Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|962
Gene name
LocationContig_1344:75..1808
Strand+
Gene length (bp)1733
Transcript length (bp)1491
Coding sequence length (bp)1491
Protein length (aa) 497

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02353 CMAS Mycolic acid cyclopropane synthetase 2.5E-62 170 447
PF08241 Methyltransf_11 Methyltransferase domain 6.1E-11 237 337
PF13649 Methyltransf_25 Methyltransferase domain 5.5E-10 237 334
PF13489 Methyltransf_23 Methyltransferase domain 1.1E-09 219 347

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C4R7Z3|C9MT_PICPG Sphingolipid C9-methyltransferase OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAS_chr4_0465 PE=1 SV=1 12 474 0.0E+00
sp|I1RNL0|C9MT2_GIBZE Sphingolipid C9-methyltransferase 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MT2 PE=3 SV=1 7 495 0.0E+00
sp|Q5APD4|C9MT_CANAL Sphingolipid C9-methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MTS1 PE=1 SV=1 13 474 0.0E+00
sp|I1RJD6|C9MT1_GIBZE Sphingolipid C9-methyltransferase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MT1 PE=3 SV=1 7 468 0.0E+00
sp|O69687|FAMT_MYCTU Probable fatty acid methyltransferase Rv3720 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3720 PE=1 SV=4 167 451 4.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C4R7Z3|C9MT_PICPG Sphingolipid C9-methyltransferase OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAS_chr4_0465 PE=1 SV=1 12 474 0.0E+00
sp|I1RNL0|C9MT2_GIBZE Sphingolipid C9-methyltransferase 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MT2 PE=3 SV=1 7 495 0.0E+00
sp|Q5APD4|C9MT_CANAL Sphingolipid C9-methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MTS1 PE=1 SV=1 13 474 0.0E+00
sp|I1RJD6|C9MT1_GIBZE Sphingolipid C9-methyltransferase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MT1 PE=3 SV=1 7 468 0.0E+00
sp|O69687|FAMT_MYCTU Probable fatty acid methyltransferase Rv3720 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3720 PE=1 SV=4 167 451 4.0E-39
sp|P31049|FAMT_PSEPU Probable fatty acid methyltransferase OS=Pseudomonas putida PE=3 SV=1 164 458 2.0E-36
sp|P0A9H7|CFA_ECOLI Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli (strain K12) GN=cfa PE=1 SV=2 179 459 6.0E-33
sp|P0A9H8|CFA_ECOL6 Cyclopropane-fatty-acyl-phospholipid synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cfa PE=3 SV=2 179 459 6.0E-33
sp|P0CH91|MMAA3_MYCTU Methoxy mycolic acid synthase MmaA3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmaA3 PE=1 SV=1 176 451 2.0E-28
sp|A5U028|MMAA3_MYCTA Methoxy mycolic acid synthase MmaA3 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA3 PE=1 SV=1 176 451 2.0E-28
sp|Q7U1K0|MMAA3_MYCBO Methoxy mycolic acid synthase MmaA3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaB PE=1 SV=1 176 451 2.0E-28
sp|Q6MX39|UMAA_MYCTU S-adenosylmethionine-dependent methyltransferase UmaA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=umaA PE=1 SV=1 176 451 1.0E-25
sp|P9WPB1|MMAA1_MYCTU Mycolic acid methyltransferase MmaA1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmaA1 PE=1 SV=1 176 451 1.0E-25
sp|P9WPB0|MMAA1_MYCTO Mycolic acid methyltransferase MmaA1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mmaA1 PE=3 SV=1 176 451 1.0E-25
sp|A5U030|MMAA1_MYCTA Mycolic acid methyltransferase MmaA1 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA1 PE=1 SV=1 176 451 1.0E-25
sp|P0A5Q1|MMAA1_MYCBO Mycolic acid methyltransferase MmaA1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaD PE=3 SV=1 176 451 1.0E-25
sp|O53732|UFAA1_MYCTU Tuberculostearic acid methyltransferase UfaA1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ufaA1 PE=1 SV=3 169 452 2.0E-24
sp|Q79FX8|MMAA4_MYCTU Hydroxymycolate synthase MmaA4 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmaA4 PE=1 SV=1 176 429 6.0E-24
sp|A5U027|MMAA4_MYCTA Hydroxymycolate synthase MmaA4 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA4 PE=1 SV=1 176 429 6.0E-24
sp|Q79FX6|MMAA2_MYCTU Cyclopropane mycolic acid synthase MmaA2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmaA2 PE=1 SV=1 176 451 2.0E-23
sp|A5U029|MMAA2_MYCTA Cyclopropane mycolic acid synthase MmaA2 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mmaA2 PE=1 SV=1 176 451 2.0E-23
sp|Q7U1K1|MMAA4_MYCBO Hydroxymycolate synthase MmaA4 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaA PE=1 SV=1 176 429 2.0E-23
sp|P9WPB5|CMAS2_MYCTU Cyclopropane mycolic acid synthase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cmaA2 PE=1 SV=1 176 451 4.0E-23
sp|P9WPB4|CMAS2_MYCTO Cyclopropane mycolic acid synthase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cmaA2 PE=3 SV=1 176 451 4.0E-23
sp|P0A5P1|CMAS2_MYCBO Cyclopropane mycolic acid synthase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaA2 PE=3 SV=1 176 451 4.0E-23
sp|Q7U1J9|MMAA2_MYCBO Cyclopropane mycolic acid synthase MmaA2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cmaC PE=1 SV=1 176 451 5.0E-23
sp|Q49807|CMAS2_MYCLE Cyclopropane mycolic acid synthase 2 OS=Mycobacterium leprae (strain TN) GN=cmaA2 PE=3 SV=1 176 451 1.0E-22
sp|P9WPB3|CMAS3_MYCTU Cyclopropane mycolic acid synthase 3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pcaA PE=1 SV=1 178 451 9.0E-22
sp|P9WPB2|CMAS3_MYCTO Cyclopropane mycolic acid synthase 3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pcaA PE=3 SV=1 178 451 9.0E-22
sp|A5U866|CMAS1_MYCTA Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=cmaA1 PE=1 SV=1 178 447 3.0E-21
sp|P9WPB7|CMAS1_MYCTU Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cmaA1 PE=1 SV=1 178 447 3.0E-21
sp|P9WPB6|CMAS1_MYCTO Cyclopropane mycolic acid synthase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cmaA1 PE=3 SV=1 178 447 8.0E-21
sp|Q5C9L6|CNMT_THLFG (S)-coclaurine N-methyltransferase OS=Thalictrum flavum subsp. glaucum PE=1 SV=1 208 418 5.0E-11
sp|B2I023|UBIG_ACIBC Ubiquinone biosynthesis O-methyltransferase OS=Acinetobacter baumannii (strain ACICU) GN=ubiG PE=3 SV=1 213 314 2.0E-10
sp|B0VMN8|UBIG_ACIBS Ubiquinone biosynthesis O-methyltransferase OS=Acinetobacter baumannii (strain SDF) GN=ubiG PE=3 SV=1 213 314 3.0E-10
sp|B0V5X4|UBIG_ACIBY Ubiquinone biosynthesis O-methyltransferase OS=Acinetobacter baumannii (strain AYE) GN=ubiG PE=3 SV=1 213 314 3.0E-10
sp|B7IBN2|UBIG_ACIB5 Ubiquinone biosynthesis O-methyltransferase OS=Acinetobacter baumannii (strain AB0057) GN=ubiG PE=3 SV=1 213 314 3.0E-10
sp|B7H2Y9|UBIG_ACIB3 Ubiquinone biosynthesis O-methyltransferase OS=Acinetobacter baumannii (strain AB307-0294) GN=ubiG PE=3 SV=1 213 314 3.0E-10
sp|Q6FFY1|UBIG_ACIAD Ubiquinone biosynthesis O-methyltransferase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=ubiG PE=3 SV=1 213 314 2.0E-09
sp|Q4K8M4|UBIG_PSEF5 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=ubiG PE=3 SV=1 208 349 1.0E-07
sp|Q02PX7|UBIG_PSEAB Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ubiG PE=3 SV=1 208 314 1.0E-07
sp|Q9HZ63|UBIG_PSEAE Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ubiG PE=3 SV=1 208 314 1.0E-07
sp|B7V9J5|UBIG_PSEA8 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas aeruginosa (strain LESB58) GN=ubiG PE=3 SV=1 208 314 1.0E-07
sp|C3SBW0|PNMT_THLFG Pavine N-methyltransferase OS=Thalictrum flavum subsp. glaucum PE=1 SV=1 188 365 2.0E-07
sp|B1J5G4|UBIG_PSEPW Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas putida (strain W619) GN=ubiG PE=3 SV=1 208 349 3.0E-07
sp|Q8KZ94|REBMT_NOCAE Demethylrebeccamycin-D-glucose O-methyltransferase OS=Lechevalieria aerocolonigenes GN=rebM PE=1 SV=1 176 314 3.0E-07
sp|Q1IDA6|UBIG_PSEE4 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas entomophila (strain L48) GN=ubiG PE=3 SV=1 208 349 3.0E-07
sp|Q7NZ91|UBIG_CHRVO Ubiquinone biosynthesis O-methyltransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=ubiG PE=3 SV=1 232 314 4.0E-07
sp|A6V2Q4|UBIG_PSEA7 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas aeruginosa (strain PA7) GN=ubiG PE=3 SV=1 208 413 5.0E-07
sp|Q885T9|UBIG_PSESM Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ubiG PE=3 SV=2 208 349 6.0E-07
sp|Q3K8T6|UBIG_PSEPF Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas fluorescens (strain Pf0-1) GN=ubiG PE=3 SV=1 208 349 7.0E-07
sp|Q759S7|ERG6_ASHGO Sterol 24-C-methyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERG6 PE=3 SV=1 224 336 9.0E-07
sp|Q96WX4|ERG6_PNECA Sterol 24-C-methyltransferase OS=Pneumocystis carinii GN=erg6 PE=2 SV=1 178 404 1.0E-06
sp|Q7XB08|CNMT_PAPSO (S)-coclaurine N-methyltransferase OS=Papaver somniferum GN=CNMT PE=1 SV=1 194 410 1.0E-06
sp|L7IP31|ERG6_MAGOY Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain Y34) GN=ERG6 PE=2 SV=1 224 338 2.0E-06
sp|P0CT10|ERG6_MAGO7 Sterol 24-C-methyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ERG6 PE=3 SV=1 224 338 2.0E-06
sp|Q88M10|UBIG_PSEPK Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas putida (strain KT2440) GN=ubiG PE=3 SV=1 226 349 2.0E-06
sp|A5W7G3|UBIG_PSEP1 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ubiG PE=3 SV=1 226 349 2.0E-06
sp|Q9LM02|SMT1_ARATH Cycloartenol-C-24-methyltransferase OS=Arabidopsis thaliana GN=SMT1 PE=1 SV=1 176 336 4.0E-06
sp|Q2L2T5|UBIG_BORA1 Ubiquinone biosynthesis O-methyltransferase OS=Bordetella avium (strain 197N) GN=ubiG PE=3 SV=1 213 314 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0016741 transferase activity, transferring one-carbon groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 33 52 19
2 57 79 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|962
MTSAAFAPPRFYPAIKNGPLPADGPGSDSFNNTAFFALLGGVPLYLAWKVGGGLKTFLFFALLADIPLLVAWWLA
ISAISPRRNEKAKLPGRPVEFYLDFKKEADRAKYRGSNKIPLETFHEMYFDGHVDFKGDCLDVMEYRHDWASFRF
TIGLIRFFLLGMIPELIMHTRSQDEEQVRDHYDRGDDFYGWFLGPRMIYTSGIISDINKEESLEQLQDNKLAIVC
EKIGLKSGEKMLDIGCGWGTLARFASENYGARVTGITLGRNQTAWGNSAMRKAGVPQEQSNILCMDYRDIPVPEG
GYEKITCLEMAEHVGVRHFSGFLTQVYNMLDDDGVFFLQIAGLRKPWQYEDLIWGLFMNKYVFPGADASTPLGWV
VDKLEGAGFEIKGIDTIGVHYSATLWRWYRNWMANRERVEAKYGKRWFRIWEYFLAYSTIAARQGTATCFQITLV
KNINSTHRIEGIDTQFSLSGALEKCKVNLQAWAAKNKVTSSTEYLS*
Coding >Ophun1|962
ATGACGAGTGCGGCGTTCGCACCACCAAGGTTCTATCCCGCCATCAAGAATGGCCCCCTTCCCGCCGACGGCCCC
GGCTCCGACTCGTTCAACAACACGGCCTTCTTCGCCCTCCTCGGCGGCGTCCCCCTCTATCTCGCCTGGAAGGTC
GGAGGCGGTCTCAAGACCTTCCTCTTCTTCGCCCTCTTGGCCGACATCCCCCTCCTCGTTGCCTGGTGGCTCGCC
ATCTCCGCCATTAGCCCCCGCCGCAATGAAAAGGCTAAACTTCCGGGCCGTCCCGTCGAGTTCTACCTAGACTTC
AAGAAGGAGGCCGACCGTGCCAAGTACCGCGGCTCCAACAAGATTCCCTTGGAGACCTTTCACGAGATGTACTTT
GACGGCCATGTCGACTTCAAGGGCGATTGCCTCGATGTCATGGAGTATCGCCACGACTGGGCCAGCTTCCGCTTC
ACCATTGGCCTCATCAGGTTCTTCCTCCTCGGCATGATTCCCGAGCTCATCATGCACACCCGCTCCCAAGACGAG
GAGCAGGTCCGCGACCACTACGACCGCGGTGACGACTTTTACGGCTGGTTCCTCGGCCCTCGCATGATTTACACC
TCGGGCATCATCTCCGACATCAACAAGGAGGAGTCGCTGGAGCAGCTGCAGGACAACAAGCTGGCCATTGTCTGC
GAAAAGATTGGTCTCAAGTCGGGCGAGAAGATGCTCGACATTGGCTGCGGCTGGGGCACGCTGGCCCGCTTCGCC
AGCGAAAACTACGGCGCGCGCGTCACGGGCATCACCCTCGGCCGCAACCAGACGGCCTGGGGCAACAGCGCCATG
CGCAAGGCGGGCGTGCCCCAAGAGCAGAGCAATATTCTGTGCATGGACTACCGCGACATTCCCGTGCCCGAGGGC
GGCTACGAAAAGATTACCTGCCTCGAGATGGCGGAGCACGTCGGCGTCCGTCACTTTTCCGGCTTCCTCACGCAG
GTCTACAACATGCTCGACGACGACGGTGTCTTTTTCTTGCAGATTGCCGGCCTGCGCAAGCCGTGGCAGTACGAG
GATCTCATCTGGGGCCTGTTCATGAACAAGTACGTCTTCCCGGGCGCCGACGCGTCGACGCCGCTCGGCTGGGTC
GTGGACAAGCTCGAGGGCGCCGGTTTCGAGATCAAGGGCATCGACACCATCGGGGTGCATTACTCGGCCACGCTG
TGGCGTTGGTACCGCAACTGGATGGCCAACCGCGAGAGGGTCGAGGCCAAGTACGGCAAGCGCTGGTTCAGAATC
TGGGAATACTTTCTCGCCTACTCGACCATTGCGGCGCGGCAGGGGACGGCCACGTGCTTCCAGATTACGCTGGTC
AAGAACATCAACTCGACGCACCGCATTGAAGGCATTGACACGCAGTTTAGCCTTTCGGGGGCGCTCGAGAAGTGC
AAGGTCAACCTGCAGGCGTGGGCGGCCAAGAACAAGGTGACGTCTTCGACCGAGTATCTGTCGTGA
Transcript >Ophun1|962
ATGACGAGTGCGGCGTTCGCACCACCAAGGTTCTATCCCGCCATCAAGAATGGCCCCCTTCCCGCCGACGGCCCC
GGCTCCGACTCGTTCAACAACACGGCCTTCTTCGCCCTCCTCGGCGGCGTCCCCCTCTATCTCGCCTGGAAGGTC
GGAGGCGGTCTCAAGACCTTCCTCTTCTTCGCCCTCTTGGCCGACATCCCCCTCCTCGTTGCCTGGTGGCTCGCC
ATCTCCGCCATTAGCCCCCGCCGCAATGAAAAGGCTAAACTTCCGGGCCGTCCCGTCGAGTTCTACCTAGACTTC
AAGAAGGAGGCCGACCGTGCCAAGTACCGCGGCTCCAACAAGATTCCCTTGGAGACCTTTCACGAGATGTACTTT
GACGGCCATGTCGACTTCAAGGGCGATTGCCTCGATGTCATGGAGTATCGCCACGACTGGGCCAGCTTCCGCTTC
ACCATTGGCCTCATCAGGTTCTTCCTCCTCGGCATGATTCCCGAGCTCATCATGCACACCCGCTCCCAAGACGAG
GAGCAGGTCCGCGACCACTACGACCGCGGTGACGACTTTTACGGCTGGTTCCTCGGCCCTCGCATGATTTACACC
TCGGGCATCATCTCCGACATCAACAAGGAGGAGTCGCTGGAGCAGCTGCAGGACAACAAGCTGGCCATTGTCTGC
GAAAAGATTGGTCTCAAGTCGGGCGAGAAGATGCTCGACATTGGCTGCGGCTGGGGCACGCTGGCCCGCTTCGCC
AGCGAAAACTACGGCGCGCGCGTCACGGGCATCACCCTCGGCCGCAACCAGACGGCCTGGGGCAACAGCGCCATG
CGCAAGGCGGGCGTGCCCCAAGAGCAGAGCAATATTCTGTGCATGGACTACCGCGACATTCCCGTGCCCGAGGGC
GGCTACGAAAAGATTACCTGCCTCGAGATGGCGGAGCACGTCGGCGTCCGTCACTTTTCCGGCTTCCTCACGCAG
GTCTACAACATGCTCGACGACGACGGTGTCTTTTTCTTGCAGATTGCCGGCCTGCGCAAGCCGTGGCAGTACGAG
GATCTCATCTGGGGCCTGTTCATGAACAAGTACGTCTTCCCGGGCGCCGACGCGTCGACGCCGCTCGGCTGGGTC
GTGGACAAGCTCGAGGGCGCCGGTTTCGAGATCAAGGGCATCGACACCATCGGGGTGCATTACTCGGCCACGCTG
TGGCGTTGGTACCGCAACTGGATGGCCAACCGCGAGAGGGTCGAGGCCAAGTACGGCAAGCGCTGGTTCAGAATC
TGGGAATACTTTCTCGCCTACTCGACCATTGCGGCGCGGCAGGGGACGGCCACGTGCTTCCAGATTACGCTGGTC
AAGAACATCAACTCGACGCACCGCATTGAAGGCATTGACACGCAGTTTAGCCTTTCGGGGGCGCTCGAGAAGTGC
AAGGTCAACCTGCAGGCGTGGGCGGCCAAGAACAAGGTGACGTCTTCGACCGAGTATCTGTCGTGA
Gene >Ophun1|962
ATGACGAGTGCGGCGTTCGCACCACCAAGGTTCGTTTGCCTGGTCTCCTGTTGCTCTCTGTTCTCGTCGTCTTCC
TTCTCTCCTCCTCCTCCTCCTCCTCCTCCTCCTCCTATCCCTCTTCTCTCTCCCCCTCCTCCCCCCCCTACTCCC
TCCTCACACTAACCTCCTCCAGTATCCCGCCATCAAGAATGGCCCCCTTCCCGCCGACGGCCCCGGCTCCGACTC
GTTCAACAACACGGCCTTCTTCGCCCTCCTCGGCGGCGTCCCCCTCTATCTCGCCTGGAAGGTCGGAGGCGGTCT
CAAGACCTTCCTCTTCTTCGCCCTCTTGGCCGACATCCCCCTCCTCGTTGCCTGGTGGCTCGCCATCTCCGCCAT
TAGCCCCCGCCGCAATGAAAAGGCTAAACTTCCGGGCCGTCCCGTCGAGTTCTACCTAGACTTCAAGAAGGAGGC
CGACCGTGCCAAGTACCGCGGCTCCAACAAGATTCCCTTGGAGACCTTTCACGAGATGTACTTTGACGGCCATGT
CGACTTCAAGGGCGATTGCCTCGATGTCATGGAGTATCGCCACGACTGGGCCAGCTTCCGCTTCACCATTGGCCT
CATCAGGTTCTTCCTCCTCGGCATGATTCCCGAGCTCATCATGCACACCCGCTCCCAAGGTATGTACTCCTCTTT
GGTGCTTCGACGCCTAGCCAACCCGCGACGCCAGACGAGGAGCAGGTCCGCGACCACTACGACCGCGGTGACGAC
TTTTACGGCTGGTTCCTCGGCCCTCGCATGATTTACACCTCGGGCATCATCTCCGACATCAACAAGGAGGAGTCG
CTGGAGCAGCTGCAGGACAACAAGCTGGCCATTGTCTGCGAAAAGATTGGTCTCAAGTCGGGCGAGAAGATGCTC
GACATTGGCTGCGGCTGGGGCACGCTGGCCCGCTTCGCCAGCGAAAACTACGGCGCGCGCGTCACGGGCATCACC
CTCGGCCGCAACCAGACGGCCTGGGGCAACAGCGCCATGCGCAAGGCGGGCGTGCCCCAAGAGCAGAGCAATATT
CTGTGCATGGACTACCGCGACATTCCCGTGCCCGAGGGCGGCTACGAAAAGATTACCTGCCTCGAGATGGCGGAG
CACGTCGGCGTCCGTCACTTTTCCGGCTTCCTCACGCAGGTCTACAACATGCTCGACGACGACGGTGTCTTTTTC
TTGCAGATTGCCGGCCTGCGCAAGCCGTGGCAGTACGAGGATCTCATCTGGGGCCTGTTCATGAACAAGTACGTC
TTCCCGGGCGCCGACGCGTCGACGCCGCTCGGCTGGGTCGTGGACAAGCTCGAGGGCGCCGGTTTCGAGATCAAG
GGCATCGACACCATCGGGGTGCATTACTCGGCCACGCTGTGGCGTTGGTACCGCAACTGGATGGCCAACCGCGAG
AGGGTCGAGGCCAAGTACGGCAAGCGCTGGTTCAGAGTGAGTCTCGATCTCTGTGTGCATCTCGTGTCTGGCAGC
TGACGTCAAGGCAGATCTGGGAATACTTTCTCGCCTACTCGACCATTGCGGCGCGGCAGGGGACGGCCACGTGCT
TCCAGATTACGCTGGTCAAGAACATCAACTCGACGCACCGCATTGAAGGCATTGACACGCAGTTTAGCCTTTCGG
GGGCGCTCGAGAAGTGCAAGGTCAACCTGCAGGCGTGGGCGGCCAAGAACAAGGTGACGTCTTCGACCGAGTATC
TGTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail