Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|968
Gene name
LocationContig_135:4093..6881
Strand-
Gene length (bp)2788
Transcript length (bp)2055
Coding sequence length (bp)2055
Protein length (aa) 685

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 1.8E-56 1 257
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 8.0E-34 265 385
PF03981 Ubiq_cyt_C_chap Ubiquinol-cytochrome C chaperone 7.0E-31 510 647

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94297|OXSM_SCHPO Putative 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.13c PE=3 SV=1 1 429 5.0E-150
sp|Q9NWU1|OXSM_HUMAN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Homo sapiens GN=OXSM PE=1 SV=1 2 427 6.0E-139
sp|Q9D404|OXSM_MOUSE 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Mus musculus GN=Oxsm PE=1 SV=1 2 427 2.0E-137
sp|P56902|FABF_RHIME 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Rhizobium meliloti (strain 1021) GN=fabF PE=3 SV=2 1 428 6.0E-134
sp|Q0VCA7|OXSM_BOVIN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Bos taurus GN=OXSM PE=2 SV=1 2 427 1.0E-130
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94297|OXSM_SCHPO Putative 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.13c PE=3 SV=1 1 429 5.0E-150
sp|Q9NWU1|OXSM_HUMAN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Homo sapiens GN=OXSM PE=1 SV=1 2 427 6.0E-139
sp|Q9D404|OXSM_MOUSE 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Mus musculus GN=Oxsm PE=1 SV=1 2 427 2.0E-137
sp|P56902|FABF_RHIME 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Rhizobium meliloti (strain 1021) GN=fabF PE=3 SV=2 1 428 6.0E-134
sp|Q0VCA7|OXSM_BOVIN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Bos taurus GN=OXSM PE=2 SV=1 2 427 1.0E-130
sp|Q8L3X9|KASM_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Arabidopsis thaliana GN=KAS PE=1 SV=1 2 427 3.0E-130
sp|P55338|FABF_VIBHA 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio harveyi GN=fabF PE=3 SV=2 2 429 2.0E-120
sp|Q9KQH9|FABF_VIBCH 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabF PE=1 SV=3 2 427 2.0E-117
sp|O34340|FABF_BACSU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Bacillus subtilis (strain 168) GN=fabF PE=1 SV=1 2 426 7.0E-110
sp|Q83E37|FABF_COXBU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=fabF PE=1 SV=1 2 427 6.0E-104
sp|Q8NXE1|FABF_STAAW 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MW2) GN=fabF PE=1 SV=1 2 427 1.0E-99
sp|Q6GAU2|FABF_STAAS 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MSSA476) GN=fabF PE=3 SV=1 2 427 1.0E-99
sp|Q5HHA1|FABF_STAAC 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain COL) GN=fabF PE=1 SV=1 2 427 1.0E-99
sp|Q7A6F8|FABF_STAAN 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain N315) GN=fabF PE=1 SV=1 2 427 1.0E-99
sp|Q99VA6|FABF_STAAM 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabF PE=3 SV=1 2 427 1.0E-99
sp|Q6GIA3|FABF_STAAR 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MRSA252) GN=fabF PE=3 SV=1 3 427 3.0E-99
sp|P0AAI8|FABF_SHIFL 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Shigella flexneri GN=fabF PE=3 SV=2 2 427 8.0E-99
sp|P0AAI5|FABF_ECOLI 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli (strain K12) GN=fabF PE=1 SV=2 2 427 8.0E-99
sp|P0AAI6|FABF_ECOL6 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabF PE=3 SV=2 2 427 8.0E-99
sp|P0AAI7|FABF_ECO57 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli O157:H7 GN=fabF PE=3 SV=2 2 427 8.0E-99
sp|P39525|CEM1_YEAST 3-oxoacyl-[acyl-carrier-protein] synthase homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CEM1 PE=1 SV=1 2 426 1.0E-97
sp|Q5TKS0|FABF_STAAU 3-oxoacyl-[acyl-carrier-protein] synthase 2 (Fragment) OS=Staphylococcus aureus GN=fabF PE=3 SV=1 5 424 5.0E-97
sp|P73283|FABF_SYNY3 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabF PE=1 SV=1 2 426 9.0E-96
sp|P52410|KASC1_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Arabidopsis thaliana GN=KAS1 PE=2 SV=2 2 425 3.0E-82
sp|P23902|KASC1_HORVU 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Hordeum vulgare GN=KAS12 PE=1 SV=1 2 425 7.0E-78
sp|Q9C9P4|KASC2_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic OS=Arabidopsis thaliana GN=KAS2 PE=1 SV=1 2 425 2.0E-72
sp|P9WQD9|FAB1_MYCTU 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kasA PE=1 SV=1 19 426 3.0E-70
sp|P9WQD8|FAB1_MYCTO 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kasA PE=3 SV=1 19 426 3.0E-70
sp|H8ESN0|FAB1_MYCTE 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) GN=kasA PE=2 SV=2 19 426 3.0E-70
sp|P63455|FAB1_MYCBO 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kasA PE=3 SV=1 19 426 3.0E-70
sp|Q02578|KAS1_STRCN Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces cyaneus GN=curA PE=3 SV=1 2 425 5.0E-70
sp|Q05356|KAS1_STRHA Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces halstedii GN=sch1 PE=3 SV=1 2 425 4.0E-69
sp|P9WQD7|FAB2_MYCTU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kasB PE=1 SV=1 4 426 2.0E-68
sp|P9WQD6|FAB2_MYCTO 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kasB PE=3 SV=1 4 426 2.0E-68
sp|P63457|FAB2_MYCBO 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kasB PE=3 SV=1 4 426 2.0E-68
sp|P16540|KAS1_STRVN Granaticin polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces violaceoruber GN=gra-orf1 PE=3 SV=1 2 430 8.0E-68
sp|Q9CBS7|FAB1_MYCLE 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium leprae (strain TN) GN=kasA PE=3 SV=1 19 426 5.0E-67
sp|O69473|FAB2_MYCLE 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium leprae (strain TN) GN=kasB PE=3 SV=2 3 424 1.0E-65
sp|P23155|KAS1_STRCO Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5318 PE=3 SV=1 2 425 2.0E-64
sp|Q02059|KASA_STRCO Actinorhodin polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5087 PE=1 SV=2 2 424 1.0E-63
sp|P41175|KAS1_STRCM Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces cinnamonensis PE=3 SV=1 2 425 5.0E-63
sp|P43710|FABB_HAEIN 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabB PE=3 SV=1 1 426 6.0E-63
sp|P72331|NODE_RHIS3 Nodulation protein E OS=Rhizobium sp. (strain N33) GN=nodE PE=3 SV=1 2 427 7.0E-63
sp|P04684|NODE_RHILT Nodulation protein E OS=Rhizobium leguminosarum bv. trifolii GN=nodE PE=3 SV=2 2 427 2.0E-62
sp|P0A953|FABB_ECOLI 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Escherichia coli (strain K12) GN=fabB PE=1 SV=1 1 429 2.0E-61
sp|P0A954|FABB_ECOL6 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabB PE=3 SV=1 1 429 2.0E-61
sp|P06230|NODE_RHIME Nodulation protein E OS=Rhizobium meliloti (strain 1021) GN=nodE PE=3 SV=1 2 427 1.0E-60
sp|P16538|KAS1_STRGA Tetracenomycin C polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces glaucescens GN=tcmK PE=3 SV=1 2 430 1.0E-60
sp|P57193|FABB_BUCAI 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=fabB PE=3 SV=1 1 426 3.0E-59
sp|Q89AY4|FABB_BUCBP 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fabB PE=3 SV=1 1 427 5.0E-59
sp|P06231|NOE4_RHIML Nodulation protein E OS=Rhizobium meliloti GN=nodE PE=3 SV=1 2 427 8.0E-59
sp|P04683|NODE_RHILV Nodulation protein E OS=Rhizobium leguminosarum bv. viciae GN=nodE PE=3 SV=2 2 427 1.0E-57
sp|Q02K94|FABB_PSEAB 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=fabB PE=1 SV=1 1 426 1.0E-56
sp|P43678|KAS1_STRRM Oxytetracycline polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces rimosus PE=3 SV=2 2 425 2.0E-51
sp|Q8KA28|FABB_BUCAP 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fabB PE=3 SV=1 1 426 4.0E-48
sp|P40804|PKSF_BACSU Polyketide biosynthesis malonyl-ACP decarboxylase PksF OS=Bacillus subtilis (strain 168) GN=pksF PE=1 SV=3 71 429 5.0E-32
sp|P16539|KAS2_STRGA Tetracenomycin C polyketide putative beta-ketoacyl synthase 2 OS=Streptomyces glaucescens GN=tcmL PE=3 SV=2 4 426 2.0E-29
sp|Q05357|KAS2_STRHA Putative polyketide beta-ketoacyl synthase 2 OS=Streptomyces halstedii GN=sch2 PE=3 SV=1 2 426 1.0E-27
sp|P96284|PKS15_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks15 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks15 PE=1 SV=2 149 424 1.0E-27
sp|Q02062|KASB_STRCO Actinorhodin polyketide putative beta-ketoacyl synthase 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5088 PE=1 SV=1 4 430 3.0E-27
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 149 423 1.0E-26
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 149 424 2.0E-26
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 149 429 6.0E-26
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 149 429 6.0E-26
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 149 429 7.0E-26
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 149 461 1.0E-25
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 149 461 1.0E-25
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 149 461 1.0E-25
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 149 461 1.0E-25
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 149 461 1.0E-25
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 150 426 2.0E-25
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 150 426 2.0E-25
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 150 424 2.0E-25
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 139 425 5.0E-25
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 145 425 1.0E-24
sp|Q9USK6|CBP3_SCHPO CBP3-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cbp3 PE=3 SV=1 504 641 1.0E-24
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 153 423 5.0E-24
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 4 436 5.0E-24
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 4 419 6.0E-24
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 133 424 7.0E-24
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 109 432 7.0E-24
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 150 424 1.0E-23
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 12 423 1.0E-23
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 2 425 2.0E-23
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 149 439 4.0E-23
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 2 456 7.0E-23
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 162 445 3.0E-22
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 4 424 4.0E-22
sp|P23156|KAS2_STRCO Putative polyketide beta-ketoacyl synthase 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5317 PE=3 SV=1 2 426 4.0E-22
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 152 430 5.0E-22
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 152 430 6.0E-22
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 152 430 6.0E-22
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 156 427 9.0E-22
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 156 426 1.0E-21
sp|P21560|CBP3_YEAST Protein CBP3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CBP3 PE=1 SV=1 507 646 2.0E-21
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 150 441 3.0E-21
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 23 432 1.0E-20
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 109 426 1.0E-20
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 1 471 1.0E-20
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 151 429 3.0E-20
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 6 427 3.0E-20
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 153 433 4.0E-20
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 149 427 4.0E-20
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 1 436 5.0E-20
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 2 429 6.0E-20
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 153 467 7.0E-20
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 2 429 8.0E-20
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 4 435 2.0E-19
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 10 427 3.0E-19
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 4 428 3.0E-19
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 4 428 3.0E-19
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 4 425 5.0E-19
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 10 437 7.0E-19
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 150 456 9.0E-19
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 154 441 1.0E-18
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 10 431 1.0E-18
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 162 432 1.0E-18
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 4 438 1.0E-18
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 138 424 2.0E-18
sp|Q7TXL6|PPSE_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsE PE=1 SV=1 150 424 6.0E-18
sp|P9WQE1|PPSE_MYCTU Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsE PE=1 SV=1 150 424 7.0E-18
sp|P9WQE0|PPSE_MYCTO Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsE PE=3 SV=1 150 424 7.0E-18
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 23 432 7.0E-18
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 154 423 8.0E-18
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 151 429 9.0E-18
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 147 432 1.0E-17
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 147 432 1.0E-17
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 151 463 2.0E-17
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 151 424 2.0E-17
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 3 437 6.0E-17
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 4 432 7.0E-17
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 143 469 8.0E-17
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 4 431 1.0E-16
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 10 425 1.0E-16
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 3 437 1.0E-16
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 151 424 2.0E-16
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 162 424 2.0E-16
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 10 432 2.0E-16
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 150 433 3.0E-16
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 150 433 4.0E-16
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 10 425 4.0E-16
sp|P36189|FAS_ANSAN Fatty acid synthase (Fragment) OS=Anser anser anser GN=FASN PE=1 SV=1 151 377 7.0E-16
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 23 432 1.0E-15
sp|Q02579|KAS2_STRCN Putative polyketide beta-ketoacyl synthase 2 OS=Streptomyces cyaneus GN=curB PE=3 SV=1 2 424 2.0E-15
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 111 417 2.0E-15
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 23 431 2.0E-15
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 23 427 3.0E-15
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 156 433 4.0E-15
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 153 427 4.0E-15
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 23 430 5.0E-15
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 23 426 6.0E-15
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 150 429 8.0E-15
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 150 429 8.0E-15
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 150 429 8.0E-15
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 23 425 1.0E-14
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 153 424 2.0E-14
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 151 425 5.0E-14
sp|P41176|KAS2_STRCM Putative polyketide beta-ketoacyl synthase 2 OS=Streptomyces cinnamonensis PE=3 SV=1 153 423 1.0E-13
sp|Q00681|STCJ_EMENI Sterigmatocystin biosynthesis fatty acid synthase subunit alpha OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcJ PE=3 SV=2 149 439 2.0E-13
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 4 464 3.0E-13
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 151 467 3.0E-13
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 23 425 3.0E-13
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 4 451 2.0E-12
sp|P16541|KAS2_STRVN Granaticin polyketide putative beta-ketoacyl synthase 2 OS=Streptomyces violaceoruber GN=gra-orf2 PE=3 SV=2 2 432 7.0E-11
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 4 424 1.0E-10
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 162 425 8.0E-09
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 164 463 1.0E-07
sp|Q9W6I0|UQCC1_XENLA Ubiquinol-cytochrome-c reductase complex assembly factor 1 OS=Xenopus laevis GN=uqcc1 PE=2 SV=1 513 663 2.0E-07
sp|Q9CWU6|UQCC1_MOUSE Ubiquinol-cytochrome-c reductase complex assembly factor 1 OS=Mus musculus GN=Uqcc1 PE=1 SV=1 512 663 2.0E-06
sp|Q9NVA1|UQCC1_HUMAN Ubiquinol-cytochrome-c reductase complex assembly factor 1 OS=Homo sapiens GN=UQCC1 PE=1 SV=3 512 663 3.0E-06
sp|Q765N2|FAS2_LACKL Fatty acid synthase subunit alpha OS=Lachancea kluyveri GN=FAS2 PE=3 SV=1 111 296 4.0E-06
sp|P19097|FAS2_YEAST Fatty acid synthase subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAS2 PE=1 SV=2 111 265 6.0E-06
sp|Q10289|FAS2_SCHPO Fatty acid synthase subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fas2 PE=1 SV=2 111 310 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|968
MRRVVVTGLGAVTPLGVGIRRTWSRLLNGDSGITSTACREPQPRWSELTSTVAGIVPRGDAEGQWRASDWLSASD
RRRMSTFAQFAVAASDMALEDARWKASSQAQQLATGVCLGSGIGNLEDLYESSRAHHAEGYRAVSPLFVPRILIN
MAAGHVSLRHGFRGPIHTATTACTTGAHSIGDAARFIAFGDADVMIAGGAESCIHPLTFAGFGRARSLSTAYNAD
PARSCRPFDAARNGFVVSEGAAVCVLEELEHARARGAHIYAELRGYGCSGDAHHMTAPCADGDGAYHAMRRALIN
ARLRPVDVGYINAHATGTRIGDAAEVAAIRRLMLGEDGVSSESQVTVSSTKAAMGHLLGAAGAIEALVSVLAIHE
GVVPATLNLERPDVGAAFNFVPLKAQERRVDVAVTNSFGFGGTNSSLVFSRLTESEHPASQTRRLSGTAQRWGLL
SSYTEAYRVIAASERVFKVCSKPADYTISEKVRKEDGVKKLEDGEELGVPLMPLNVWHSTFQLPPSFNTWSHVTM
LHLYLINAQLRCFENDAYRSWQQQLIDHFFFECEKKMHLDHNITSSALRQRYLKDVFVQWRGLLLAYDEGLIRGD
AILASAVWRNLFKGSPDVDPMALLAVVGWMRASLAALEGVSEQSLAQDVQGILTKHVASFATELMKAKEKLRPIE
ERCIEIPKS*
Coding >Ophun1|968
ATGCGCCGCGTCGTCGTCACGGGCCTCGGCGCCGTAACGCCTCTAGGCGTCGGTATCCGTCGCACGTGGTCGCGT
CTGCTGAATGGCGACTCGGGCATCACCAGCACCGCCTGTCGCGAACCGCAACCGCGCTGGAGCGAGCTCACGAGC
ACCGTCGCCGGCATCGTGCCTCGTGGTGACGCAGAGGGCCAATGGAGGGCCTCGGACTGGCTATCTGCTTCGGAT
AGACGCCGCATGTCGACGTTTGCCCAGTTCGCCGTTGCTGCCAGCGACATGGCTCTCGAGGATGCCCGGTGGAAG
GCCTCGAGTCAGGCCCAGCAGCTCGCTACCGGCGTCTGCCTCGGAAGCGGCATCGGGAACCTCGAAGATCTGTAC
GAATCCAGTCGCGCCCATCACGCTGAAGGCTATAGGGCCGTCTCTCCCCTTTTCGTGCCCAGGATTCTCATCAAC
ATGGCAGCCGGACACGTCTCCCTCCGACACGGCTTCCGGGGTCCGATACACACGGCGACGACGGCCTGCACTACA
GGCGCCCACTCCATCGGCGACGCGGCCCGCTTCATAGCCTTTGGCGACGCCGACGTCATGATCGCAGGCGGCGCC
GAATCCTGCATTCATCCGCTCACCTTTGCCGGCTTCGGACGCGCCCGATCCCTATCGACGGCCTACAACGCCGAC
CCAGCCCGCAGCTGCCGTCCCTTCGACGCCGCCCGCAATGGCTTCGTCGTCTCCGAGGGCGCCGCCGTCTGCGTC
CTCGAGGAGCTGGAGCACGCCAGGGCCAGGGGCGCTCACATCTACGCCGAGCTCCGAGGCTACGGCTGCAGCGGA
GACGCTCACCACATGACGGCCCCGTGCGCAGACGGCGACGGAGCCTACCACGCCATGCGCCGGGCCCTGATCAAC
GCGCGCCTCAGGCCCGTCGACGTTGGCTACATCAACGCTCACGCCACGGGAACGCGTATAGGAGACGCTGCCGAG
GTGGCTGCCATCCGTCGCCTCATGCTCGGCGAGGACGGCGTCTCGTCGGAGTCGCAGGTGACGGTGAGTAGCACC
AAGGCAGCCATGGGCCATCTGCTCGGCGCCGCCGGTGCCATCGAGGCCCTCGTCTCCGTCCTTGCCATCCACGAG
GGAGTCGTTCCCGCGACTCTCAACCTCGAGAGGCCCGACGTCGGCGCCGCCTTCAACTTTGTACCCCTCAAGGCG
CAAGAGAGGCGCGTCGACGTAGCCGTCACCAATAGCTTCGGCTTCGGCGGCACCAACAGCAGCTTAGTATTTTCA
CGCCTTACTGAGAGTGAGCACCCAGCCTCTCAGACCCGGCGGTTGAGCGGCACGGCGCAGAGATGGGGCCTGTTG
AGCTCCTACACGGAGGCCTACCGCGTCATCGCCGCCTCGGAACGCGTCTTCAAGGTGTGCTCCAAGCCGGCCGAC
TACACCATTTCCGAGAAAGTCCGCAAAGAGGATGGCGTCAAGAAGCTGGAGGACGGCGAGGAGCTTGGCGTTCCT
CTCATGCCGCTCAACGTGTGGCATAGCACTTTCCAGCTGCCACCGAGCTTCAATACCTGGTCGCACGTCACGATG
CTGCACCTATATCTGATCAACGCGCAGCTGCGATGCTTCGAAAACGACGCCTATCGAAGCTGGCAGCAACAGCTG
ATCGACCACTTCTTCTTCGAGTGCGAGAAGAAGATGCATCTGGATCACAACATCACGTCGAGCGCGCTGCGCCAA
CGATACCTCAAGGACGTCTTTGTCCAGTGGCGCGGGCTGCTTCTGGCGTACGATGAGGGACTCATCAGGGGTGAC
GCCATCCTCGCCAGTGCCGTGTGGCGGAACCTTTTCAAAGGGTCGCCCGACGTTGACCCAATGGCGCTGCTGGCC
GTCGTCGGCTGGATGAGGGCGTCTTTGGCAGCGCTCGAGGGCGTGTCTGAGCAATCGTTGGCGCAGGACGTGCAG
GGCATATTGACAAAGCATGTCGCGTCCTTTGCCACGGAACTGATGAAAGCCAAGGAGAAACTGCGGCCCATCGAA
GAGCGGTGCATCGAGATTCCAAAGTCTTGA
Transcript >Ophun1|968
ATGCGCCGCGTCGTCGTCACGGGCCTCGGCGCCGTAACGCCTCTAGGCGTCGGTATCCGTCGCACGTGGTCGCGT
CTGCTGAATGGCGACTCGGGCATCACCAGCACCGCCTGTCGCGAACCGCAACCGCGCTGGAGCGAGCTCACGAGC
ACCGTCGCCGGCATCGTGCCTCGTGGTGACGCAGAGGGCCAATGGAGGGCCTCGGACTGGCTATCTGCTTCGGAT
AGACGCCGCATGTCGACGTTTGCCCAGTTCGCCGTTGCTGCCAGCGACATGGCTCTCGAGGATGCCCGGTGGAAG
GCCTCGAGTCAGGCCCAGCAGCTCGCTACCGGCGTCTGCCTCGGAAGCGGCATCGGGAACCTCGAAGATCTGTAC
GAATCCAGTCGCGCCCATCACGCTGAAGGCTATAGGGCCGTCTCTCCCCTTTTCGTGCCCAGGATTCTCATCAAC
ATGGCAGCCGGACACGTCTCCCTCCGACACGGCTTCCGGGGTCCGATACACACGGCGACGACGGCCTGCACTACA
GGCGCCCACTCCATCGGCGACGCGGCCCGCTTCATAGCCTTTGGCGACGCCGACGTCATGATCGCAGGCGGCGCC
GAATCCTGCATTCATCCGCTCACCTTTGCCGGCTTCGGACGCGCCCGATCCCTATCGACGGCCTACAACGCCGAC
CCAGCCCGCAGCTGCCGTCCCTTCGACGCCGCCCGCAATGGCTTCGTCGTCTCCGAGGGCGCCGCCGTCTGCGTC
CTCGAGGAGCTGGAGCACGCCAGGGCCAGGGGCGCTCACATCTACGCCGAGCTCCGAGGCTACGGCTGCAGCGGA
GACGCTCACCACATGACGGCCCCGTGCGCAGACGGCGACGGAGCCTACCACGCCATGCGCCGGGCCCTGATCAAC
GCGCGCCTCAGGCCCGTCGACGTTGGCTACATCAACGCTCACGCCACGGGAACGCGTATAGGAGACGCTGCCGAG
GTGGCTGCCATCCGTCGCCTCATGCTCGGCGAGGACGGCGTCTCGTCGGAGTCGCAGGTGACGGTGAGTAGCACC
AAGGCAGCCATGGGCCATCTGCTCGGCGCCGCCGGTGCCATCGAGGCCCTCGTCTCCGTCCTTGCCATCCACGAG
GGAGTCGTTCCCGCGACTCTCAACCTCGAGAGGCCCGACGTCGGCGCCGCCTTCAACTTTGTACCCCTCAAGGCG
CAAGAGAGGCGCGTCGACGTAGCCGTCACCAATAGCTTCGGCTTCGGCGGCACCAACAGCAGCTTAGTATTTTCA
CGCCTTACTGAGAGTGAGCACCCAGCCTCTCAGACCCGGCGGTTGAGCGGCACGGCGCAGAGATGGGGCCTGTTG
AGCTCCTACACGGAGGCCTACCGCGTCATCGCCGCCTCGGAACGCGTCTTCAAGGTGTGCTCCAAGCCGGCCGAC
TACACCATTTCCGAGAAAGTCCGCAAAGAGGATGGCGTCAAGAAGCTGGAGGACGGCGAGGAGCTTGGCGTTCCT
CTCATGCCGCTCAACGTGTGGCATAGCACTTTCCAGCTGCCACCGAGCTTCAATACCTGGTCGCACGTCACGATG
CTGCACCTATATCTGATCAACGCGCAGCTGCGATGCTTCGAAAACGACGCCTATCGAAGCTGGCAGCAACAGCTG
ATCGACCACTTCTTCTTCGAGTGCGAGAAGAAGATGCATCTGGATCACAACATCACGTCGAGCGCGCTGCGCCAA
CGATACCTCAAGGACGTCTTTGTCCAGTGGCGCGGGCTGCTTCTGGCGTACGATGAGGGACTCATCAGGGGTGAC
GCCATCCTCGCCAGTGCCGTGTGGCGGAACCTTTTCAAAGGGTCGCCCGACGTTGACCCAATGGCGCTGCTGGCC
GTCGTCGGCTGGATGAGGGCGTCTTTGGCAGCGCTCGAGGGCGTGTCTGAGCAATCGTTGGCGCAGGACGTGCAG
GGCATATTGACAAAGCATGTCGCGTCCTTTGCCACGGAACTGATGAAAGCCAAGGAGAAACTGCGGCCCATCGAA
GAGCGGTGCATCGAGATTCCAAAGTCTTGA
Gene >Ophun1|968
ATGCGCCGCGTCGTCGTCACGGGCCTCGGCGCCGTAACGCCTCTAGGCGTCGGTATCCGTCGCACGTGGTCGCGT
CTGCTGAATGGCGACTCGGGCATCACCAGCACCGCCTGTCGCGAACCGCAACCGCGCTGGAGCGAGCTCACGAGC
ACCGTCGCCGGCATCGTGCCTCGTGGTGACGCAGAGGGCCAATGGAGGGCCTCGGACTGGCTATCTGCTTCGGAT
AGACGCCGCATGTCGACGTTTGCCCAGTTCGCCGTTGCTGCCAGCGACATGGCTCTCGAGGATGCCCGGTGGAAG
GCCTCGAGTCAGGCCCAGCAGCTCGCTACCGGCGTCTGCCTCGGAAGCGGCATCGGGAACCTCGAAGATCTGTAC
GAATCCAGTCGCGCCCATCACGCTGAAGTGAGGCAGCGCCGTATCTCGAAGCCGAGCCAAGAAGGGCCAACCGTT
AGCTAACCCTATGCCGCCTACTATCAGGGCTATAGGGCCGTCTCTCCCCTTTTCGTGCCCAGGATTCTCATCAAC
ATGGCAGCCGGACACGTCTCCCTCCGACACGGCTTCCGGGGTCCGATACACACGGCGACGACGGCCTGCACTACA
GGCGCCCACTCCATCGGCGACGCGGCCCGCTTCATAGCCTTTGGCGACGCCGACGTCATGATCGCAGGCGGCGCC
GAATCCTGCATTCATCCGCTCACCTTTGCCGGCTTCGGACGCGCCCGATCCCTATCGACGGCCTACAACGCCGAC
CCAGCCCGCAGCTGCCGTCCCTTCGACGCCGCCCGCAATGGCTTCGTCGTCTCCGAGGGCGCCGCCGTCTGCGTC
CTCGAGGAGCTGGAGCACGCCAGGGCCAGGGGCGCTCACATCTACGCCGAGCTCCGAGGCTACGGCTGCAGCGGA
GACGCTCACCACATGACGGCCCCGTGCGCAGACGGCGACGGAGCCTACCACGCCATGCGCCGGGCCCTGATCAAC
GCGCGCCTCAGGCCCGTCGACGTTGGCTACATCAACGCTCACGCCACGGGAACGCGTATAGGAGACGCTGCCGAG
GTGGCTGCCATCCGTCGCCTCATGCTCGGCGAGGACGGCGTCTCGTCGGAGTCGCAGGTGACGGTGAGTAGCACC
AAGGCAGCCATGGGCCATCTGCTCGGCGCCGCCGGTGCCATCGAGGCCCTCGTCTCCGTCCTTGCCATCCACGAG
GTGAGTTGAGCTGCGATTGACGAAGAGATGGATTCTTGTCTCGCTTCAGTAGCTGATGTCGACAATGGTAGGGAG
TCGTTCCCGCGACTCTCAACCTCGAGAGGCCCGACGTCGGCGCCGCCTTCAACTTTGTACCCCTCAAGGCGCAAG
AGAGGCGCGTCGACGTAGCCGTCACCAATAGCTTCGGCTTCGGCGGCACCAACAGCAGCTTAGTATTTTCACGCC
TTACTGAGAGTGAGCAGTGAGCCATCGTCTTCCTGATGGGGTTCGTGCTAGATCGTCTGGCCGAGGCGAGTGGTG
GCGGTTCCCGTAGATACCTACTCGTCCACCGCTGCGCCAATCCCTCAGCAGGGAGTCGTTTAGGCTTGAACCATG
GGCTGCAAGACACTCTCGATTCACCTGCATGTTGTTTGTACGAGTCGAAGGAGGTTGAAGCCGAGGCTGGAGTGT
ACCGCGGAGGTAGTCTGTCAGTGGCCCGGAACATTTCGGGCCGCGCAACTTTTTCAACTTGTAAGCGTCATTATC
GTCATCGACAGCTTCTCTTTACCAAGAACCAACCAATTCATCAGCTCTTACGAGGCTCGCTCGGCCAGCTACACG
CGAAGAATCCCACCAAACGAGCGTTCCGCCCCCTTACTCTCTTCCCGCTCCAGCAATGGCCTGCGAGAGCCTCAG
GTGGCACCGAAGCCTCGTCCAGCTCACCGCCCGCGCGAGGCCAAGGCCATCATCTCCCTCTACAAGCAATACGCC
TATTCCCCGACGCAGCCCAGCCTCTCAGACCCGGCGGTTGAGCGGCACGGCGCAGAGATGGGGCCTGTTGAGCTC
CTACACGGAGGCCTACCGCGTCATCGCCGCCTCGGAACGCGTCTTCAAGGTGTGCTCCAAGCCGGCCGACTACAC
CATTTCCGAGAAAGTCCGCAAAGAGGATGGCGTCAAGAAGCTGGAGGACGGCGAGGAGCTTGGCGTTCCTCTCAT
GCCGCTCAACGTGTGGCATAGCAGTGCGTTGTTTGCGTCCCTGGCTGTGGTTCGATGGGTTGGCTAACCGTTTTT
CCCTGTGTCAGCTTTCCAGCTGCCACCGAGCTTCAATACCTGGTCGCACGTCACGATGCTGCACCTATATCTGAT
CAACGCGCAGCTGCGATGCTTCGAAAACGACGCCTATCGAAGCTGGCAGCAACAGCTGATCGACCACTTCTTCTT
CGAGTGCGAGAAGAAGATGCATCTGGATCACAACATCACGTCGAGCGCGCTGCGCCAACGATACCTCAAGGACGT
CTTTGTCCAGTGGCGCGGGCTGCTTCTGGCGTACGATGAGGGACTCATCAGGGGTGACGCCATCCTCGCCAGTGC
CGTGTGGCGGAACCTTTTCAAAGGGTCGCCCGACGTTGACCCAATGGCGCTGCTGGCCGTCGTCGGCTGGATGAG
GGCGTCTTTGGCAGCGCTCGAGGGCGTGTCTGAGCAATCGTTGGCGCAGGACGTGCAGGGCATATTGACAAAGCA
TGTCGCGTCCTTTGCCACGGAACTGATGAAAGCCAAGGAGAAACTGCGGCCCATCGAAGAGCGGTGCATCGAGAT
TCCAAAGTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail