VSSELSVDADPQDWDVSGEIYRRRIQNLRDRVGSGYLSVLSEESWDGTGSFNGAGSTSVPPLRAGHLSSNTLSAQ
AVHSGRTMG*
Coding >Ophun1|972
ATGAGTGAAGACGGAGAGTACTTCATCAAGCGCCTGGTGGCCTTTGTTCGCACCCACGAAAAGTCCATCGCCAAT
GCGCTCCAGTTCCAGCGCCGCGAGGTTCGTCATAGGGCCTCGCAGAGCACCGGCTCCGCCTCGCTGTCCCTCTCC
CCGTCGCTGCCCGAGCGGCCCTCGACGTCTTCCGTCTCGAATTCGCTCGCCGCCGCCTTGTCCTTTGGCTCCATC
AACTTTACCTCTCACAATGCAAAGTCGGTGAGGCTCGCCTTGACCCCTCACCACCTCTTCTACCTCCTCTCCCGC
TTCGAGGAGCTCAACATCCAGGTTGGGCCCATGAAGGTCCGCCTCGAGGACCTCCACGATAGCTCCTCCACCATA
TACGTCTCCTTTCTCGGAAACACCGGACGCTCCCGCTCTCGCAGTTCCGATGTCGGCTCCATCCACTCCGTCACC
AGCATGCGGAGCGTCATGTCGGGCATGACGGCTCTCTGGACCAGCTTCGGCATCGGAGCCAGCATCTCCGCCGCC
AGGACCGAGCGCCACAAGGCCGCCCTCCACGCCGATCTCAAATACCTCTACTCGGCCTTTACCAAGATCCCCTGC
CTCCGGTTGGCCCCGGACTGGCGGGCCCGCCTGATTAAAGGCTACGAAGAGTTCCCCTTTGACTCGGCCGTGCCG
CTCTACGTCTTCAAGAACCTGCAGGCCCTCGAGATCAGGAGCCTCGATTTTCGCCAGTTCTTTGGCTGGGATCGC
CTGGCCGATCAGCTCCGCTCCCTCAGCTTGAGACGCGCCGGCATCGAGGACCCGGCCGATATCCTGATAGACATC
GTCCTCGACGACATGGACAAACGACGCCGGAGATCGTCCAAGTCTCAGGCCTCTCCCACGGCGACGCTCGCGGCC
AACGGCAGCCCGCGTCGGAGCCCCACGATACCCCATCTCGGGCTCGTCCGCGCCGCCTCGGCCCCCGGATCCCCC
GACGCCCGCAGCGCCCTCGCCGATCTCCGCGTCGGCTCCATGACGGCCAGCGACCCGGCTGTCGAGGATACGGAC
GCGTCCGACGCCGGCAGGACTCCGGTCGCCCGCGACGAGGCTGAAGCCGCTCGCCATCACCGTAACCACCGCGAT
CACCATCATCACCACCACCAACACTACCGCTCTCCCACCAGGCGAAGCCGTCCCCGAAGTAACTCGCCGACGCGA
CCAACCAGCTCGCGGAACCACTCGCACAACGTCCGCTCGTCGCAGCGCATCAGGCGCTCGGGCTCAGGGAGCTCC
CACTCCAGCATGTCCGACTCGTGGCATCACCACTCCAGGGGCAGCACGGGGAATCTCTTGGCCATGGGCGTCTTG
CCCTCGACCAAGTGGCGCTTCCTGCGTCACCTGAGCCTCGCCGACAACGCCCTGACGTCGATTCCGCAGGCCAGC
CTCGCCCCCCTCTGCAACACGCTGCGCTCTCTCGACCTGTCGTCGAACCTGTTCAGCCAGATGCCCGACAGCCTC
GCGTCGCTGACTGCTCTCCGCGCCCTCAACCTCTCTCACTGCATGATCGACTCCCTCCACTCCCTGACGCGCAGC
CCGCTGCCGGCCATGACGGCTCTCAACCTGCGCGCCAACAGGCTCCGGTCGCTGGCGGGCGTCGAGAAGCTCTAC
TCGCTCGAGAGGCTGGACCTGCGCGACAACCAGCTGACGGATCCCCGCGAGTTGGCCCGGCTGACGGGTATGCCC
GACCTGCGCGAGATCTGGGTCGAGGGCAACCCCCTGGCCCGCACCCACAAGAACTACCGCGTCACCATATTCAAC
CTGTTCCGGTCGACGCCGGGCTATACCGTCGACGTCATCGTCGACGGCCGCGGGCCCGGCTACTCCGAACGGCGG
CACCTGGTGGAGCGGGCGCCGATCCCGGAATCGGTCCCGGTGGTCAAGCCCAAGGCCCCGGATGCCCCCGTCGTC
GTCGAAGTCGGCAAGGCGGTACCGACCGAGGTCGGCGCCGGCTCTACCCGACGTCGCAATAAGACGTCGAGCAAG
AGACGCATCGTCGACCTGGCCAGCGGCGACGTCTCGCTCCCTCCGCTGGCCGTCGACACCGACGTCGCCGACAGG
GTCCAGGAAGCGACCAAGGTGCAGGTCTCGGAAGTCTCTCCGTCGGACGGCTACCGCACCTCTCGCCCCACGGAG
TCGGTGCTGCTGCCCCCGGTGAAGCTGTCGCCGAGCGGGGAGACGGGCTACGGAGGCGGGCGGCGGGCGGACGAC
GTGAGCTCCGAGCTGTCGGTCGACGCGGACCCGCAAGATTGGGACGTCAGCGGGGAGATTTACCGGCGCCGGATC
CAGAACCTGCGCGATCGCGTCGGCAGCGGATACCTCAGCGTCCTGAGCGAGGAGAGCTGGGACGGGACTGGCAGC
TTTAACGGGGCTGGGTCTACGTCTGTGCCGCCGCTTCGGGCTGGGCATTTGTCGAGCAACACGCTGTCTGCTCAG
GCGGTTCACAGCGGGCGTACCATGGGCTAG
Transcript >Ophun1|972
ATGAGTGAAGACGGAGAGTACTTCATCAAGCGCCTGGTGGCCTTTGTTCGCACCCACGAAAAGTCCATCGCCAAT
GCGCTCCAGTTCCAGCGCCGCGAGGTTCGTCATAGGGCCTCGCAGAGCACCGGCTCCGCCTCGCTGTCCCTCTCC
CCGTCGCTGCCCGAGCGGCCCTCGACGTCTTCCGTCTCGAATTCGCTCGCCGCCGCCTTGTCCTTTGGCTCCATC
AACTTTACCTCTCACAATGCAAAGTCGGTGAGGCTCGCCTTGACCCCTCACCACCTCTTCTACCTCCTCTCCCGC
TTCGAGGAGCTCAACATCCAGGTTGGGCCCATGAAGGTCCGCCTCGAGGACCTCCACGATAGCTCCTCCACCATA
TACGTCTCCTTTCTCGGAAACACCGGACGCTCCCGCTCTCGCAGTTCCGATGTCGGCTCCATCCACTCCGTCACC
AGCATGCGGAGCGTCATGTCGGGCATGACGGCTCTCTGGACCAGCTTCGGCATCGGAGCCAGCATCTCCGCCGCC
AGGACCGAGCGCCACAAGGCCGCCCTCCACGCCGATCTCAAATACCTCTACTCGGCCTTTACCAAGATCCCCTGC
CTCCGGTTGGCCCCGGACTGGCGGGCCCGCCTGATTAAAGGCTACGAAGAGTTCCCCTTTGACTCGGCCGTGCCG
CTCTACGTCTTCAAGAACCTGCAGGCCCTCGAGATCAGGAGCCTCGATTTTCGCCAGTTCTTTGGCTGGGATCGC
CTGGCCGATCAGCTCCGCTCCCTCAGCTTGAGACGCGCCGGCATCGAGGACCCGGCCGATATCCTGATAGACATC
GTCCTCGACGACATGGACAAACGACGCCGGAGATCGTCCAAGTCTCAGGCCTCTCCCACGGCGACGCTCGCGGCC
AACGGCAGCCCGCGTCGGAGCCCCACGATACCCCATCTCGGGCTCGTCCGCGCCGCCTCGGCCCCCGGATCCCCC
GACGCCCGCAGCGCCCTCGCCGATCTCCGCGTCGGCTCCATGACGGCCAGCGACCCGGCTGTCGAGGATACGGAC
GCGTCCGACGCCGGCAGGACTCCGGTCGCCCGCGACGAGGCTGAAGCCGCTCGCCATCACCGTAACCACCGCGAT
CACCATCATCACCACCACCAACACTACCGCTCTCCCACCAGGCGAAGCCGTCCCCGAAGTAACTCGCCGACGCGA
CCAACCAGCTCGCGGAACCACTCGCACAACGTCCGCTCGTCGCAGCGCATCAGGCGCTCGGGCTCAGGGAGCTCC
CACTCCAGCATGTCCGACTCGTGGCATCACCACTCCAGGGGCAGCACGGGGAATCTCTTGGCCATGGGCGTCTTG
CCCTCGACCAAGTGGCGCTTCCTGCGTCACCTGAGCCTCGCCGACAACGCCCTGACGTCGATTCCGCAGGCCAGC
CTCGCCCCCCTCTGCAACACGCTGCGCTCTCTCGACCTGTCGTCGAACCTGTTCAGCCAGATGCCCGACAGCCTC
GCGTCGCTGACTGCTCTCCGCGCCCTCAACCTCTCTCACTGCATGATCGACTCCCTCCACTCCCTGACGCGCAGC
CCGCTGCCGGCCATGACGGCTCTCAACCTGCGCGCCAACAGGCTCCGGTCGCTGGCGGGCGTCGAGAAGCTCTAC
TCGCTCGAGAGGCTGGACCTGCGCGACAACCAGCTGACGGATCCCCGCGAGTTGGCCCGGCTGACGGGTATGCCC
GACCTGCGCGAGATCTGGGTCGAGGGCAACCCCCTGGCCCGCACCCACAAGAACTACCGCGTCACCATATTCAAC
CTGTTCCGGTCGACGCCGGGCTATACCGTCGACGTCATCGTCGACGGCCGCGGGCCCGGCTACTCCGAACGGCGG
CACCTGGTGGAGCGGGCGCCGATCCCGGAATCGGTCCCGGTGGTCAAGCCCAAGGCCCCGGATGCCCCCGTCGTC
GTCGAAGTCGGCAAGGCGGTACCGACCGAGGTCGGCGCCGGCTCTACCCGACGTCGCAATAAGACGTCGAGCAAG
AGACGCATCGTCGACCTGGCCAGCGGCGACGTCTCGCTCCCTCCGCTGGCCGTCGACACCGACGTCGCCGACAGG
GTCCAGGAAGCGACCAAGGTGCAGGTCTCGGAAGTCTCTCCGTCGGACGGCTACCGCACCTCTCGCCCCACGGAG
TCGGTGCTGCTGCCCCCGGTGAAGCTGTCGCCGAGCGGGGAGACGGGCTACGGAGGCGGGCGGCGGGCGGACGAC
GTGAGCTCCGAGCTGTCGGTCGACGCGGACCCGCAAGATTGGGACGTCAGCGGGGAGATTTACCGGCGCCGGATC
CAGAACCTGCGCGATCGCGTCGGCAGCGGATACCTCAGCGTCCTGAGCGAGGAGAGCTGGGACGGGACTGGCAGC
TTTAACGGGGCTGGGTCTACGTCTGTGCCGCCGCTTCGGGCTGGGCATTTGTCGAGCAACACGCTGTCTGCTCAG
GCGGTTCACAGCGGGCGTACCATGGGCTAG
Gene >Ophun1|972
ATGAGTGAAGACGGAGAGTACTTCATCAAGGTGCCCACGACACGTCTTCCCTTGGCCACGACGCCTTGACGCTGA
CTTGAGATGAAAGCGCCTGGTGGCCTTTGTTCGCACCCACGAAAAGTCCATCGCCAATGCGCTCCAGTTCCAGCG
CCGCGAGGTTCGTCATAGGGCCTCGCAGAGCACCGGCTCCGCCTCGCTGTCCCTCTCCCCGTCGCTGCCCGAGCG
GCCCTCGACGTCTTCCGTCTCGAATTCGCTCGCCGCCGCCTTGTCCTTTGGCTCCATCAACTTTACCTCTCACAA
TGCAAAGTCGGTGAGGCTCGCCTTGACCCCTCACCACCTCTTCTACCTCCTCTCCCGCTTCGAGGAGCTCAACAT
CCAGGTTGGGCCCATGAAGGTCCGCCTCGAGGACCTCCACGATAGCTCCTCCACCATATACGTCTCCTTTCTCGG
AAACACCGGACGCTCCCGCTCTCGCAGTTCCGATGTCGGCTCCATCCACTCCGTCACCAGCATGCGGAGCGTCAT
GTCGGGCATGACGGCTCTCTGGACCAGCTTCGGCATCGGAGCCAGCATCTCCGCCGCCAGGACCGAGCGCCACAA
GGCCGCCCTCCACGCCGATCTCAAATACCTCTACTCGGCCTTTACCAAGATCCCCTGCCTCCGGTTGGCCCCGGA
CTGGCGGGCCCGCCTGATTAAAGGCTACGAAGAGTTCCCCTTTGACTCGGCCGTGCCGCTCTACGTCTTCAAGAA
CCTGCAGGCCCTCGAGATCAGGAGCCTCGATTTTCGCCAGTTCTTTGGCTGGGATCGCCTGGCCGATCAGCTCCG
CTCCCTCAGCTTGAGACGCGCCGGCATCGAGGACCCGGCCGATATCCTGATAGACATCGTCCTCGACGACATGGA
CAAACGACGCCGGAGATCGTCCAAGTCTCAGGCCTCTCCCACGGCGACGCTCGCGGCCAACGGCAGCCCGCGTCG
GAGCCCCACGATACCCCATCTCGGGCTCGTCCGCGCCGCCTCGGCCCCCGGATCCCCCGACGCCCGCAGCGCCCT
CGCCGATCTCCGCGTCGGCTCCATGACGGCCAGCGACCCGGCTGTCGAGGATACGGACGCGTCCGACGCCGGCAG
GACTCCGGTCGCCCGCGACGAGGCTGAAGCCGCTCGCCATCACCGTAACCACCGCGATCACCATCATCACCACCA
CCAACACTACCGCTCTCCCACCAGGCGAAGCCGTCCCCGAAGTAACTCGCCGACGCGACCAACCAGCTCGCGGAA
CCACTCGCACAACGTCCGCTCGTCGCAGCGCATCAGGCGCTCGGGCTCAGGGAGCTCCCACTCCAGCATGTCCGA
CTCGTGGCATCACCACTCCAGGGGCAGCACGGGGAATCTCTTGGCCATGGGCGTCTTGCCCTCGACCAAGTGGCG
CTTCCTGCGTCACCTGAGCCTCGCCGACAACGCCCTGACGTCGATTCCGCAGGCCAGCCTCGCCCCCCTCTGCAA
CACGCTGCGCTCTCTCGACCTGTCGTCGAACCTGTTCAGCCAGATGCCCGACAGCCTCGCGTCGCTGACTGCTCT
CCGCGCCCTCAACCTCTCTCACTGCATGATCGACTCCCTCCACTCCCTGACGCGCAGCCCGCTGCCGGCCATGAC
GGCTCTCAACCTGCGCGCCAACAGGCTCCGGTCGCTGGCGGGCGTCGAGAAGCTCTACTCGCTCGAGAGGCTGGA
CCTGCGCGACAACCAGCTGACGGATCCCCGCGAGTTGGCCCGGCTGACGGGTATGCCCGACCTGCGCGAGATCTG
GGTCGAGGGCAACCCCCTGGCCCGCACCCACAAGAACTACCGCGTCACCATATTCAACCTGTTCCGGTCGACGCC
GGGCTATACCGTCGACGTCATCGTCGACGGCCGCGGGCCCGGCTACTCCGAACGGCGGCACCTGGTGGAGCGGGC
GCCGATCCCGGAATCGGTCCCGGTGGTCAAGCCCAAGGCCCCGGATGCCCCCGTCGTCGTCGAAGTCGGCAAGGC
GGTACCGACCGAGGTCGGCGCCGGCTCTACCCGACGTCGCAATAAGACGTCGAGCAAGAGACGCATCGTCGACCT
GGCCAGCGGCGACGTCTCGCTCCCTCCGCTGGCCGTCGACACCGACGTCGCCGACAGGGTCCAGGAAGCGACCAA
GGTGCAGGTCTCGGAAGTCTCTCCGTCGGACGGCTACCGCACCTCTCGCCCCACGGAGTCGGTGCTGCTGCCCCC
GGTGAAGCTGTCGCCGAGCGGGGAGACGGGCTACGGAGGCGGGCGGCGGGCGGACGACGTGAGCTCCGAGCTGTC
GGTCGACGCGGACCCGCAAGATTGGGACGTCAGCGGGGAGATTTACCGGCGCCGGATCCAGAACCTGCGCGATCG
CGTCGGCAGCGGATACCTCAGCGTCCTGAGCGAGGAGAGCTGGGACGGGACTGGCAGCTTTAACGGGGCTGGGTC
TACGTCTGTGCCGCCGCTTCGGGCTGGGCATTTGTCGAGCAACACGCTGTCTGCTCAGGCGGTTCACAGCGGGCG
TACCATGGGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail