Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|950
Gene name
LocationContig_134:8797..10473
Strand-
Gene length (bp)1676
Transcript length (bp)1620
Coding sequence length (bp)1620
Protein length (aa) 540

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup296
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|00022
Ophiocordyceps camponoti-floridani Ophcf2|01596
Ophiocordyceps camponoti-floridani Ophcf2|06712
Ophiocordyceps camponoti-rufipedis Ophun1|1283
Ophiocordyceps camponoti-rufipedis Ophun1|2810
Ophiocordyceps camponoti-rufipedis Ophun1|950 (this protein)
Ophiocordyceps kimflemingae Ophio5|2947
Ophiocordyceps kimflemingae Ophio5|4080
Ophiocordyceps kimflemingae Ophio5|6414
Ophiocordyceps subramaniannii Hirsu2|9518

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|950
MSVEPVTEKTPSLDVQDVQAKDVFPLHTFDDAKINHKLLAWVMRFNDILDAKKLHDSLQRLLEIGDWRKLGGRLR
LTPMKESGRLELHVPKQFSAEHPAVSFSHVTEFFGMPIEEHPIARRFPKPTVEPSIQPVDGFRSFLAPSDYPKTL
QEMISRGLPQISLHITSFSNATLVAVAWPHTLMDAVGQQDLLRSWSFVLAGREEHVPPLLGARNDILKELEDEES
EKNREPLAIERHRLGKIGLFAMIARLLWERLRGSPLEMRAIYLPRKIFSRLQREAENQIDQLSKDTNQSKFISDG
DILFAWLAQTVGQSKPGPRPLTIVSFFNARYRLPRLRNELSGVYVQNMTQLSFTLVPSSLVKAPVGHLAVQHRQQ
LAEQSSKQQTLSLLRTFRRKIETDQLKSTVYGQSNALLMFCNNLTKLDLLKAADFGPAVLSKGECSCKETRRLNP
PGTMVMYYNQPVDDDLGPLDSFFMLGKDYGDNYWLLGNFQAQTWTKLEQDLKRLKENESAPLNAQLEKVPLRSVG
GVMEERVIHVVGEE*
Coding >Ophun1|950
ATGTCCGTGGAACCAGTGACTGAGAAGACTCCGTCTCTTGACGTCCAAGACGTCCAAGCCAAAGACGTCTTCCCA
CTGCACACCTTTGACGATGCCAAGATCAACCACAAGCTCCTGGCGTGGGTCATGCGGTTCAATGACATCTTGGAC
GCCAAGAAGCTGCATGATTCCCTCCAGAGGCTCTTGGAGATTGGTGATTGGAGGAAGCTCGGCGGGAGGCTCAGA
CTTACGCCGATGAAGGAGTCTGGCAGGCTGGAGCTTCACGTCCCGAAGCAATTCTCAGCAGAACACCCGGCCGTG
TCCTTCAGTCACGTCACTGAATTCTTCGGAATGCCCATCGAAGAGCATCCCATAGCCCGTCGATTCCCCAAGCCG
ACCGTCGAGCCATCCATCCAACCAGTCGACGGCTTCCGTTCCTTTCTCGCCCCCTCAGACTATCCCAAGACGCTC
CAGGAGATGATCAGCCGAGGTCTGCCTCAGATATCGCTGCACATCACCTCGTTCAGCAACGCCACCCTCGTGGCC
GTGGCCTGGCCTCACACCCTTATGGATGCCGTAGGCCAGCAGGACTTGTTACGCAGCTGGTCTTTTGTTCTGGCA
GGGCGTGAGGAACATGTGCCTCCCCTTCTCGGGGCCCGGAATGACATTCTCAAGGAACTCGAGGACGAAGAGAGC
GAGAAGAATAGGGAGCCGCTTGCCATCGAACGGCATCGTCTAGGGAAAATTGGCTTGTTTGCCATGATTGCCCGT
CTTCTATGGGAACGGCTCCGGGGTTCTCCGTTGGAAATGCGTGCCATCTACCTCCCTCGAAAGATCTTCTCCCGA
CTGCAAAGAGAGGCCGAGAATCAGATAGACCAGCTCTCCAAAGACACCAATCAGTCCAAATTCATAAGCGATGGC
GATATCCTCTTCGCATGGCTCGCCCAGACGGTAGGACAGTCCAAGCCCGGACCGCGGCCTCTCACCATCGTCAGC
TTCTTCAACGCCCGCTACCGGCTCCCGCGGTTGCGGAACGAGCTCTCAGGCGTCTACGTCCAGAACATGACGCAG
CTGAGCTTCACCTTGGTCCCATCCTCGCTCGTCAAGGCTCCTGTCGGTCATCTTGCCGTGCAACATCGCCAGCAG
CTGGCGGAGCAATCGTCAAAGCAACAGACGCTGAGCCTGCTGCGGACCTTTCGGCGGAAGATCGAGACGGACCAG
CTTAAGAGTACCGTCTACGGCCAGAGCAATGCTCTGCTCATGTTCTGCAATAACCTGACCAAGCTCGACCTTCTC
AAGGCCGCTGACTTTGGCCCGGCTGTCTTGTCGAAAGGCGAGTGCAGCTGCAAGGAGACGAGGAGGCTCAACCCG
CCGGGAACCATGGTCATGTACTATAACCAGCCCGTTGACGACGATCTGGGACCGCTGGATTCGTTCTTCATGCTC
GGAAAGGATTACGGGGATAACTACTGGCTTCTGGGCAACTTTCAAGCACAGACGTGGACGAAGCTGGAGCAGGAT
CTGAAGAGACTGAAAGAGAACGAGTCGGCGCCGCTGAATGCTCAGCTTGAGAAAGTGCCTCTTCGATCCGTGGGA
GGGGTGATGGAAGAAAGGGTAATACATGTAGTGGGAGAGGAGTAG
Transcript >Ophun1|950
ATGTCCGTGGAACCAGTGACTGAGAAGACTCCGTCTCTTGACGTCCAAGACGTCCAAGCCAAAGACGTCTTCCCA
CTGCACACCTTTGACGATGCCAAGATCAACCACAAGCTCCTGGCGTGGGTCATGCGGTTCAATGACATCTTGGAC
GCCAAGAAGCTGCATGATTCCCTCCAGAGGCTCTTGGAGATTGGTGATTGGAGGAAGCTCGGCGGGAGGCTCAGA
CTTACGCCGATGAAGGAGTCTGGCAGGCTGGAGCTTCACGTCCCGAAGCAATTCTCAGCAGAACACCCGGCCGTG
TCCTTCAGTCACGTCACTGAATTCTTCGGAATGCCCATCGAAGAGCATCCCATAGCCCGTCGATTCCCCAAGCCG
ACCGTCGAGCCATCCATCCAACCAGTCGACGGCTTCCGTTCCTTTCTCGCCCCCTCAGACTATCCCAAGACGCTC
CAGGAGATGATCAGCCGAGGTCTGCCTCAGATATCGCTGCACATCACCTCGTTCAGCAACGCCACCCTCGTGGCC
GTGGCCTGGCCTCACACCCTTATGGATGCCGTAGGCCAGCAGGACTTGTTACGCAGCTGGTCTTTTGTTCTGGCA
GGGCGTGAGGAACATGTGCCTCCCCTTCTCGGGGCCCGGAATGACATTCTCAAGGAACTCGAGGACGAAGAGAGC
GAGAAGAATAGGGAGCCGCTTGCCATCGAACGGCATCGTCTAGGGAAAATTGGCTTGTTTGCCATGATTGCCCGT
CTTCTATGGGAACGGCTCCGGGGTTCTCCGTTGGAAATGCGTGCCATCTACCTCCCTCGAAAGATCTTCTCCCGA
CTGCAAAGAGAGGCCGAGAATCAGATAGACCAGCTCTCCAAAGACACCAATCAGTCCAAATTCATAAGCGATGGC
GATATCCTCTTCGCATGGCTCGCCCAGACGGTAGGACAGTCCAAGCCCGGACCGCGGCCTCTCACCATCGTCAGC
TTCTTCAACGCCCGCTACCGGCTCCCGCGGTTGCGGAACGAGCTCTCAGGCGTCTACGTCCAGAACATGACGCAG
CTGAGCTTCACCTTGGTCCCATCCTCGCTCGTCAAGGCTCCTGTCGGTCATCTTGCCGTGCAACATCGCCAGCAG
CTGGCGGAGCAATCGTCAAAGCAACAGACGCTGAGCCTGCTGCGGACCTTTCGGCGGAAGATCGAGACGGACCAG
CTTAAGAGTACCGTCTACGGCCAGAGCAATGCTCTGCTCATGTTCTGCAATAACCTGACCAAGCTCGACCTTCTC
AAGGCCGCTGACTTTGGCCCGGCTGTCTTGTCGAAAGGCGAGTGCAGCTGCAAGGAGACGAGGAGGCTCAACCCG
CCGGGAACCATGGTCATGTACTATAACCAGCCCGTTGACGACGATCTGGGACCGCTGGATTCGTTCTTCATGCTC
GGAAAGGATTACGGGGATAACTACTGGCTTCTGGGCAACTTTCAAGCACAGACGTGGACGAAGCTGGAGCAGGAT
CTGAAGAGACTGAAAGAGAACGAGTCGGCGCCGCTGAATGCTCAGCTTGAGAAAGTGCCTCTTCGATCCGTGGGA
GGGGTGATGGAAGAAAGGGTAATACATGTAGTGGGAGAGGAGTAG
Gene >Ophun1|950
ATGTCCGTGGAACCAGTGACTGAGAAGACTCCGTCTCTTGACGTCCAAGACGTCCAAGCCAAAGACGTCTTCCCA
CTGCACACCTTTGACGATGCCAAGATCAACCACAAGCTCCTGGCGTGGGTCATGCGGTTCAATGACATCTTGGAC
GCCAAGAAGCTGCATGATTCCCTCCAGAGGCTCTTGGAGATTGGTGATTGGAGGAAGCTCGGCGGGAGGCTCAGA
CTTACGGTATGTACTGGATCGAATGTTGTTGATAGTGGCAACAGTTCTATGTTCTCTAACAGCCGATGAAGGAGT
CTGGCAGGCTGGAGCTTCACGTCCCGAAGCAATTCTCAGCAGAACACCCGGCCGTGTCCTTCAGTCACGTCACTG
AATTCTTCGGAATGCCCATCGAAGAGCATCCCATAGCCCGTCGATTCCCCAAGCCGACCGTCGAGCCATCCATCC
AACCAGTCGACGGCTTCCGTTCCTTTCTCGCCCCCTCAGACTATCCCAAGACGCTCCAGGAGATGATCAGCCGAG
GTCTGCCTCAGATATCGCTGCACATCACCTCGTTCAGCAACGCCACCCTCGTGGCCGTGGCCTGGCCTCACACCC
TTATGGATGCCGTAGGCCAGCAGGACTTGTTACGCAGCTGGTCTTTTGTTCTGGCAGGGCGTGAGGAACATGTGC
CTCCCCTTCTCGGGGCCCGGAATGACATTCTCAAGGAACTCGAGGACGAAGAGAGCGAGAAGAATAGGGAGCCGC
TTGCCATCGAACGGCATCGTCTAGGGAAAATTGGCTTGTTTGCCATGATTGCCCGTCTTCTATGGGAACGGCTCC
GGGGTTCTCCGTTGGAAATGCGTGCCATCTACCTCCCTCGAAAGATCTTCTCCCGACTGCAAAGAGAGGCCGAGA
ATCAGATAGACCAGCTCTCCAAAGACACCAATCAGTCCAAATTCATAAGCGATGGCGATATCCTCTTCGCATGGC
TCGCCCAGACGGTAGGACAGTCCAAGCCCGGACCGCGGCCTCTCACCATCGTCAGCTTCTTCAACGCCCGCTACC
GGCTCCCGCGGTTGCGGAACGAGCTCTCAGGCGTCTACGTCCAGAACATGACGCAGCTGAGCTTCACCTTGGTCC
CATCCTCGCTCGTCAAGGCTCCTGTCGGTCATCTTGCCGTGCAACATCGCCAGCAGCTGGCGGAGCAATCGTCAA
AGCAACAGACGCTGAGCCTGCTGCGGACCTTTCGGCGGAAGATCGAGACGGACCAGCTTAAGAGTACCGTCTACG
GCCAGAGCAATGCTCTGCTCATGTTCTGCAATAACCTGACCAAGCTCGACCTTCTCAAGGCCGCTGACTTTGGCC
CGGCTGTCTTGTCGAAAGGCGAGTGCAGCTGCAAGGAGACGAGGAGGCTCAACCCGCCGGGAACCATGGTCATGT
ACTATAACCAGCCCGTTGACGACGATCTGGGACCGCTGGATTCGTTCTTCATGCTCGGAAAGGATTACGGGGATA
ACTACTGGCTTCTGGGCAACTTTCAAGCACAGACGTGGACGAAGCTGGAGCAGGATCTGAAGAGACTGAAAGAGA
ACGAGTCGGCGCCGCTGAATGCTCAGCTTGAGAAAGTGCCTCTTCGATCCGTGGGAGGGGTGATGGAAGAAAGGG
TAATACATGTAGTGGGAGAGGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail