Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|953
Gene name
LocationContig_134:14966..19269
Strand-
Gene length (bp)4303
Transcript length (bp)3651
Coding sequence length (bp)3651
Protein length (aa) 1217

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10528 GLEYA GLEYA domain 7.2E-16 660 753
PF01565 FAD_binding_4 FAD binding domain 3.5E-12 763 887
PF07691 PA14 PA14 domain 2.2E-08 654 744

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q15392|DHC24_HUMAN Delta(24)-sterol reductase OS=Homo sapiens GN=DHCR24 PE=1 SV=2 800 1197 8.0E-47
sp|Q60HC5|DHC24_MACFA Delta(24)-sterol reductase OS=Macaca fascicularis GN=DHCR24 PE=2 SV=2 800 1197 9.0E-47
sp|Q5BQE6|DHC24_RAT Delta(24)-sterol reductase OS=Rattus norvegicus GN=Dhcr24 PE=2 SV=2 800 1197 2.0E-43
sp|Q8VCH6|DHC24_MOUSE Delta(24)-sterol reductase OS=Mus musculus GN=Dhcr24 PE=1 SV=1 800 1197 2.0E-43
sp|O17397|DIML_CAEEL Diminuto-like protein OS=Caenorhabditis elegans GN=F52H2.6 PE=3 SV=1 789 1197 8.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q15392|DHC24_HUMAN Delta(24)-sterol reductase OS=Homo sapiens GN=DHCR24 PE=1 SV=2 800 1197 8.0E-47
sp|Q60HC5|DHC24_MACFA Delta(24)-sterol reductase OS=Macaca fascicularis GN=DHCR24 PE=2 SV=2 800 1197 9.0E-47
sp|Q5BQE6|DHC24_RAT Delta(24)-sterol reductase OS=Rattus norvegicus GN=Dhcr24 PE=2 SV=2 800 1197 2.0E-43
sp|Q8VCH6|DHC24_MOUSE Delta(24)-sterol reductase OS=Mus musculus GN=Dhcr24 PE=1 SV=1 800 1197 2.0E-43
sp|O17397|DIML_CAEEL Diminuto-like protein OS=Caenorhabditis elegans GN=F52H2.6 PE=3 SV=1 789 1197 8.0E-40
sp|Q39085|DIM_ARATH Delta(24)-sterol reductase OS=Arabidopsis thaliana GN=DIM PE=1 SV=2 798 1196 2.0E-36
sp|P93472|DIM_PEA Delta(24)-sterol reductase OS=Pisum sativum GN=DIM PE=1 SV=1 798 1198 2.0E-34
sp|Q75K78|CKX9_ORYSJ Cytokinin dehydrogenase 9 OS=Oryza sativa subsp. japonica GN=CKX9 PE=2 SV=1 826 957 4.0E-10
sp|F1QBY1|NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio GN=nipblb PE=2 SV=1 131 462 7.0E-10
sp|Q9FUJ1|CKX7_ARATH Cytokinin dehydrogenase 7 OS=Arabidopsis thaliana GN=CKX7 PE=1 SV=1 825 977 8.0E-10
sp|Q7SGY1|ALO_NEUCR Putative D-arabinono-1,4-lactone oxidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=alo-1 PE=3 SV=1 794 919 1.0E-09
sp|Q5JLP4|CKX4_ORYSJ Cytokinin dehydrogenase 4 OS=Oryza sativa subsp. japonica GN=CKX4 PE=2 SV=1 827 974 2.0E-09
sp|A3AVP1|CKX8_ORYSJ Cytokinin dehydrogenase 8 OS=Oryza sativa subsp. japonica GN=CKX8 PE=3 SV=1 827 956 2.0E-08
sp|A2XVN3|CKX8_ORYSI Cytokinin dehydrogenase 8 OS=Oryza sativa subsp. indica GN=CKX8 PE=3 SV=1 827 956 2.0E-08
sp|P38894|FLO5_YEAST Flocculation protein FLO5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLO5 PE=1 SV=1 658 744 2.0E-07
sp|Q4ADV8|CKX2_ORYSJ Cytokinin dehydrogenase 2 OS=Oryza sativa subsp. japonica GN=CKX2 PE=2 SV=1 761 933 4.0E-07
sp|P39712|FLO9_YEAST Flocculation protein FLO9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLO9 PE=3 SV=2 637 744 5.0E-07
sp|Q9LY71|CKX6_ARATH Cytokinin dehydrogenase 6 OS=Arabidopsis thaliana GN=CKX6 PE=2 SV=2 806 974 5.0E-07
sp|Q6YW51|CKX6_ORYSJ Cytokinin dehydrogenase 6 OS=Oryza sativa subsp. japonica GN=CKX6 PE=3 SV=1 827 954 8.0E-07
sp|Q6YW50|CKX7_ORYSJ Cytokinin dehydrogenase 7 OS=Oryza sativa subsp. japonica GN=CKX7 PE=3 SV=1 827 954 1.0E-06
sp|Q94AX4|DLD_ARATH D-lactate dehydrogenase [cytochrome], mitochondrial OS=Arabidopsis thaliana GN=DLD PE=1 SV=1 796 916 2.0E-06
sp|O22213|CKX1_ARATH Cytokinin dehydrogenase 1 OS=Arabidopsis thaliana GN=CKX1 PE=1 SV=1 827 957 3.0E-06
sp|Q6Z955|CKX11_ORYSJ Cytokinin dehydrogenase 11 OS=Oryza sativa subsp. japonica GN=CKX11 PE=2 SV=1 830 957 4.0E-06
sp|Q8ILR9|YPF17_PLAF7 Protein PF14_0175 OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0175 PE=3 SV=1 71 229 5.0E-06
sp|Q8LNV6|CKX3_ORYSJ Cytokinin dehydrogenase 3 OS=Oryza sativa subsp. japonica GN=CKX3 PE=2 SV=1 827 956 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|953
MVAHAMRALTLLAVGFFVVVYARESSLDNGRRVSECLPSDVMSLGDGVAARAASHGVTLCDDLSHSAAALDEPSY
KRHRRQFQQQQQQSQGFGQQQQQQQSQGWGQQQQQQQSQGFGQQQQQQQQSQGQSQQQQQQMGQGGVQQQQQQQQ
RKGKGHASSQEQSQHQNGQEQSQMQEQQQQKGRGQAQIQEQSQQQGHGGAQQAQRQEQQKGRGQTQEQRQQQNGQ
TQAQMQEQQGRGRSQMQEQRQKHEDQEQAQRQEQKGRERAQIQEQRQGHHGQEQAQMQEQRKGQGQTQRQEQQGR
GGTQMQEQQQGQDSQGQDQMQEQQGGGRGQIQEQRQQQHGKEQAQVQEQRGRGRAQIQEQQQGREAGEQAQRQQQ
EGRGRAQAQEQQQGGHGKGQAQIQEQQGRGRVQAQEQQQGYHDKEQAQIQEQQSRGRPQIQEQQQERPGRGKAQL
QAQAQEQQGKEQAQLQAQVAQGKIQLQQQEQQALHGHGQFHGSQATHQRTAPQARVTPAPYVTTTVAYRGTKLVT
TTLPPRGPIRGTVVIWSPTATRPTAAVATSPHGSCPLSSRSCLSPELNVALYANSVNPDEAYGPPPPNGVGPDYY
LSQKPLDHGRSNSLSLPYIDRDSSATGLHSIKPKGTKPFLYYYPDLKQTYGGMTYNANNFTLVFTGYFLAQQTGT
HRFCATADNRVAFYLGGGSAFPCGGSFQGATAGATPLLDFWYGASEDAACGNVVLRAGHYYPIRSVFGNYGNPAV
LRVDRHNQAVAGIAAAIRGFFQRKEPFRINHGSTNSTRPRPRLSAATVDISSLSRVISIDAASQTALVEPNVPMD
RLVEATLREGLVPPVVMEFPGITAGGGYAGTAGESSSFRHGFFDDTLNRVEMVLGNGDVVSASATERPDLFRAAA
GAVGSLGVTTLLELRLVSARRWVRTTYRRTSSVAEAVAAIRAETNKEENDYVDGILFSPNHGAIITGRMTDEKPD
HDKIQTFSHARDPWFYMHVRDRTASQDEAIEYIPLAEYFFRYDRAGFWVGAEGWKYFRYVPFNRFFRWFLDDFMH
TRMLYRALHASGESSRFVVQDLAVPYNKAEELIDYTTHKLAIWPLWLCPLKQARTPTFHPCSGAVSLSEGVLNVG
VWGWGPEDHEAFVRENRALEDKLVELEGRKWLYAHTYYSEDEFWRVYGNRDWYEALRTKYHATTLPSVYDKVRID
AFTGEILELSASFTES*
Coding >Ophun1|953
ATGGTAGCCCATGCCATGCGCGCCTTGACTCTCTTAGCCGTCGGCTTCTTCGTCGTCGTCTACGCTCGTGAGAGC
AGCCTTGACAATGGCAGACGCGTGTCGGAGTGTCTGCCGTCGGACGTGATGAGCTTGGGTGATGGAGTCGCAGCA
AGGGCAGCTTCTCATGGCGTTACTCTCTGTGATGATTTGAGTCATTCTGCTGCTGCACTTGACGAACCATCATAC
AAGCGACACCGGCGGCAGTTCCAGCAGCAACAACAACAGAGCCAAGGCTTCGGTCAACAGCAGCAGCAGCAGCAG
AGTCAAGGCTGGGGACAGCAGCAGCAACAACAACAAAGCCAAGGCTTCGGCCAACAGCAGCAGCAGCAACAGCAG
AGTCAGGGACAATCTCAGCAGCAGCAGCAACAGATGGGACAAGGGGGGGTCCAGCAACAGCAGCAACAGCAGCAG
CGGAAGGGCAAGGGGCACGCCTCAAGTCAAGAGCAAAGTCAGCACCAGAACGGTCAGGAACAGTCCCAGATGCAA
GAGCAACAGCAGCAGAAGGGTCGGGGTCAAGCCCAGATACAAGAACAGAGCCAACAGCAGGGCCACGGAGGTGCT
CAACAAGCACAGCGGCAAGAGCAACAAAAGGGCCGGGGTCAGACTCAAGAGCAAAGACAGCAGCAGAACGGTCAA
ACACAGGCACAGATGCAAGAGCAGCAGGGTCGAGGACGGTCTCAGATGCAAGAGCAAAGACAGAAACACGAGGAC
CAGGAGCAAGCCCAACGTCAAGAGCAGAAGGGCCGTGAGCGAGCGCAGATCCAGGAGCAAAGACAGGGGCATCAT
GGCCAGGAGCAAGCCCAGATGCAAGAGCAGCGAAAGGGCCAGGGGCAAACGCAACGGCAAGAGCAGCAGGGACGG
GGAGGAACTCAGATGCAAGAGCAGCAACAGGGGCAGGATAGCCAGGGTCAAGATCAGATGCAGGAGCAGCAAGGT
GGGGGGCGAGGGCAGATTCAAGAGCAGCGACAGCAGCAGCATGGTAAAGAGCAAGCACAGGTTCAAGAGCAGAGG
GGTAGGGGGCGGGCGCAGATTCAGGAGCAGCAACAGGGACGGGAGGCTGGAGAGCAGGCTCAAAGACAGCAGCAG
GAGGGCCGAGGGAGAGCTCAGGCTCAGGAACAACAGCAGGGGGGTCATGGCAAGGGGCAAGCTCAGATACAGGAG
CAACAGGGTCGAGGGCGGGTTCAAGCTCAAGAACAACAACAAGGATATCACGACAAGGAGCAAGCGCAAATACAG
GAGCAACAAAGTCGGGGACGACCCCAAATCCAGGAACAACAACAAGAACGGCCAGGCCGCGGAAAAGCCCAGCTC
CAAGCCCAAGCCCAAGAGCAACAGGGCAAAGAACAAGCCCAACTCCAAGCACAAGTAGCCCAAGGCAAGATTCAG
CTACAGCAACAAGAACAGCAAGCCCTTCATGGTCATGGACAGTTTCACGGGTCACAAGCTACACATCAACGCACA
GCACCTCAGGCCCGCGTCACACCCGCCCCCTACGTGACGACGACCGTTGCGTACAGAGGGACTAAGCTGGTGACG
ACGACGCTGCCTCCACGGGGTCCCATCCGAGGGACCGTCGTGATCTGGTCTCCTACGGCGACTCGGCCGACAGCA
GCGGTGGCGACGTCGCCTCACGGGTCGTGCCCCCTTTCATCGAGAAGCTGCCTCTCTCCGGAACTCAACGTCGCG
CTATACGCCAACTCTGTCAACCCTGACGAAGCATACGGTCCCCCCCCTCCCAACGGCGTCGGCCCGGACTACTAT
CTCTCCCAGAAACCGCTAGATCACGGCCGAAGCAACTCACTCAGCCTCCCGTACATAGACCGAGACAGCAGTGCA
ACAGGCCTCCACAGCATCAAGCCCAAAGGAACAAAGCCCTTCCTGTATTACTACCCAGACCTGAAGCAGACGTAC
GGGGGCATGACGTACAACGCCAACAACTTCACCCTCGTCTTCACGGGCTACTTCCTCGCACAGCAGACGGGCACG
CACCGATTCTGCGCCACGGCGGACAACCGCGTAGCCTTCTATCTCGGCGGCGGCTCGGCGTTTCCGTGCGGAGGC
TCGTTTCAAGGGGCGACGGCCGGGGCGACGCCGCTGCTGGATTTCTGGTACGGGGCTTCGGAGGATGCGGCGTGC
GGGAACGTGGTGCTCCGGGCCGGGCATTATTACCCGATTCGGTCGGTGTTTGGGAACTATGGGAATCCTGCGGTG
TTGCGGGTGGATCGCCACAACCAAGCCGTCGCCGGCATCGCAGCCGCCATCCGCGGCTTCTTCCAGCGCAAAGAG
CCCTTCCGAATCAACCACGGCAGCACAAACAGCACACGGCCAAGACCCCGTCTCAGCGCCGCAACCGTCGACATC
AGCAGCCTCTCGCGCGTCATCTCCATCGACGCAGCCTCCCAAACGGCCCTCGTCGAGCCCAACGTCCCGATGGAC
CGGCTGGTGGAAGCGACGCTGCGAGAGGGCCTCGTCCCTCCCGTCGTCATGGAGTTTCCCGGTATTACGGCCGGG
GGCGGATACGCCGGCACAGCGGGCGAGAGCTCGTCATTCCGCCATGGCTTCTTCGATGATACGCTGAATCGGGTG
GAGATGGTGCTGGGGAATGGCGACGTTGTCTCTGCTTCGGCGACGGAGCGTCCTGACTTGTTTCGTGCCGCTGCT
GGGGCTGTGGGCTCTCTTGGCGTCACGACGTTGCTGGAGCTGCGTCTCGTCAGTGCCCGTCGATGGGTGAGGACC
ACGTATCGTCGTACGTCGAGCGTGGCAGAGGCTGTGGCCGCCATCCGAGCTGAGACGAACAAGGAGGAGAATGAC
TACGTCGATGGCATCCTCTTCTCGCCCAACCACGGAGCCATCATCACGGGCCGAATGACGGACGAGAAGCCGGAT
CATGACAAGATTCAGACCTTTAGCCACGCTCGCGATCCCTGGTTCTACATGCACGTCCGCGATCGAACCGCCAGC
CAGGACGAGGCCATCGAATATATCCCGCTGGCAGAGTATTTCTTCCGCTACGACCGTGCTGGCTTTTGGGTTGGT
GCCGAGGGATGGAAGTACTTTCGTTACGTGCCCTTTAACCGCTTCTTCCGCTGGTTTCTCGACGACTTTATGCAC
ACGCGCATGCTCTATCGTGCCCTTCACGCCAGCGGCGAATCCTCCCGCTTCGTCGTCCAGGACCTCGCCGTTCCG
TACAACAAGGCAGAGGAGCTGATCGATTACACGACGCACAAACTGGCCATCTGGCCCCTCTGGCTATGTCCGCTG
AAGCAGGCCCGGACGCCGACTTTCCACCCTTGTTCCGGCGCGGTGTCGCTGTCCGAGGGCGTGCTCAACGTCGGC
GTCTGGGGATGGGGGCCTGAAGACCACGAGGCCTTCGTGCGGGAGAACCGCGCGCTTGAGGATAAGCTGGTTGAG
CTCGAGGGGCGGAAGTGGCTGTACGCACACACGTACTACTCCGAGGACGAATTCTGGCGCGTCTACGGGAATAGA
GACTGGTATGAGGCGCTGCGGACAAAGTATCATGCCACGACGCTGCCCAGTGTTTACGACAAGGTGCGGATTGAT
GCGTTTACAGGGGAGATTCTGGAGCTGTCTGCTTCGTTTACAGAGTCATGA
Transcript >Ophun1|953
ATGGTAGCCCATGCCATGCGCGCCTTGACTCTCTTAGCCGTCGGCTTCTTCGTCGTCGTCTACGCTCGTGAGAGC
AGCCTTGACAATGGCAGACGCGTGTCGGAGTGTCTGCCGTCGGACGTGATGAGCTTGGGTGATGGAGTCGCAGCA
AGGGCAGCTTCTCATGGCGTTACTCTCTGTGATGATTTGAGTCATTCTGCTGCTGCACTTGACGAACCATCATAC
AAGCGACACCGGCGGCAGTTCCAGCAGCAACAACAACAGAGCCAAGGCTTCGGTCAACAGCAGCAGCAGCAGCAG
AGTCAAGGCTGGGGACAGCAGCAGCAACAACAACAAAGCCAAGGCTTCGGCCAACAGCAGCAGCAGCAACAGCAG
AGTCAGGGACAATCTCAGCAGCAGCAGCAACAGATGGGACAAGGGGGGGTCCAGCAACAGCAGCAACAGCAGCAG
CGGAAGGGCAAGGGGCACGCCTCAAGTCAAGAGCAAAGTCAGCACCAGAACGGTCAGGAACAGTCCCAGATGCAA
GAGCAACAGCAGCAGAAGGGTCGGGGTCAAGCCCAGATACAAGAACAGAGCCAACAGCAGGGCCACGGAGGTGCT
CAACAAGCACAGCGGCAAGAGCAACAAAAGGGCCGGGGTCAGACTCAAGAGCAAAGACAGCAGCAGAACGGTCAA
ACACAGGCACAGATGCAAGAGCAGCAGGGTCGAGGACGGTCTCAGATGCAAGAGCAAAGACAGAAACACGAGGAC
CAGGAGCAAGCCCAACGTCAAGAGCAGAAGGGCCGTGAGCGAGCGCAGATCCAGGAGCAAAGACAGGGGCATCAT
GGCCAGGAGCAAGCCCAGATGCAAGAGCAGCGAAAGGGCCAGGGGCAAACGCAACGGCAAGAGCAGCAGGGACGG
GGAGGAACTCAGATGCAAGAGCAGCAACAGGGGCAGGATAGCCAGGGTCAAGATCAGATGCAGGAGCAGCAAGGT
GGGGGGCGAGGGCAGATTCAAGAGCAGCGACAGCAGCAGCATGGTAAAGAGCAAGCACAGGTTCAAGAGCAGAGG
GGTAGGGGGCGGGCGCAGATTCAGGAGCAGCAACAGGGACGGGAGGCTGGAGAGCAGGCTCAAAGACAGCAGCAG
GAGGGCCGAGGGAGAGCTCAGGCTCAGGAACAACAGCAGGGGGGTCATGGCAAGGGGCAAGCTCAGATACAGGAG
CAACAGGGTCGAGGGCGGGTTCAAGCTCAAGAACAACAACAAGGATATCACGACAAGGAGCAAGCGCAAATACAG
GAGCAACAAAGTCGGGGACGACCCCAAATCCAGGAACAACAACAAGAACGGCCAGGCCGCGGAAAAGCCCAGCTC
CAAGCCCAAGCCCAAGAGCAACAGGGCAAAGAACAAGCCCAACTCCAAGCACAAGTAGCCCAAGGCAAGATTCAG
CTACAGCAACAAGAACAGCAAGCCCTTCATGGTCATGGACAGTTTCACGGGTCACAAGCTACACATCAACGCACA
GCACCTCAGGCCCGCGTCACACCCGCCCCCTACGTGACGACGACCGTTGCGTACAGAGGGACTAAGCTGGTGACG
ACGACGCTGCCTCCACGGGGTCCCATCCGAGGGACCGTCGTGATCTGGTCTCCTACGGCGACTCGGCCGACAGCA
GCGGTGGCGACGTCGCCTCACGGGTCGTGCCCCCTTTCATCGAGAAGCTGCCTCTCTCCGGAACTCAACGTCGCG
CTATACGCCAACTCTGTCAACCCTGACGAAGCATACGGTCCCCCCCCTCCCAACGGCGTCGGCCCGGACTACTAT
CTCTCCCAGAAACCGCTAGATCACGGCCGAAGCAACTCACTCAGCCTCCCGTACATAGACCGAGACAGCAGTGCA
ACAGGCCTCCACAGCATCAAGCCCAAAGGAACAAAGCCCTTCCTGTATTACTACCCAGACCTGAAGCAGACGTAC
GGGGGCATGACGTACAACGCCAACAACTTCACCCTCGTCTTCACGGGCTACTTCCTCGCACAGCAGACGGGCACG
CACCGATTCTGCGCCACGGCGGACAACCGCGTAGCCTTCTATCTCGGCGGCGGCTCGGCGTTTCCGTGCGGAGGC
TCGTTTCAAGGGGCGACGGCCGGGGCGACGCCGCTGCTGGATTTCTGGTACGGGGCTTCGGAGGATGCGGCGTGC
GGGAACGTGGTGCTCCGGGCCGGGCATTATTACCCGATTCGGTCGGTGTTTGGGAACTATGGGAATCCTGCGGTG
TTGCGGGTGGATCGCCACAACCAAGCCGTCGCCGGCATCGCAGCCGCCATCCGCGGCTTCTTCCAGCGCAAAGAG
CCCTTCCGAATCAACCACGGCAGCACAAACAGCACACGGCCAAGACCCCGTCTCAGCGCCGCAACCGTCGACATC
AGCAGCCTCTCGCGCGTCATCTCCATCGACGCAGCCTCCCAAACGGCCCTCGTCGAGCCCAACGTCCCGATGGAC
CGGCTGGTGGAAGCGACGCTGCGAGAGGGCCTCGTCCCTCCCGTCGTCATGGAGTTTCCCGGTATTACGGCCGGG
GGCGGATACGCCGGCACAGCGGGCGAGAGCTCGTCATTCCGCCATGGCTTCTTCGATGATACGCTGAATCGGGTG
GAGATGGTGCTGGGGAATGGCGACGTTGTCTCTGCTTCGGCGACGGAGCGTCCTGACTTGTTTCGTGCCGCTGCT
GGGGCTGTGGGCTCTCTTGGCGTCACGACGTTGCTGGAGCTGCGTCTCGTCAGTGCCCGTCGATGGGTGAGGACC
ACGTATCGTCGTACGTCGAGCGTGGCAGAGGCTGTGGCCGCCATCCGAGCTGAGACGAACAAGGAGGAGAATGAC
TACGTCGATGGCATCCTCTTCTCGCCCAACCACGGAGCCATCATCACGGGCCGAATGACGGACGAGAAGCCGGAT
CATGACAAGATTCAGACCTTTAGCCACGCTCGCGATCCCTGGTTCTACATGCACGTCCGCGATCGAACCGCCAGC
CAGGACGAGGCCATCGAATATATCCCGCTGGCAGAGTATTTCTTCCGCTACGACCGTGCTGGCTTTTGGGTTGGT
GCCGAGGGATGGAAGTACTTTCGTTACGTGCCCTTTAACCGCTTCTTCCGCTGGTTTCTCGACGACTTTATGCAC
ACGCGCATGCTCTATCGTGCCCTTCACGCCAGCGGCGAATCCTCCCGCTTCGTCGTCCAGGACCTCGCCGTTCCG
TACAACAAGGCAGAGGAGCTGATCGATTACACGACGCACAAACTGGCCATCTGGCCCCTCTGGCTATGTCCGCTG
AAGCAGGCCCGGACGCCGACTTTCCACCCTTGTTCCGGCGCGGTGTCGCTGTCCGAGGGCGTGCTCAACGTCGGC
GTCTGGGGATGGGGGCCTGAAGACCACGAGGCCTTCGTGCGGGAGAACCGCGCGCTTGAGGATAAGCTGGTTGAG
CTCGAGGGGCGGAAGTGGCTGTACGCACACACGTACTACTCCGAGGACGAATTCTGGCGCGTCTACGGGAATAGA
GACTGGTATGAGGCGCTGCGGACAAAGTATCATGCCACGACGCTGCCCAGTGTTTACGACAAGGTGCGGATTGAT
GCGTTTACAGGGGAGATTCTGGAGCTGTCTGCTTCGTTTACAGAGTCATGA
Gene >Ophun1|953
ATGGTAGCCCATGCCATGCGCGCCTTGACTCTCTTAGCCGTCGGCTTCTTCGTCGTCGTCTACGCTCGTGAGAGC
AGCCTTGACAATGGCAGACGCGTGTCGGAGTGTCTGCCGTCGGACGTGATGAGCTTGGGTGATGGAGTCGCAGCA
AGGGCAGCTTCGTAAGTTTGCTCGAGGTGTTAAATTGAGGATTAATTGTGAAGTGGCTGATGGAGGGGTGAGACG
CAGTCATGGCGTTACTCTCTGTGATGATTTGAGTCATTCTGCTGCTGCACTTGACGAACCATCATACAAGGTCAG
TCTTTGAGCTAACGTCAATGTTCTTGCTGGAAATACAGTCTTTGGAGATATCAATGCTAACAAACTTCATAGCGA
CACCGGCGGCAGTTCCAGCAGCAACAACAACAGAGCCAAGGCTTCGGTCAACAGCAGCAGCAGCAGCAGAGTCAA
GGCTGGGGACAGCAGCAGCAACAACAACAAAGCCAAGGCTTCGGCCAACAGCAGCAGCAGCAACAGCAGAGTCAG
GGACAATCTCAGCAGCAGCAGCAACAGATGGGACAAGGGGGGGTCCAGCAACAGCAGCAACAGCAGCAGCGGAAG
GGCAAGGGGCACGCCTCAAGTCAAGAGCAAAGTCAGCACCAGAACGGTCAGGAACAGTCCCAGATGCAAGAGCAA
CAGCAGCAGAAGGGTCGGGGTCAAGCCCAGATACAAGAACAGAGCCAACAGCAGGGCCACGGAGGTGCTCAACAA
GCACAGCGGCAAGAGCAACAAAAGGGCCGGGGTCAGACTCAAGAGCAAAGACAGCAGCAGAACGGTCAAACACAG
GCACAGATGCAAGAGCAGCAGGGTCGAGGACGGTCTCAGATGCAAGAGCAAAGACAGAAACACGAGGACCAGGAG
CAAGCCCAACGTCAAGAGCAGAAGGGCCGTGAGCGAGCGCAGATCCAGGAGCAAAGACAGGGGCATCATGGCCAG
GAGCAAGCCCAGATGCAAGAGCAGCGAAAGGGCCAGGGGCAAACGCAACGGCAAGAGCAGCAGGGACGGGGAGGA
ACTCAGATGCAAGAGCAGCAACAGGGGCAGGATAGCCAGGGTCAAGATCAGATGCAGGAGCAGCAAGGTGGGGGG
CGAGGGCAGATTCAAGAGCAGCGACAGCAGCAGCATGGTAAAGAGCAAGCACAGGTTCAAGAGCAGAGGGGTAGG
GGGCGGGCGCAGATTCAGGAGCAGCAACAGGGACGGGAGGCTGGAGAGCAGGCTCAAAGACAGCAGCAGGAGGGC
CGAGGGAGAGCTCAGGCTCAGGAACAACAGCAGGGGGGTCATGGCAAGGGGCAAGCTCAGATACAGGAGCAACAG
GGTCGAGGGCGGGTTCAAGCTCAAGAACAACAACAAGGATATCACGACAAGGAGCAAGCGCAAATACAGGAGCAA
CAAAGTCGGGGACGACCCCAAATCCAGGAACAACAACAAGAACGGCCAGGCCGCGGAAAAGCCCAGCTCCAAGCC
CAAGCCCAAGAGCAACAGGGCAAAGAACAAGCCCAACTCCAAGCACAAGTAGCCCAAGGCAAGATTCAGCTACAG
CAACAAGAACAGCAAGCCCTTCATGGTCATGGACAGTTTCACGGGTCACAAGCTACACATCAACGCACAGCACCT
CAGGCCCGCGTCACACCCGCCCCCTACGTGACGACGACCGTTGCGTACAGAGGGACTAAGCTGGTGACGACGACG
CTGCCTCCACGGGGTCCCATCCGAGGGACCGTCGTGATCTGGTCTCCTACGGCGACTCGGCCGACAGCAGCGGTG
GCGACGTCGCCTCACGGGTCGTGCCCCCTTTCATCGAGAAGCTGCCTCTCTCCGGAACTCAACGTCGCGCTATAC
GCCAACTCTGTCAACCCTGACGAAGCATACGGTCCCCCCCCTCCCAACGGCGTCGGCCCGGACTACTATCTCTCC
CAGAAACCGCTAGATCACGGCCGAAGCAACTCACTCAGCCTCCCGTACATAGACCGAGACAGCAGTGCAACAGGC
CTCCACAGCATCAAGCCCAAAGGAACAAAGCCCTTCCTGTATTACTACCCAGACCTGAAGCAGACGTACGGGGGC
ATGACGTACAACGCCAACAACTTCACCCTCGTCTTCACGGGCTACTTCCTCGCACAGCAGACGGGCACGCACCGA
TTCTGCGCCACGGCGGACAACCGCGTAGCCTTCTATCTCGGCGGCGGCTCGGCGTTTCCGTGCGGAGGCTCGTTT
CAAGGGGCGACGGCCGGGGCGACGCCGCTGCTGGATTTCTGGTACGGGGCTTCGGAGGATGCGGCGTGCGGGAAC
GTGGTGCTCCGGGCCGGGCATTATTACCCGATTCGGTCGGTGTTTGGGAACTATGGGAATCCTGCGGTGTTGCGG
GTGGATGTGAGGCTTCCGGATGGGCGGAAGACGGAGGATATGGGGGGGATGCTGGCTGGTGATGTGTGTTAGTAG
TGTTGGGGGGGGGAGTGGATGGGATGAGGATGAAGTGGATGTGTTGTTAGGTTAAGATGAAGATGATTTGATAAC
AGCTGTATGAGTTGTAATAGTAATAACTATACTGTAAGGTGTAGAAAACTGCAGGGTGGTAGATGGTCACGTTGG
AGTAGGTAGCCGTATCTGCGGGCTGGTCAGACAGATTGTGTGCTGGATAGACAGCGAAAGGATCGTCACGTAACC
TCATCTCCTCTCCTCTCTATACCCTCATACCCTCTCCTCTCCCCTCCCTCTCCTCCCCCAATCCCCTCCCTCCTC
CATGGAGCGCCACAACCAAGCCGTCGCCGGCATCGCAGCCGCCATCCGCGGCTTCTTCCAGCGCAAAGAGCCCTT
CCGAATCAACCACGGCAGCACAAACAGCACACGGCCAAGACCCCGTCTCAGCGCCGCAACCGTCGACATCAGCAG
CCTCTCGCGCGTCATCTCCATCGACGCAGCCTCCCAAACGGCCCTCGTCGAGCCCAACGTCCCGATGGACCGGCT
GGTGGAAGCGACGCTGCGAGAGGGCCTCGTCCCTCCCGTCGTCATGGAGTTTCCCGGTATTACGGCCGGGGGCGG
ATACGCCGGCACAGCGGGCGAGAGCTCGTCATTCCGCCATGGCTTCTTCGATGATACGCTGAATCGGGTGGAGAT
GGTGCTGGGGAATGGCGACGTTGTCTCTGCTTCGGCGACGGAGCGTCCTGACTTGTTTCGTGCCGCTGCTGGGGC
TGTGGGCTCTCTTGGCGTCACGACGTTGCTGGAGCTGCGTCTCGTCAGTGCCCGTCGATGGGTGAGGACCACGTA
TCGTCGTACGTCGAGCGTGGCAGAGGCTGTGGCCGCCATCCGAGCTGAGACGAACAAGGAGGAGAATGACTACGT
CGATGGCATCCTCTTCTCGCCCAACCACGGAGCCATCATCACGGGCCGAATGACGGACGAGAAGCCGGATCATGA
CAAGATTCAGACCTTTAGCCACGCTCGCGATCCCTGGTTCTACATGCACGTCCGCGATCGAACCGCCAGCCAGGA
CGAGGCCATCGAATATATCCCGCTGGCAGAGTATTTCTTCCGCTACGACCGTGCTGGCTTTTGGGTTGGTGCCGA
GGGATGGAAGTACTTTCGTTACGTGCCCTTTAACCGCTTCTTCCGCTGGTTTCTCGACGACTTTATGCACACGCG
CATGCTCTATCGTGCCCTTCACGCCAGCGGCGAATCCTCCCGCTTCGTCGTCCAGGACCTCGCCGTTCCGTACAA
CAAGGCAGAGGAGCTGATCGATTACACGACGCACAAACTGGCCATCTGGCCCCTCTGGCTATGTCCGCTGAAGCA
GGCCCGGACGCCGACTTTCCACCCTTGTTCCGGCGCGGTGTCGCTGTCCGAGGGCGTGCTCAACGTCGGCGTCTG
GGGATGGGGGCCTGAAGACCACGAGGCCTTCGTGCGGGAGAACCGCGCGCTTGAGGATAAGCTGGTTGAGCTCGA
GGGGCGGAAGTGGCTGTACGCACACACGTACTACTCCGAGGACGAATTCTGGCGCGTCTACGGGAATAGAGACTG
GTATGAGGCGCTGCGGACAAAGTATCATGCCACGACGCTGCCCAGTGTTTACGACAAGGTGCGGATTGATGTGAG
GGCTGCGAGGGATGCTTCGGCTTGGAGGAGGATGTGGCCGCTGGGGGGGGTGTATGGGTTGTGGAAGAGTATTCT
GAGTGGTGATTATCACTTGCATCGGAACGCGGGCTGGAGATGTCGTCGGTAGGCGTTTACAGGGGAGATTCTGGA
GCTGTCTGCTTCGTTTACAGAGTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail