Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|960
Gene name
LocationContig_1340:30..2396
Strand-
Gene length (bp)2366
Transcript length (bp)1620
Coding sequence length (bp)1620
Protein length (aa) 540

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 3.1E-21 345 482
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 1.7E-06 49 137

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 325 518 8.0E-19
sp|B3QM89|METX_CHLP8 Homoserine O-acetyltransferase OS=Chlorobaculum parvum (strain NCIB 8327) GN=metX PE=3 SV=1 4 290 1.0E-14
sp|Q8KES7|METX_CHLTE Homoserine O-acetyltransferase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=metX PE=3 SV=1 12 290 2.0E-14
sp|B3QZ51|METX_CHLT3 Homoserine O-acetyltransferase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=metX PE=3 SV=1 12 296 2.0E-14
sp|Q3M5Q6|METX_ANAVT Homoserine O-acetyltransferase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=metX PE=3 SV=1 12 285 5.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 325 518 8.0E-19
sp|B3QM89|METX_CHLP8 Homoserine O-acetyltransferase OS=Chlorobaculum parvum (strain NCIB 8327) GN=metX PE=3 SV=1 4 290 1.0E-14
sp|Q8KES7|METX_CHLTE Homoserine O-acetyltransferase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=metX PE=3 SV=1 12 290 2.0E-14
sp|B3QZ51|METX_CHLT3 Homoserine O-acetyltransferase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=metX PE=3 SV=1 12 296 2.0E-14
sp|Q3M5Q6|METX_ANAVT Homoserine O-acetyltransferase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=metX PE=3 SV=1 12 285 5.0E-14
sp|A6P6V9|CBDAS_CANSA Cannabidiolic acid synthase OS=Cannabis sativa GN=CBDAS PE=1 SV=1 337 523 6.0E-14
sp|Q98G09|METX_RHILO Homoserine O-acetyltransferase OS=Rhizobium loti (strain MAFF303099) GN=metX PE=3 SV=1 2 309 1.0E-13
sp|A6P6W1|CASL2_CANSA Cannabidiolic acid synthase-like 2 OS=Cannabis sativa GN=CBDAS3 PE=2 SV=1 345 523 4.0E-13
sp|A6P6W0|CASL1_CANSA Cannabidiolic acid synthase-like 1 OS=Cannabis sativa GN=CBDAS2 PE=2 SV=1 345 523 6.0E-13
sp|Q8GTB6|THCAS_CANSA Tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=1 SV=1 345 531 6.0E-13
sp|Q3ARA7|METX_CHLCH Homoserine O-acetyltransferase OS=Chlorobium chlorochromatii (strain CaD3) GN=metX PE=3 SV=1 12 290 7.0E-13
sp|Q796Y5|YGAK_BACSU Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) GN=ygaK PE=3 SV=4 324 528 1.0E-12
sp|B2IY96|METX_NOSP7 Homoserine O-acetyltransferase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=metX PE=3 SV=1 12 285 1.0E-12
sp|Q9FZC7|FOX4_ARATH Flavin-dependent oxidoreductase FOX4 OS=Arabidopsis thaliana GN=FOX4 PE=2 SV=1 347 524 3.0E-12
sp|Q33DQ2|THCAI_CANSA Inactive tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=3 SV=1 345 531 3.0E-12
sp|P30986|RETO_ESCCA Reticuline oxidase OS=Eschscholzia californica GN=BBE1 PE=1 SV=1 297 523 5.0E-12
sp|Q67NS3|METX_SYMTH Homoserine O-acetyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=metX PE=3 SV=1 55 318 1.0E-11
sp|Q9FZC4|FOX1_ARATH Flavin-dependent oxidoreductase FOX1 OS=Arabidopsis thaliana GN=FOX1 PE=2 SV=1 347 524 2.0E-11
sp|Q2RIW8|METX_MOOTA Homoserine O-acetyltransferase OS=Moorella thermoacetica (strain ATCC 39073) GN=metX PE=3 SV=1 14 312 4.0E-11
sp|Q20YI1|METX_RHOPB Homoserine O-acetyltransferase OS=Rhodopseudomonas palustris (strain BisB18) GN=metX PE=3 SV=1 14 309 7.0E-11
sp|Q06736|MET2_SACPS Homoserine O-acetyltransferase OS=Saccharomyces pastorianus GN=MET2 PE=3 SV=1 11 193 7.0E-11
sp|Q4JTI5|METX_CORJK Homoserine O-acetyltransferase OS=Corynebacterium jeikeium (strain K411) GN=metX PE=3 SV=1 37 319 1.0E-10
sp|Q3SV39|METX_NITWN Homoserine O-acetyltransferase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=metX PE=3 SV=1 14 309 3.0E-10
sp|Q54H55|Y8969_DICDI FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum GN=DDB_G0289697 PE=2 SV=1 309 509 3.0E-10
sp|A1AUS2|METX_PELPD Homoserine O-acetyltransferase OS=Pelobacter propionicus (strain DSM 2379) GN=metX PE=3 SV=1 14 153 3.0E-10
sp|O27848|METX_METTH Homoserine O-acetyltransferase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=metX PE=3 SV=1 7 155 4.0E-10
sp|Q47L17|METX_THEFY Homoserine O-acetyltransferase OS=Thermobifida fusca (strain YX) GN=metX PE=3 SV=1 12 136 5.0E-10
sp|Q9FZC6|FOX3_ARATH Flavin-dependent oxidoreductase FOX3 OS=Arabidopsis thaliana GN=FOX3 PE=3 SV=1 316 523 7.0E-10
sp|P08465|MET2_YEAST Homoserine O-acetyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET2 PE=1 SV=2 11 193 1.0E-09
sp|Q4FP51|METX_PELUB Homoserine O-acetyltransferase OS=Pelagibacter ubique (strain HTCC1062) GN=metX PE=3 SV=1 14 338 1.0E-09
sp|Q1QQD3|METX_NITHX Homoserine O-acetyltransferase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=metX PE=3 SV=1 14 309 2.0E-09
sp|Q9FZC5|FOX2_ARATH Flavin-dependent oxidoreductase FOX2 OS=Arabidopsis thaliana GN=FOX2 PE=2 SV=1 316 524 2.0E-09
sp|B5EAS1|METX_GEOBB Homoserine O-acetyltransferase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=metX PE=3 SV=1 11 156 3.0E-09
sp|Q2RP84|METX_RHORT Homoserine O-acetyltransferase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=metX PE=3 SV=1 52 296 3.0E-09
sp|O68640|METX_CORGL Homoserine O-acetyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=metX PE=1 SV=2 9 319 5.0E-09
sp|Q9FZC8|FOX5_ARATH Flavin-dependent oxidoreductase FOX5 OS=Arabidopsis thaliana GN=FOX5 PE=3 SV=1 289 524 7.0E-09
sp|Q2IS70|METX_RHOP2 Homoserine O-acetyltransferase OS=Rhodopseudomonas palustris (strain HaA2) GN=metX PE=3 SV=1 54 309 8.0E-09
sp|Q6ANV2|METX_DESPS Homoserine O-acetyltransferase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=metX PE=3 SV=2 12 327 8.0E-09
sp|B9M4M5|METX_GEODF Homoserine O-acetyltransferase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=metX PE=3 SV=1 11 156 8.0E-09
sp|Q74AC8|METX_GEOSL Homoserine O-acetyltransferase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=metX PE=3 SV=1 11 154 8.0E-09
sp|Q9SVG4|RETOL_ARATH Reticuline oxidase-like protein OS=Arabidopsis thaliana GN=At4g20830 PE=1 SV=2 302 494 9.0E-09
sp|P94535|GLCD_BACSU Glycolate oxidase subunit GlcD OS=Bacillus subtilis (strain 168) GN=glcD PE=3 SV=1 326 517 1.0E-08
sp|Q2YCJ2|METX_NITMU Homoserine O-acetyltransferase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=metX PE=3 SV=1 14 296 1.0E-08
sp|Q7SGY1|ALO_NEUCR Putative D-arabinono-1,4-lactone oxidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alo-1 PE=3 SV=1 345 514 2.0E-08
sp|A5FVN0|METX_ACICJ Homoserine O-acetyltransferase OS=Acidiphilium cryptum (strain JF-5) GN=metX PE=3 SV=1 12 309 2.0E-08
sp|P39058|CEFG_ACRCH Acetyl-CoA--deacetylcephalosporin C acetyltransferase OS=Acremonium chrysogenum GN=CEFG PE=1 SV=1 12 150 2.0E-08
sp|Q4QJY8|METX_HAEI8 Homoserine O-acetyltransferase OS=Haemophilus influenzae (strain 86-028NP) GN=metX PE=3 SV=1 4 322 2.0E-08
sp|O06997|YVDP_BACSU Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) GN=yvdP PE=1 SV=1 327 528 2.0E-08
sp|Q6ADB9|METX_LEIXX Homoserine O-acetyltransferase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=metX PE=3 SV=1 9 290 2.0E-08
sp|Q5NR05|METX_ZYMMO Homoserine O-acetyltransferase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=metX PE=3 SV=1 10 306 3.0E-08
sp|Q4FUR4|METX_PSYA2 Homoserine O-acetyltransferase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=metX PE=3 SV=1 12 155 4.0E-08
sp|O60062|MET2_SCHPO Homoserine O-acetyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=met6 PE=3 SV=1 12 193 4.0E-08
sp|P45131|METX_HAEIN Homoserine O-acetyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=metX PE=1 SV=3 4 322 5.0E-08
sp|Q6NIZ3|METX_CORDI Homoserine O-acetyltransferase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=metX PE=3 SV=1 9 151 5.0E-08
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 318 511 7.0E-08
sp|Q5UY71|METX_HALMA Homoserine O-acetyltransferase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=metX PE=3 SV=1 3 150 7.0E-08
sp|Q3B5A5|METX_CHLL7 Homoserine O-acetyltransferase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=metX PE=3 SV=1 12 186 1.0E-07
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 325 512 1.0E-07
sp|Q6N1G8|METX_RHOPA Homoserine O-acetyltransferase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=metX PE=3 SV=1 54 309 2.0E-07
sp|B1VF43|METX_CORU7 Homoserine O-acetyltransferase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=metX PE=3 SV=1 4 169 2.0E-07
sp|Q39RX3|METX_GEOMG Homoserine O-acetyltransferase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=metX PE=3 SV=1 11 154 3.0E-07
sp|P93479|RETO_PAPSO Reticuline oxidase OS=Papaver somniferum GN=BBE1 PE=2 SV=1 345 523 3.0E-07
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 431 518 6.0E-07
sp|Q0BVW2|METX_GRABC Homoserine O-acetyltransferase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=metX PE=3 SV=1 14 309 7.0E-07
sp|Q0PCD7|AKNOX_STRGJ Aclacinomycin-N/aclacinomycin-A oxidase OS=Streptomyces galilaeus GN=aknOx PE=1 SV=1 337 511 8.0E-07
sp|B3E278|METX_GEOLS Homoserine O-acetyltransferase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=metX PE=3 SV=1 14 154 8.0E-07
sp|P57884|METX_PASMU Homoserine O-acetyltransferase OS=Pasteurella multocida (strain Pm70) GN=metX PE=3 SV=1 12 322 9.0E-07
sp|P12917|MET2_ASCIM Homoserine O-acetyltransferase OS=Ascobolus immersus GN=MET2 PE=3 SV=1 12 159 9.0E-07
sp|Q72R95|METX_LEPIC Homoserine O-acetyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=metX PE=3 SV=1 11 296 1.0E-06
sp|Q8F4I0|METX_LEPIN Homoserine O-acetyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=metX PE=1 SV=1 11 296 1.0E-06
sp|B8GZZ0|METX_CAUCN Homoserine O-acetyltransferase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=metX PE=3 SV=1 12 294 1.0E-06
sp|Q9AAS1|METX_CAUCR Homoserine O-acetyltransferase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=metX PE=3 SV=1 12 294 1.0E-06
sp|Q3IUE8|METX_NATPD Homoserine O-acetyltransferase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=metX PE=3 SV=1 1 298 1.0E-06
sp|Q65U29|METX_MANSM Homoserine O-acetyltransferase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=metX PE=3 SV=2 54 322 2.0E-06
sp|Q9RVZ8|METX_DEIRA Homoserine O-acetyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=metX PE=3 SV=1 12 291 2.0E-06
sp|A1TY14|METX_MARHV Homoserine O-acetyltransferase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=metX PE=3 SV=1 14 323 2.0E-06
sp|A2SLU8|METX_METPP Homoserine O-acetyltransferase OS=Methylibium petroleiphilum (strain PM1) GN=metX PE=3 SV=1 14 296 3.0E-06
sp|A6W3E8|METX_MARMS Homoserine O-acetyltransferase OS=Marinomonas sp. (strain MWYL1) GN=metX PE=3 SV=1 1 309 3.0E-06
sp|B0SQZ8|METX_LEPBP Homoserine O-acetyltransferase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=metX PE=3 SV=1 1 296 4.0E-06
sp|B0SHJ0|METX_LEPBA Homoserine O-acetyltransferase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=metX PE=3 SV=1 1 296 4.0E-06
sp|A1SMU5|METX_NOCSJ Homoserine O-acetyltransferase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=metX PE=3 SV=1 14 155 6.0E-06
sp|A5CQM6|METX_CLAM3 Homoserine O-acetyltransferase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=metX PE=3 SV=1 9 312 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|960
MADYDSYPLGDFTLSSGQVLPSAHLAFKTYGSPSSPCIIYQAYYGGLIADNEWLIGENRALNPGRFFIVIPALFG
NGQSSSPSNTTLRPFPNITIRDNVTAQHRLLTEKLGVHHAHCILGWNMGACVTFQWIAQFPTFADLAVPICGAAR
ARPHNQLCVRGVQAAVLAARGASSTDEAGTWTEEQARVGLRAAATIFPAWLFSPAWYRERKFEGLGFASVEEFLV
GFWEKLLLSKNVEDIMAMTYAWQMADISAQEPYNGRLDLALSAIRTKTLGLPCQTDMIFPLEDSEAEVKGMGEGV
GKCVTFPSIWGHCCLVTNSIPFTTPDDASWPRAAYSYNLRPSYTPKAIAKPTSAAAVAGAIRCGTAAGLRISAKA
GGHGFGGFGLGGEDGHLVIALDDMKDVSLLSDNVTAVVQPGARLRHVATQLYEQGGRAISHGSCLGVGIAGHVLH
GGFGLSSRTHGLALDWLIGAEIVLANGTSLQTSQTQHPDLFWALRGAGSSFGIVTSLTFTTFAAPESVTPFTIDL
DWDGDGPAAVRAVE*
Coding >Ophun1|960
ATGGCAGACTACGACTCCTATCCCCTCGGTGACTTCACCCTCTCGTCCGGCCAGGTCCTCCCCTCAGCACACCTC
GCCTTCAAGACCTACGGCTCGCCCTCAAGCCCCTGCATCATCTACCAAGCCTACTACGGCGGCCTCATCGCCGAC
AACGAATGGCTCATCGGCGAGAACCGTGCTCTCAACCCGGGCCGTTTCTTCATCGTCATCCCCGCGCTGTTCGGG
AACGGCCAGTCTTCCAGCCCTTCCAACACCACCCTCCGTCCCTTTCCAAACATCACCATCAGAGACAACGTCACG
GCTCAGCACAGGCTTCTCACGGAGAAACTGGGCGTCCATCACGCTCACTGCATCCTTGGTTGGAACATGGGCGCG
TGCGTGACCTTCCAATGGATAGCCCAGTTCCCGACCTTTGCAGACTTGGCCGTGCCCATCTGCGGAGCTGCCCGC
GCAAGACCCCACAACCAGCTCTGTGTTCGGGGGGTCCAGGCGGCGGTTCTGGCAGCCAGGGGAGCGTCTTCAACC
GACGAGGCTGGGACGTGGACCGAGGAGCAGGCGAGGGTTGGGCTGCGGGCTGCGGCCACCATCTTCCCCGCCTGG
CTGTTCTCTCCGGCCTGGTACCGGGAGAGGAAGTTTGAGGGGCTGGGGTTTGCGTCGGTGGAGGAGTTTTTGGTG
GGATTTTGGGAGAAGTTGTTGCTGAGCAAGAATGTTGAGGATATCATGGCTATGACATATGCGTGGCAGATGGCG
GATATTTCGGCGCAGGAGCCTTACAATGGCCGTCTTGATCTCGCTCTCTCTGCTATTCGCACCAAGACGCTTGGT
CTTCCGTGTCAGACGGATATGATCTTTCCGCTTGAGGATTCGGAGGCTGAGGTGAAGGGGATGGGGGAAGGGGTG
GGAAAGTGTGTTACGTTTCCATCCATCTGGGGACACTGCTGTCTCGTCACAAACTCCATCCCCTTCACCACCCCC
GACGACGCCTCCTGGCCACGAGCAGCATACTCGTACAACCTCCGACCGAGCTACACGCCCAAAGCCATCGCGAAG
CCCACATCCGCCGCTGCCGTCGCAGGGGCTATCCGCTGTGGCACCGCTGCCGGACTCCGCATCTCTGCAAAGGCG
GGCGGTCATGGCTTTGGGGGGTTCGGCCTCGGCGGTGAGGATGGCCATCTCGTCATTGCGCTGGATGACATGAAA
GATGTCTCTCTTCTTTCTGATAACGTCACGGCTGTGGTTCAGCCTGGGGCTCGGCTTCGGCATGTAGCTACGCAG
TTGTACGAGCAGGGCGGACGAGCCATCTCACATGGTTCCTGTCTCGGCGTCGGGATAGCAGGCCATGTCCTTCAC
GGGGGCTTCGGACTATCATCTCGGACGCACGGTCTTGCGCTGGACTGGTTGATAGGCGCGGAAATAGTGCTCGCA
AACGGAACCAGCCTGCAAACCTCGCAAACCCAACACCCAGACCTCTTCTGGGCCCTCCGCGGCGCAGGCTCCTCC
TTCGGGATAGTAACCTCCCTAACCTTTACCACTTTTGCGGCCCCAGAGTCCGTCACGCCTTTTACCATTGACCTC
GACTGGGATGGCGACGGGCCGGCTGCTGTTCGTGCGGTCGAGTGA
Transcript >Ophun1|960
ATGGCAGACTACGACTCCTATCCCCTCGGTGACTTCACCCTCTCGTCCGGCCAGGTCCTCCCCTCAGCACACCTC
GCCTTCAAGACCTACGGCTCGCCCTCAAGCCCCTGCATCATCTACCAAGCCTACTACGGCGGCCTCATCGCCGAC
AACGAATGGCTCATCGGCGAGAACCGTGCTCTCAACCCGGGCCGTTTCTTCATCGTCATCCCCGCGCTGTTCGGG
AACGGCCAGTCTTCCAGCCCTTCCAACACCACCCTCCGTCCCTTTCCAAACATCACCATCAGAGACAACGTCACG
GCTCAGCACAGGCTTCTCACGGAGAAACTGGGCGTCCATCACGCTCACTGCATCCTTGGTTGGAACATGGGCGCG
TGCGTGACCTTCCAATGGATAGCCCAGTTCCCGACCTTTGCAGACTTGGCCGTGCCCATCTGCGGAGCTGCCCGC
GCAAGACCCCACAACCAGCTCTGTGTTCGGGGGGTCCAGGCGGCGGTTCTGGCAGCCAGGGGAGCGTCTTCAACC
GACGAGGCTGGGACGTGGACCGAGGAGCAGGCGAGGGTTGGGCTGCGGGCTGCGGCCACCATCTTCCCCGCCTGG
CTGTTCTCTCCGGCCTGGTACCGGGAGAGGAAGTTTGAGGGGCTGGGGTTTGCGTCGGTGGAGGAGTTTTTGGTG
GGATTTTGGGAGAAGTTGTTGCTGAGCAAGAATGTTGAGGATATCATGGCTATGACATATGCGTGGCAGATGGCG
GATATTTCGGCGCAGGAGCCTTACAATGGCCGTCTTGATCTCGCTCTCTCTGCTATTCGCACCAAGACGCTTGGT
CTTCCGTGTCAGACGGATATGATCTTTCCGCTTGAGGATTCGGAGGCTGAGGTGAAGGGGATGGGGGAAGGGGTG
GGAAAGTGTGTTACGTTTCCATCCATCTGGGGACACTGCTGTCTCGTCACAAACTCCATCCCCTTCACCACCCCC
GACGACGCCTCCTGGCCACGAGCAGCATACTCGTACAACCTCCGACCGAGCTACACGCCCAAAGCCATCGCGAAG
CCCACATCCGCCGCTGCCGTCGCAGGGGCTATCCGCTGTGGCACCGCTGCCGGACTCCGCATCTCTGCAAAGGCG
GGCGGTCATGGCTTTGGGGGGTTCGGCCTCGGCGGTGAGGATGGCCATCTCGTCATTGCGCTGGATGACATGAAA
GATGTCTCTCTTCTTTCTGATAACGTCACGGCTGTGGTTCAGCCTGGGGCTCGGCTTCGGCATGTAGCTACGCAG
TTGTACGAGCAGGGCGGACGAGCCATCTCACATGGTTCCTGTCTCGGCGTCGGGATAGCAGGCCATGTCCTTCAC
GGGGGCTTCGGACTATCATCTCGGACGCACGGTCTTGCGCTGGACTGGTTGATAGGCGCGGAAATAGTGCTCGCA
AACGGAACCAGCCTGCAAACCTCGCAAACCCAACACCCAGACCTCTTCTGGGCCCTCCGCGGCGCAGGCTCCTCC
TTCGGGATAGTAACCTCCCTAACCTTTACCACTTTTGCGGCCCCAGAGTCCGTCACGCCTTTTACCATTGACCTC
GACTGGGATGGCGACGGGCCGGCTGCTGTTCGTGCGGTCGAGTGA
Gene >Ophun1|960
ATGGCAGACTACGACTCCTATCCCCTCGGTGACTTCACCCTCTCGTCCGGCCAGGTCCTCCCCTCAGCACACCTC
GCCTTCAAGACCTACGGCTCGCCCTCAAGCCCCTGCATCATCTACCAAGCCTACTACGGCGGCCTCATCGCCGAC
AACGAATGGCTCATCGGCGAGAACCGTGCTCTCAACCCGGGCCGTTTCTTCATCGTCATCCCCGCGCTGTTCGGG
AACGGCCAGTCTTCCAGCCCTTCCAACACCACCCTCCGTCCCTTTCCAAACATCACCATCAGAGACAACGTCACG
GCTCAGCACAGGCTTCTCACGGAGAAACTGGGCGTCCATCACGCTCACTGCATCCTTGGTTGGAACATGGGCGCG
TGCGTGACCTTCCAATGGATAGCCCAGTTCCCGACCTTTGCAGACTTGGCCGTGCCCATCTGCGGAGCTGCCCGC
GCAAGACCCCACAACCAGCTCTGTGTTCGGGGGGTCCAGGCGGCGGTTCTGGCAGCCAGGGGAGCGTCTTCAACC
GACGAGGCTGGGACGTGGACCGAGGAGCAGGCGAGGGTTGGGCTGCGGGCTGCGGCCACCATCTTCCCCGCCTGG
CTGTTCTCTCCGGCCTGGTACCGGGAGAGGAAGTTTGAGGGGCTGGGGTTTGCGTCGGTGGAGGAGTTTTTGGTG
GGATTTTGGGAGAAGTTGTTGCTGAGCAAGAGTATTCCCCCCCCCCCAACTTCATCTCTTCTCATTTTTGATTCG
GGGGCTGACAGGTGCAGATGTTGAGGATATCATGGCTATGACATATGCGTGGCAGATGGCGGATATTTCGGCGCA
GGAGCCTTACAATGGCCGTCTTGATCTCGCTCTCTCTGCTATTCGCACCAAGACGCTTGGTCTTCCGTGTCAGAC
GGATATGATCTTTCCGCTTGAGGATTCGGAGGCTGAGGTGAAGGGGATGGGGGAAGGGGTGGGAAAGTGTGTTAC
GTTTCCATCCATCTGGGGACACTGGTACGTCAAGCCGTTTCATTTTCCAATATTGAGCTGTTTCTTACCGTGGTG
TCATTGATTGCATCCGAATCATGTTTCTCTCTCTCGTATCACGACACCCTTTCCCGGTATTCCCCTTTTCAGTGT
CATGGAGTCCCGATTTGTCGTCTTCAGCTGTGCTTTCTTTTCTCCGGTGGCTGACGGCTTGCTCGTTTCGGTAGG
GCTGGTAGTTCGTTGAATGTGGAGGATGTGGAGTGGCTTGATGGGAAACTGAAGGCTTTTCTGGAAGATGGGAGC
TGGTAGTTGGTCGTGCTAGTTGTGCTTATACTTGACCTCCCCTCGTCATTCCTGAGCCATCACAACTCCTTTTGA
AAAATCATGCTGCTCCAGTTGAGATTACAGTGATCTACGAGTACAGTACGTTTACAAATCACCTCTACATCTGTC
TCAGACACCTCAGCCGCCAAGCCGAGCTGAACAACCATTGCAAGCCATCCCCGTAATCCCAACTCATCAACCTAC
ATGTAAAAACACACTCAGCAACATCACCGCCTCACCAACGCCATGGCTTCCCTCCTCCTCCTCGCCCTCTGCGCA
GCAGCAACCCCCCTCCAACACCCGCTAACCCCCTCAGTAACAAGCTGTCTCGTCACAAACTCCATCCCCTTCACC
ACCCCCGACGACGCCTCCTGGCCACGAGCAGCATACTCGTACAACCTCCGACCGAGCTACACGCCCAAAGCCATC
GCGAAGCCCACATCCGCCGCTGCCGTCGCAGGGGCTATCCGCTGTGGCACCGCTGCCGGACTCCGCATCTCTGCA
AAGGCGGGCGGTCATGGCTTTGGGGGGTTCGGCCTCGGCGGTGAGGATGGCCATCTCGTCATTGCGCTGGATGAC
ATGAAAGATGTCTCTCTTCTTTCTGATAACGTCACGGCTGTGGTTCAGCCTGGGGCTCGGCTTCGGCATGTAGCT
ACGCAGTTGTACGAGCAGGGCGGACGAGCCATCTCACATGGTTCCTGTCTCGGCGTCGGGATAGCAGGCCATGTC
CTTCACGGGGGCTTCGGACTATCATCTCGGACGCACGGTCTTGCGCTGGACTGGTTGATAGGCGCGGAAATAGTG
CTCGCAAACGGAACCAGCCTGCAAACCTCGCAAACCCAACACCCAGACCTCTTCTGGGCCCTCCGCGGCGCAGGC
TCCTCCTTCGGGATAGTAACCTCCCTAACCTTTACCACTTTTGCGGCCCCAGAGTCCGTCACGCCTTTTACCATT
GACCTCGACTGGGATGGCGACGGGCCGGCTGCTGTTCGTGCGGTCGAGGTGATGCAGGCGTTTGCGGAGACGGCG
CCTTCGGAAGTCAACTTTATGATGGATCTTACGCCCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail