Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|967
Gene name
LocationContig_135:3164..3836
Strand+
Gene length (bp)672
Transcript length (bp)672
Coding sequence length (bp)672
Protein length (aa) 224

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00186 DHFR_1 Dihydrofolate reductase 1.5E-20 74 179

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P16184|DYR_PNECA Dihydrofolate reductase OS=Pneumocystis carinii PE=1 SV=1 2 219 5.0E-39
sp|P22906|DYR_CANAX Dihydrofolate reductase OS=Candida albicans GN=DFR1 PE=1 SV=4 1 219 7.0E-31
sp|Q07801|DYR_CRYNJ Dihydrofolate reductase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DFR1 PE=1 SV=1 4 219 1.0E-30
sp|Q920D2|DYR_RAT Dihydrofolate reductase OS=Rattus norvegicus GN=Dhfr PE=2 SV=3 6 223 3.0E-29
sp|P00375|DYR_MOUSE Dihydrofolate reductase OS=Mus musculus GN=Dhfr PE=1 SV=3 6 223 6.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P16184|DYR_PNECA Dihydrofolate reductase OS=Pneumocystis carinii PE=1 SV=1 2 219 5.0E-39
sp|P22906|DYR_CANAX Dihydrofolate reductase OS=Candida albicans GN=DFR1 PE=1 SV=4 1 219 7.0E-31
sp|Q07801|DYR_CRYNJ Dihydrofolate reductase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DFR1 PE=1 SV=1 4 219 1.0E-30
sp|Q920D2|DYR_RAT Dihydrofolate reductase OS=Rattus norvegicus GN=Dhfr PE=2 SV=3 6 223 3.0E-29
sp|P00375|DYR_MOUSE Dihydrofolate reductase OS=Mus musculus GN=Dhfr PE=1 SV=3 6 223 6.0E-29
sp|Q9U8B8|DYR_HELVI Dihydrofolate reductase OS=Heliothis virescens GN=DHFR PE=1 SV=1 1 177 7.0E-29
sp|P04753|DYR_MESAU Dihydrofolate reductase OS=Mesocricetus auratus GN=DHFR PE=2 SV=4 6 222 2.0E-28
sp|P00374|DYR_HUMAN Dihydrofolate reductase OS=Homo sapiens GN=DHFR PE=1 SV=2 6 223 8.0E-28
sp|P00377|DYR_PIG Dihydrofolate reductase OS=Sus scrofa GN=DHFR PE=1 SV=1 6 222 1.0E-27
sp|P36591|DYR_SCHPO Dihydrofolate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dfr1 PE=2 SV=2 2 216 5.0E-27
sp|P22573|DYR_SHV2C Viral dihydrofolate reductase OS=Saimiriine herpesvirus 2 (strain 488) GN=DHFR PE=3 SV=1 6 220 7.0E-27
sp|P00378|DYR_CHICK Dihydrofolate reductase OS=Gallus gallus GN=DHFR PE=1 SV=1 6 222 8.0E-27
sp|P00376|DYR_BOVIN Dihydrofolate reductase OS=Bos taurus GN=DHFR PE=1 SV=3 6 222 4.0E-26
sp|P27421|DYR_SHV24 Viral dihydrofolate reductase OS=Saimiriine herpesvirus 2 (strain 484-77) GN=DHFR PE=3 SV=1 6 222 6.0E-26
sp|P09503|DYR_SHV21 Viral dihydrofolate reductase OS=Saimiriine herpesvirus 2 (strain 11) GN=DHFR PE=3 SV=1 6 222 6.0E-26
sp|P28019|DYR_AEDAL Dihydrofolate reductase OS=Aedes albopictus GN=DHFR PE=3 SV=1 5 220 6.0E-25
sp|Q07422|DRTS_TOXGO Bifunctional dihydrofolate reductase-thymidylate synthase OS=Toxoplasma gondii PE=1 SV=1 1 191 4.0E-23
sp|P17719|DYR_DROME Dihydrofolate reductase OS=Drosophila melanogaster GN=Dhfr PE=1 SV=3 6 220 6.0E-23
sp|Q86XF0|DYRL1_HUMAN Dihydrofolate reductase, mitochondrial OS=Homo sapiens GN=DHFRL1 PE=1 SV=1 6 223 6.0E-23
sp|Q93341|DYR_CAEEL Putative dihydrofolate reductase OS=Caenorhabditis elegans GN=dhfr-1 PE=3 SV=1 5 223 3.0E-22
sp|P51820|DRTS_SOYBN Bifunctional dihydrofolate reductase-thymidylate synthase OS=Glycine max PE=1 SV=1 8 177 1.0E-21
sp|Q27783|DRTS_TRYBB Bifunctional dihydrofolate reductase-thymidylate synthase OS=Trypanosoma brucei brucei PE=1 SV=1 6 217 1.0E-21
sp|P45350|DRTS_DAUCA Bifunctional dihydrofolate reductase-thymidylate synthase OS=Daucus carota PE=2 SV=1 8 178 4.0E-21
sp|Q05762|DRTS1_ARATH Bifunctional dihydrofolate reductase-thymidylate synthase 1 OS=Arabidopsis thaliana GN=THY-1 PE=1 SV=2 8 177 4.0E-21
sp|Q05763|DRTS2_ARATH Bifunctional dihydrofolate reductase-thymidylate synthase 2 OS=Arabidopsis thaliana GN=THY-2 PE=2 SV=2 8 177 2.0E-20
sp|O81395|DRTS_MAIZE Bifunctional dihydrofolate reductase-thymidylate synthase OS=Zea mays GN=DRTS PE=2 SV=1 8 177 1.0E-19
sp|P13922|DRTS_PLAFK Bifunctional dihydrofolate reductase-thymidylate synthase OS=Plasmodium falciparum (isolate K1 / Thailand) PE=1 SV=2 17 177 1.0E-17
sp|Q2HRC6|DYR_HHV8P Putative Dihydrofolate reductase OS=Human herpesvirus 8 type P (isolate GK18) GN=ORF2 PE=3 SV=1 4 219 1.0E-17
sp|Q2QRX6|DRTS_ORYSJ Putative bifunctional dihydrofolate reductase-thymidylate synthase OS=Oryza sativa subsp. japonica GN=Os12g0446900 PE=3 SV=2 16 177 1.0E-17
sp|P20712|DRTS_PLACH Bifunctional dihydrofolate reductase-thymidylate synthase OS=Plasmodium chabaudi PE=3 SV=1 17 177 3.0E-17
sp|Q27713|DRTS_PLABA Bifunctional dihydrofolate reductase-thymidylate synthase OS=Plasmodium berghei (strain Anka) PE=3 SV=1 17 177 3.0E-17
sp|O62583|DYR_ENCCU Dihydrofolate reductase OS=Encephalitozoon cuniculi (strain GB-M1) GN=DHFR-1 PE=3 SV=1 6 177 6.0E-17
sp|P07807|DYR_YEAST Dihydrofolate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DFR1 PE=1 SV=2 4 156 1.0E-16
sp|Q27793|DRTS_TRYCR Bifunctional dihydrofolate reductase-thymidylate synthase OS=Trypanosoma cruzi PE=1 SV=2 6 203 3.0E-16
sp|P46103|DRTS_PLAVN Bifunctional dihydrofolate reductase-thymidylate synthase (Fragment) OS=Plasmodium vinckei PE=3 SV=1 17 170 9.0E-15
sp|O02604|DRTS_PLAVI Bifunctional dihydrofolate reductase-thymidylate synthase OS=Plasmodium vivax PE=1 SV=2 17 177 1.0E-14
sp|Q5UQG3|DRTS_MIMIV Bifunctional dihydrofolate reductase-thymidylate synthase OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R497 PE=3 SV=1 9 179 2.0E-12
sp|P07382|DRTS_LEIMA Bifunctional dihydrofolate reductase-thymidylate synthase OS=Leishmania major GN=LmjF06.0860 PE=1 SV=1 6 203 6.0E-12
sp|P16126|DRTS_LEIAM Bifunctional dihydrofolate reductase-thymidylate synthase OS=Leishmania amazonensis PE=3 SV=1 6 178 2.0E-10
sp|Q23695|DRTS_CRIFA Bifunctional dihydrofolate reductase-thymidylate synthase OS=Crithidia fasciculata PE=3 SV=1 6 176 2.0E-10
sp|P11045|DYR_BACSU Dihydrofolate reductase OS=Bacillus subtilis (strain 168) GN=dfrA PE=1 SV=2 6 220 6.0E-10
sp|P0ABQ6|DYR_SHIFL Dihydrofolate reductase OS=Shigella flexneri GN=folA PE=3 SV=1 6 177 2.0E-09
sp|P0ABQ4|DYR_ECOLI Dihydrofolate reductase OS=Escherichia coli (strain K12) GN=folA PE=1 SV=1 6 177 2.0E-09
sp|P0ABQ5|DYR_ECOL6 Dihydrofolate reductase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=folA PE=3 SV=1 6 177 2.0E-09
sp|P9WNX1|DYR_MYCTU Dihydrofolate reductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=folA PE=1 SV=2 74 152 3.0E-09
sp|P9WNX0|DYR_MYCTO Dihydrofolate reductase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=folA PE=3 SV=2 74 152 3.0E-09
sp|P0A547|DYR_MYCBO Dihydrofolate reductase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=folA PE=3 SV=2 74 152 3.0E-09
sp|P31073|DYR_CITFR Dihydrofolate reductase OS=Citrobacter freundii GN=folA PE=3 SV=1 6 177 5.0E-09
sp|P04174|DYR_NEIGO Dihydrofolate reductase OS=Neisseria gonorrhoeae GN=folA PE=1 SV=1 5 177 5.0E-08
sp|P31074|DYR_ENTAE Dihydrofolate reductase OS=Enterobacter aerogenes GN=folA PE=3 SV=1 6 177 5.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0004146 dihydrofolate reductase activity Yes
GO:0046654 tetrahydrofolate biosynthetic process Yes
GO:0016645 oxidoreductase activity, acting on the CH-NH group of donors No
GO:0042398 cellular modified amino acid biosynthetic process No
GO:0042558 pteridine-containing compound metabolic process No
GO:0042559 pteridine-containing compound biosynthetic process No
GO:0006760 folic acid-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0003674 molecular_function No
GO:0046653 tetrahydrofolate metabolic process No
GO:0016646 oxidoreductase activity, acting on the CH-NH group of donors, NAD or NADP as acceptor No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:0016491 oxidoreductase activity No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006575 cellular modified amino acid metabolic process No
GO:0009396 folic acid-containing compound biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup502
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1476
Ophiocordyceps australis map64 (Brazil) OphauB2|4097
Ophiocordyceps camponoti-floridani Ophcf2|04483
Ophiocordyceps camponoti-rufipedis Ophun1|967 (this protein)
Ophiocordyceps kimflemingae Ophio5|1590
Ophiocordyceps subramaniannii Hirsu2|1473

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|967
MQPPELTLIVAATRSMGIGAQGSLPWTGLRKELQYFARVTSRLPPQVGPRSPPSSSIHASHTYEMRQPPPGAINA
VIMGRNTWDSIPPKFRPLKNRLNIVLTRSAPPLDDGNFPPDPLQPVRVSSFDDALRCAARHSPRVFVIGGAQVYD
AAWRCSSARRVLLTLIERDFDCDTFFPITLPGAPGWVRKSSDELRRWTGEDTESVDHEENGIKYEFQMWEASE*
Coding >Ophun1|967
ATGCAACCTCCCGAGCTGACACTCATCGTCGCAGCAACCCGCTCCATGGGCATCGGCGCCCAAGGCTCCCTCCCC
TGGACCGGCCTGCGCAAGGAGCTGCAATACTTTGCCCGCGTCACCTCCCGATTGCCGCCACAGGTTGGGCCCCGA
AGCCCTCCCTCCTCTTCTATACACGCGAGTCATACTTACGAGATGCGCCAGCCACCGCCCGGAGCCATCAACGCC
GTCATAATGGGCCGCAACACCTGGGACTCCATCCCGCCCAAGTTTCGCCCGCTTAAGAACCGTCTCAACATCGTC
CTCACCCGTTCCGCGCCTCCGCTGGATGACGGCAACTTCCCGCCCGATCCCCTTCAGCCCGTGCGCGTGTCCTCG
TTCGACGATGCTCTCCGCTGCGCTGCCCGTCATAGCCCCCGCGTGTTCGTCATCGGTGGCGCTCAAGTTTACGAC
GCTGCCTGGCGCTGTTCGTCGGCGCGCCGCGTGCTGCTCACCCTCATCGAGCGCGACTTCGATTGCGATACCTTC
TTTCCCATCACCCTGCCCGGTGCCCCTGGCTGGGTCCGCAAGTCCTCTGACGAGCTGCGACGCTGGACCGGCGAG
GACACCGAGTCTGTCGATCACGAGGAGAACGGCATCAAGTACGAATTCCAGATGTGGGAGGCCTCCGAGTGA
Transcript >Ophun1|967
ATGCAACCTCCCGAGCTGACACTCATCGTCGCAGCAACCCGCTCCATGGGCATCGGCGCCCAAGGCTCCCTCCCC
TGGACCGGCCTGCGCAAGGAGCTGCAATACTTTGCCCGCGTCACCTCCCGATTGCCGCCACAGGTTGGGCCCCGA
AGCCCTCCCTCCTCTTCTATACACGCGAGTCATACTTACGAGATGCGCCAGCCACCGCCCGGAGCCATCAACGCC
GTCATAATGGGCCGCAACACCTGGGACTCCATCCCGCCCAAGTTTCGCCCGCTTAAGAACCGTCTCAACATCGTC
CTCACCCGTTCCGCGCCTCCGCTGGATGACGGCAACTTCCCGCCCGATCCCCTTCAGCCCGTGCGCGTGTCCTCG
TTCGACGATGCTCTCCGCTGCGCTGCCCGTCATAGCCCCCGCGTGTTCGTCATCGGTGGCGCTCAAGTTTACGAC
GCTGCCTGGCGCTGTTCGTCGGCGCGCCGCGTGCTGCTCACCCTCATCGAGCGCGACTTCGATTGCGATACCTTC
TTTCCCATCACCCTGCCCGGTGCCCCTGGCTGGGTCCGCAAGTCCTCTGACGAGCTGCGACGCTGGACCGGCGAG
GACACCGAGTCTGTCGATCACGAGGAGAACGGCATCAAGTACGAATTCCAGATGTGGGAGGCCTCCGAGTGA
Gene >Ophun1|967
ATGCAACCTCCCGAGCTGACACTCATCGTCGCAGCAACCCGCTCCATGGGCATCGGCGCCCAAGGCTCCCTCCCC
TGGACCGGCCTGCGCAAGGAGCTGCAATACTTTGCCCGCGTCACCTCCCGATTGCCGCCACAGGTTGGGCCCCGA
AGCCCTCCCTCCTCTTCTATACACGCGAGTCATACTTACGAGATGCGCCAGCCACCGCCCGGAGCCATCAACGCC
GTCATAATGGGCCGCAACACCTGGGACTCCATCCCGCCCAAGTTTCGCCCGCTTAAGAACCGTCTCAACATCGTC
CTCACCCGTTCCGCGCCTCCGCTGGATGACGGCAACTTCCCGCCCGATCCCCTTCAGCCCGTGCGCGTGTCCTCG
TTCGACGATGCTCTCCGCTGCGCTGCCCGTCATAGCCCCCGCGTGTTCGTCATCGGTGGCGCTCAAGTTTACGAC
GCTGCCTGGCGCTGTTCGTCGGCGCGCCGCGTGCTGCTCACCCTCATCGAGCGCGACTTCGATTGCGATACCTTC
TTTCCCATCACCCTGCCCGGTGCCCCTGGCTGGGTCCGCAAGTCCTCTGACGAGCTGCGACGCTGGACCGGCGAG
GACACCGAGTCTGTCGATCACGAGGAGAACGGCATCAAGTACGAATTCCAGATGTGGGAGGCCTCCGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail