Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|969
Gene name
LocationContig_135:7501..10245
Strand+
Gene length (bp)2744
Transcript length (bp)2400
Coding sequence length (bp)2400
Protein length (aa) 800

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 4.0E-175 98 757

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 1 799 0.0E+00
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 35 799 0.0E+00
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 78 770 3.0E-165
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 26 799 3.0E-162
sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 OS=Arabidopsis thaliana GN=OPT1 PE=2 SV=1 68 768 4.0E-162
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 1 799 0.0E+00
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 35 799 0.0E+00
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 78 770 3.0E-165
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 26 799 3.0E-162
sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 OS=Arabidopsis thaliana GN=OPT1 PE=2 SV=1 68 768 4.0E-162
sp|O04514|OPT2_ARATH Oligopeptide transporter 2 OS=Arabidopsis thaliana GN=OPT2 PE=2 SV=2 62 768 7.0E-155
sp|O23482|OPT3_ARATH Oligopeptide transporter 3 OS=Arabidopsis thaliana GN=OPT3 PE=2 SV=3 65 772 4.0E-152
sp|O82485|OPT7_ARATH Oligopeptide transporter 7 OS=Arabidopsis thaliana GN=OPT7 PE=2 SV=1 56 770 7.0E-151
sp|Q9FJD1|OPT8_ARATH Oligopeptide transporter 8 OS=Arabidopsis thaliana GN=OPT8 PE=2 SV=1 69 771 1.0E-150
sp|Q9FME8|OPT4_ARATH Oligopeptide transporter 4 OS=Arabidopsis thaliana GN=OPT4 PE=1 SV=1 71 768 2.0E-150
sp|Q9T095|OPT6_ARATH Oligopeptide transporter 6 OS=Arabidopsis thaliana GN=OPT6 PE=2 SV=1 72 771 3.0E-150
sp|Q9FJD2|OPT9_ARATH Oligopeptide transporter 9 OS=Arabidopsis thaliana GN=OPT9 PE=2 SV=1 65 779 2.0E-140
sp|Q06593|OPT2_YEAST Oligopeptide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT2 PE=1 SV=1 37 772 6.0E-115
sp|Q7LL00|YQJC_SCHPO Uncharacterized oligopeptide transporter C1840.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1840.12 PE=3 SV=2 45 799 5.0E-111
[Show less]

GO

GO Term Description Terminal node
GO:0035673 oligopeptide transmembrane transporter activity Yes
GO:0022857 transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0042887 amide transmembrane transporter activity No
GO:1904680 peptide transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

Domain # Start End Length
1 101 123 22
2 177 199 22
3 206 228 22
4 233 255 22
5 285 307 22
6 322 344 22
7 351 373 22
8 420 442 22
9 478 500 22
10 504 526 22
11 552 574 22
12 589 611 22
13 659 678 19
14 693 715 22
15 736 758 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|969
MASVAEATGVEGLGPKPSHRRSVSLDSLDGLDGLIPERENAPLMVDDEEYELRNWQPRVEGAQVKAIDEEGDDDE
EEEDSPYAEVRAAIGNRDEDVPCSTIRAWVIGLLLVLVGASTNTLFSLRQPSISVGALVGQILAWPLGHGWARFL
PDWQVPTPFGRSLPLNPGPFTIKEHSIIGVMASVSFSVAYSTDIILAQLVFYKQDFGFLFQMLLTISTQSLGYGI
AGAMRKYLVYPASMIWPGILVSVTMMNVMYEEEDDKKDGSSSFIGSSMPRYRWFGLVTAGAFVYYFIPGFLVQCL
SVFAFATWMAPQNVVINQLFGGTTGLSLMPLTLDWTQIAGWVGSPLIPPWYAIANVIIGVSVFFVFGCSVLHYSG
AWYAPFLPMSDATTYDNTGKPYNTSRVLKPDFTLDEDAYRAYSPLFISTSFAMAYGLAFAGISSLIVHTYLHYRK
QIWQQYRNSTGEKPDIHMKLMSRYSEAPMWWYLSLFVAMLALGLYTVLAYPTQLSWWAYLLAVGISYGFSLPIGI
IEAVTSSQIGLNVLTEFIYGYIQPGRPLALMIFKTFGSITMGQALRFIADLKFGHYMKIPPKTMFFAQVIATTLS
CVVQITTLNLALGSIEDVCDIHQRDRFTCPGGRVFFSASVIWGLIGPDRIFSPGRIYQGLFLFFVLGAVTPIIIH
FASKRYPSSPIKYLMAPLIFGGAGAIPPATPLNYFSWAVVGFVFQYYIKRRHFRWWSRLNFLTSCGLDLGLALGT
LFIFFAFSMHGIKPPQWWPNTVVSTTMDVQGTAIQAHVAEGQRFGPDVW*
Coding >Ophun1|969
ATGGCGTCGGTGGCCGAAGCGACGGGCGTCGAGGGCCTGGGTCCCAAGCCGTCTCATCGACGGTCCGTTTCTCTC
GACAGCCTCGATGGCCTCGATGGCCTCATCCCGGAGCGGGAGAACGCGCCTCTCATGGTGGACGACGAGGAGTAC
GAGCTCCGAAACTGGCAGCCACGCGTCGAGGGCGCACAGGTCAAGGCAATCGATGAAGAGGGAGATGACGACGAA
GAGGAAGAGGACTCGCCCTATGCCGAGGTCCGTGCCGCCATTGGGAACCGCGACGAGGATGTTCCCTGCAGCACG
ATCCGCGCCTGGGTCATTGGCCTGCTTCTCGTCCTCGTCGGCGCCTCGACCAATACGCTCTTCTCGCTGCGACAG
CCGTCCATCTCTGTGGGCGCGCTGGTGGGCCAGATCTTGGCTTGGCCGCTGGGTCATGGCTGGGCGCGCTTCCTC
CCGGACTGGCAGGTGCCCACTCCATTTGGGCGCAGTCTGCCGCTGAATCCGGGGCCCTTTACCATCAAGGAGCAT
AGCATCATTGGCGTCATGGCCAGCGTTTCGTTTTCCGTCGCCTATTCGACTGATATCATATTGGCCCAACTGGTT
TTTTACAAGCAGGATTTCGGCTTTCTCTTCCAGATGCTATTGACCATCTCGACGCAGTCGCTCGGCTATGGAATT
GCCGGTGCCATGCGCAAGTATCTTGTCTATCCGGCTTCCATGATCTGGCCCGGCATCCTGGTGTCTGTGACGATG
ATGAACGTCATGTACGAGGAGGAAGACGACAAGAAAGATGGATCCTCGTCTTTCATTGGCAGTTCGATGCCCCGA
TACCGCTGGTTCGGGCTGGTGACGGCCGGCGCCTTCGTCTACTACTTCATCCCCGGCTTCCTGGTTCAGTGCCTC
AGCGTCTTCGCCTTTGCTACCTGGATGGCGCCGCAGAACGTCGTCATCAACCAGTTGTTTGGCGGCACGACGGGC
CTGTCACTGATGCCCCTCACGCTGGACTGGACCCAGATCGCCGGTTGGGTCGGATCGCCGTTGATTCCGCCATGG
TACGCCATCGCCAACGTCATCATCGGCGTCTCCGTCTTCTTCGTCTTCGGCTGCTCCGTGCTTCACTACTCGGGC
GCCTGGTACGCACCCTTCCTGCCCATGAGCGACGCCACGACGTACGACAACACGGGAAAGCCCTACAACACGTCG
CGGGTGCTGAAGCCCGACTTTACGCTCGACGAAGACGCCTACCGCGCGTACTCGCCGCTGTTTATAAGCACGTCG
TTCGCCATGGCCTACGGCTTGGCCTTTGCCGGCATCTCGTCCCTCATTGTCCATACTTATCTGCACTATCGCAAG
CAAATCTGGCAGCAGTACCGCAACAGCACGGGCGAGAAGCCGGACATCCACATGAAGCTCATGAGCCGATATAGC
GAGGCGCCCATGTGGTGGTACCTGTCGCTCTTCGTCGCCATGCTCGCCCTTGGTCTCTACACCGTGCTGGCTTAT
CCAACTCAGCTGTCGTGGTGGGCGTACCTGCTCGCCGTTGGCATATCGTACGGCTTCTCGCTGCCGATTGGCATC
ATCGAGGCTGTGACGAGCAGCCAGATCGGGCTCAATGTCCTGACAGAGTTCATCTACGGTTACATCCAGCCGGGT
CGGCCTCTGGCTCTCATGATCTTCAAGACGTTTGGAAGCATCACCATGGGACAGGCCCTCCGCTTCATCGCAGAC
CTCAAGTTCGGCCACTACATGAAGATCCCGCCCAAGACCATGTTCTTCGCCCAGGTCATCGCCACCACGCTCTCG
TGTGTTGTCCAGATCACGACGCTCAACCTGGCCCTCGGCAGCATTGAAGACGTCTGCGACATCCATCAGCGCGAT
CGCTTCACCTGCCCCGGCGGCCGCGTCTTCTTCTCTGCGTCCGTCATCTGGGGCCTCATCGGTCCGGATCGCATC
TTCTCTCCCGGACGCATCTACCAGGGTCTCTTCCTGTTCTTCGTGCTCGGCGCCGTCACCCCCATCATCATTCAT
TTCGCGTCCAAGCGATACCCGTCCTCGCCCATCAAGTATCTGATGGCGCCTCTCATCTTCGGCGGCGCCGGTGCC
ATCCCTCCCGCCACGCCACTCAACTACTTCTCCTGGGCCGTGGTAGGCTTCGTCTTTCAGTACTATATCAAGAGG
CGTCACTTCCGCTGGTGGAGCCGTCTCAACTTCCTCACCTCGTGCGGTCTCGATCTCGGCCTTGCCCTCGGCACC
CTCTTCATTTTCTTTGCCTTTTCCATGCATGGCATCAAGCCGCCCCAATGGTGGCCCAATACCGTCGTGTCCACC
ACCATGGACGTTCAGGGGACGGCTATTCAGGCTCACGTCGCTGAGGGGCAGCGCTTCGGCCCTGATGTATGGTAG
Transcript >Ophun1|969
ATGGCGTCGGTGGCCGAAGCGACGGGCGTCGAGGGCCTGGGTCCCAAGCCGTCTCATCGACGGTCCGTTTCTCTC
GACAGCCTCGATGGCCTCGATGGCCTCATCCCGGAGCGGGAGAACGCGCCTCTCATGGTGGACGACGAGGAGTAC
GAGCTCCGAAACTGGCAGCCACGCGTCGAGGGCGCACAGGTCAAGGCAATCGATGAAGAGGGAGATGACGACGAA
GAGGAAGAGGACTCGCCCTATGCCGAGGTCCGTGCCGCCATTGGGAACCGCGACGAGGATGTTCCCTGCAGCACG
ATCCGCGCCTGGGTCATTGGCCTGCTTCTCGTCCTCGTCGGCGCCTCGACCAATACGCTCTTCTCGCTGCGACAG
CCGTCCATCTCTGTGGGCGCGCTGGTGGGCCAGATCTTGGCTTGGCCGCTGGGTCATGGCTGGGCGCGCTTCCTC
CCGGACTGGCAGGTGCCCACTCCATTTGGGCGCAGTCTGCCGCTGAATCCGGGGCCCTTTACCATCAAGGAGCAT
AGCATCATTGGCGTCATGGCCAGCGTTTCGTTTTCCGTCGCCTATTCGACTGATATCATATTGGCCCAACTGGTT
TTTTACAAGCAGGATTTCGGCTTTCTCTTCCAGATGCTATTGACCATCTCGACGCAGTCGCTCGGCTATGGAATT
GCCGGTGCCATGCGCAAGTATCTTGTCTATCCGGCTTCCATGATCTGGCCCGGCATCCTGGTGTCTGTGACGATG
ATGAACGTCATGTACGAGGAGGAAGACGACAAGAAAGATGGATCCTCGTCTTTCATTGGCAGTTCGATGCCCCGA
TACCGCTGGTTCGGGCTGGTGACGGCCGGCGCCTTCGTCTACTACTTCATCCCCGGCTTCCTGGTTCAGTGCCTC
AGCGTCTTCGCCTTTGCTACCTGGATGGCGCCGCAGAACGTCGTCATCAACCAGTTGTTTGGCGGCACGACGGGC
CTGTCACTGATGCCCCTCACGCTGGACTGGACCCAGATCGCCGGTTGGGTCGGATCGCCGTTGATTCCGCCATGG
TACGCCATCGCCAACGTCATCATCGGCGTCTCCGTCTTCTTCGTCTTCGGCTGCTCCGTGCTTCACTACTCGGGC
GCCTGGTACGCACCCTTCCTGCCCATGAGCGACGCCACGACGTACGACAACACGGGAAAGCCCTACAACACGTCG
CGGGTGCTGAAGCCCGACTTTACGCTCGACGAAGACGCCTACCGCGCGTACTCGCCGCTGTTTATAAGCACGTCG
TTCGCCATGGCCTACGGCTTGGCCTTTGCCGGCATCTCGTCCCTCATTGTCCATACTTATCTGCACTATCGCAAG
CAAATCTGGCAGCAGTACCGCAACAGCACGGGCGAGAAGCCGGACATCCACATGAAGCTCATGAGCCGATATAGC
GAGGCGCCCATGTGGTGGTACCTGTCGCTCTTCGTCGCCATGCTCGCCCTTGGTCTCTACACCGTGCTGGCTTAT
CCAACTCAGCTGTCGTGGTGGGCGTACCTGCTCGCCGTTGGCATATCGTACGGCTTCTCGCTGCCGATTGGCATC
ATCGAGGCTGTGACGAGCAGCCAGATCGGGCTCAATGTCCTGACAGAGTTCATCTACGGTTACATCCAGCCGGGT
CGGCCTCTGGCTCTCATGATCTTCAAGACGTTTGGAAGCATCACCATGGGACAGGCCCTCCGCTTCATCGCAGAC
CTCAAGTTCGGCCACTACATGAAGATCCCGCCCAAGACCATGTTCTTCGCCCAGGTCATCGCCACCACGCTCTCG
TGTGTTGTCCAGATCACGACGCTCAACCTGGCCCTCGGCAGCATTGAAGACGTCTGCGACATCCATCAGCGCGAT
CGCTTCACCTGCCCCGGCGGCCGCGTCTTCTTCTCTGCGTCCGTCATCTGGGGCCTCATCGGTCCGGATCGCATC
TTCTCTCCCGGACGCATCTACCAGGGTCTCTTCCTGTTCTTCGTGCTCGGCGCCGTCACCCCCATCATCATTCAT
TTCGCGTCCAAGCGATACCCGTCCTCGCCCATCAAGTATCTGATGGCGCCTCTCATCTTCGGCGGCGCCGGTGCC
ATCCCTCCCGCCACGCCACTCAACTACTTCTCCTGGGCCGTGGTAGGCTTCGTCTTTCAGTACTATATCAAGAGG
CGTCACTTCCGCTGGTGGAGCCGTCTCAACTTCCTCACCTCGTGCGGTCTCGATCTCGGCCTTGCCCTCGGCACC
CTCTTCATTTTCTTTGCCTTTTCCATGCATGGCATCAAGCCGCCCCAATGGTGGCCCAATACCGTCGTGTCCACC
ACCATGGACGTTCAGGGGACGGCTATTCAGGCTCACGTCGCTGAGGGGCAGCGCTTCGGCCCTGATGTATGGTAG
Gene >Ophun1|969
ATGGCGTCGGTGGCCGAAGCGACGGGCGTCGAGGGCCTGGGTCCCAAGCCGTCTCATCGACGGTCCGTTTCTCTC
GACAGCCTCGATGGCCTCGATGGCCTCATCCCGGAGCGGGAGAACGCGCCTCTCATGGTGGACGACGAGGAGTAC
GAGCTCCGAAACTGGCAGCCACGCGTCGAGGGCGCACAGGTCAAGGCAATCGATGAAGAGGGAGATGACGACGAA
GAGGAAGAGGACTCGCCCTATGCCGAGGTCCGTGCCGCCATTGGGAACCGCGACGAGGATGTTCCCTGCAGCACG
ATCCGCGCCTGGGTCATTGGCCTGCTTCTCGTCCTCGTCGGCGCCTCGACCAATACGCTCTTCTCGCTGCGACAG
CCGTCCATCTCTGTGGGCGCGCTGGTGGGCCAGATCTTGGCTTGGCCGCTGGGTCATGGCTGGGCGCGCTTCCTC
CCGGACTGGCAGGTGCCCACTCCATTTGGGCGCAGTCTGCCGCTGAATCCGGGGCCCTTTACCATCAAGGAGCAT
AGCATCATTGGCGTCATGGCCAGCGTTTCGTTTTCCGTCGCCTATTCGACTGATATCATATTGGCCCAACTGGTT
TTTTACAAGCAGGATTTCGGCTTTCTCTTCCAGATGCTATTGACCATCTCGACGCAGTCGCTCGGCTATGGAATT
GCCGGTGCCATGCGCAAGTATCTTGGTGGGTTCGGGCCTTCTGGGATCGTGAGGTTCCGTTCTCCTTGACCGGCT
AACTCGGACTCCGGGATAGTCTATCCGGCTTCCATGATCTGGCCCGGCATCCTGGTGTCTGTGACGATGATGAAC
GTCATGTACGAGGAGGAAGACGACAAGAAAGATGGATCCTCGTCTTTCATTGGCAGTTCGATGCCCCGATACCGC
TGGTTCGGGCTGGTGACGGCCGGCGCCTTCGTCTACTACTTCATCCCCGGCTTCCTGGTTCAGTGCCTCAGCGTC
TTCGCCTTTGCTACCTGGATGGCGCCGCAGAACGTCGTCATCAACCAGTTGTTTGGCGGCACGACGGGCCTGTCA
CTGATGCCCCTCACGCTGGACTGGACCCAGATCGCCGGTTGGGTCGGATCGCCGTTGATTCCGCCATGGTAAATG
ATCTATTCCCCTTGACAGTAGAAGATGAACGTCTTCTCACAGACCCTACAGGTACGCCATCGCCAACGTCATCAT
CGGCGTCTCCGTCTTCTTCGTCTTCGGCTGCTCCGTGCTTCACTACTCGGGCGCCTGGTACGCACCCTTCCTGCC
CATGAGCGACGCCACGACGTACGACAACACGGGAAAGCCCTACAACACGTCGCGGGTGCTGAAGCCCGACTTTAC
GCTCGACGAAGACGCCTACCGCGCGTACTCGCCGCTGTTTATAAGCACGTCGTTCGCCATGGCCTACGGCTTGGC
CTTTGCCGGCATCTCGTCCCTCATTGTCCATACTTATCTGCACTATCGCAAGCAAATCTGGCAGCAGTACCGCAA
CAGCACGGGCGAGAAGCCGGACATCCACATGAAGCTCATGAGCCGATATAGCGAGGCGCCCATGTGGTGGTACCT
GTCGCTCTTCGTCGCCGTTCGTATCGCGTCGTCCCTTGACGACCCTTTGACTGACCTGGAGCCAGATGCTCGCCC
TTGGTCTCTACACCGTGCTGGCTTATCCAACTCAGCTGTCGTGGTGGGCGTACCTGCTCGCCGTTGGCATATCGT
ACGGCTTCTCGCTGCCGATTGGCATCATCGAGGCTGTGACGAGCAGCCAGATCGGGCTCAATGTCCTGACAGAGT
TCATCTACGGTTACATCCAGCCGGGTCGGCCTCTGGCTCTCATGATGTACGACTCGGCGTTGCCCTCTTGCTGTT
TATAACTAACAGACGGACAGCTTCAAGACGTTTGGAAGCATCACCATGTGCGTTGTTCACACCACCTCCCCCCCT
GCGAATGGTGCCCTCTGACGCATCCTACAGGGGACAGGCCCTCCGCTTCATCGCAGACCTCAAGTTCGGCCACTA
CATGAAGATCCCGCCCAAGACCATGTTCTTCGCCCAGGTCATCGCCACCACGCTCTCGTGTGTTGTCCAGATCAC
GACGCTCAACCTGGCCCTCGGCAGCATTGAAGACGTCTGCGACATCCATCAGCGCGATCGCTTCACCTGCCCCGG
CGGCCGCGTCTTCTTCTCTGGTGAGTCCTGTTCCTCGTCCGCCCCTTGCCCCTTTAAGGCCTTGCCTGACTCTCT
GTGGAGCGTCCGTCATCTGGGGCCTCATCGGTCCGGATCGCATCTTCTCTCCCGGACGCATCTACCAGGGTCTCT
TCCTGTTCTTCGTGCTCGGCGCCGTCACCCCCATCATCATTCATTTCGCGTCCAAGCGATACCCGTCCTCGCCCA
TCAAGTATCTGATGGCGCCTCTCATCTTCGGCGGCGCCGGTGCCATCCCTCCCGCCACGCCACTCAACTACTTCT
CCTGGGCCGTGGTAGGCTTCGTCTTTCAGTACTATATCAAGAGGCGTCACTTCCGCTGGTGGAGCCGTCTCAACT
TCCTCACCTCGTGCGGTCTCGATCTCGGCCTTGCCCTCGGCACCCTCTTCATTTTCTTTGCCTTTTCCATGCATG
GCATCAAGCCGCCCCAATGGTGGCCCAATACCGTCGTGTCCACCACCATGGACGTTCAGGGGACGGCTATTCAGG
CTCACGTCGCTGAGGGGCAGCGCTTCGGCCCTGATGTATGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail