Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|946
Gene name
LocationContig_1339:1236..2601
Strand-
Gene length (bp)1365
Transcript length (bp)1365
Coding sequence length (bp)1365
Protein length (aa) 455

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05368 NmrA NmrA-like family 3.5E-82 66 321
PF13460 NAD_binding_10 NAD(P)H-binding 4.9E-07 71 234

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P23762|NMR1_NEUCR Nitrogen metabolite repression protein nmr OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmr PE=1 SV=2 1 454 0.0E+00
sp|Q5AU62|NMRA_EMENI Nitrogen metabolite repression protein nmrA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nmrA PE=1 SV=1 63 404 4.0E-117
sp|Q5ZID0|NMRL1_CHICK NmrA-like family domain-containing protein 1 OS=Gallus gallus GN=NMRAL1 PE=2 SV=1 63 322 1.0E-11
sp|Q54LJ8|NMRL1_DICDI NmrA-like family domain-containing protein DDB_G0286605 OS=Dictyostelium discoideum GN=DDB_G0286605 PE=2 SV=1 144 320 3.0E-07

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2331
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7602
Ophiocordyceps australis map64 (Brazil) OphauB2|3637
Ophiocordyceps camponoti-floridani Ophcf2|05056
Ophiocordyceps camponoti-rufipedis Ophun1|946 (this protein)
Ophiocordyceps kimflemingae Ophio5|4588
Ophiocordyceps subramaniannii Hirsu2|3168

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|946
MPAQISGSVKGTAPIRIVDDQTNGYRKQHKHSRSSYSESSPLAGSRNNSLTFRPPKRLNSAPNKTIAVINASGRQ
AASLIRVATAVGYRVRAQLRNLEGVVATEVSTNSNVTVLVGELYTRHDEPTTEDVTQDGPLSGIGVNHELISNLF
RGAQLAFINTTFYGDELAIGMALADAAKAAGVQHYVYSSMPDHAAYHKDWPSLPLWAAKHKVEDYVRALDLPATF
VYTGIYNNNFTSLLYPLFCMELQPDGSFLWQAPFHEDAKLPWLDAEHDVGPAILQIFKDGVTKWKGERVALAYEY
LTPTEACQLFSRGVGRPVYYSRGPIEIKVRIPTGYRQQLEALARLFRADEPDVRKQPPYFGDAKLEASCPAEALE
LWEGPRGLEEYAREMFPLEEEANGLTWMLADDDGHDHEDKVHATAASVEQLKIHDDESDDEDEGLVMRGLKRDEE
QWLA*
Coding >Ophun1|946
ATGCCGGCCCAAATCTCCGGCTCCGTCAAGGGCACGGCCCCGATCCGCATCGTCGACGACCAGACCAACGGTTAC
CGCAAGCAGCACAAGCATTCGCGCTCCTCCTACTCCGAGTCGTCGCCTCTCGCAGGCTCGCGCAACAACTCGCTG
ACGTTCCGCCCGCCCAAGAGGCTCAACTCGGCACCCAACAAGACCATTGCCGTCATCAACGCCAGCGGTCGTCAG
GCTGCCTCGCTGATCCGCGTCGCCACTGCTGTTGGCTACCGCGTCCGCGCTCAGCTGCGTAACCTCGAGGGCGTC
GTCGCTACCGAAGTCTCGACCAACTCAAACGTCACCGTCCTTGTCGGCGAGCTCTACACCCGCCACGACGAGCCT
ACTACCGAAGATGTGACACAGGATGGGCCCTTGTCCGGCATCGGAGTCAACCATGAACTCATCTCCAACCTGTTC
CGCGGCGCTCAGCTGGCCTTTATAAACACCACATTTTACGGAGACGAGCTTGCCATTGGCATGGCCCTCGCCGAC
GCCGCAAAAGCCGCCGGCGTTCAGCACTATGTCTACTCGTCCATGCCCGATCACGCCGCCTACCACAAGGACTGG
CCGTCGTTGCCGCTCTGGGCTGCCAAGCACAAGGTCGAAGACTATGTCCGCGCTCTCGATCTGCCCGCCACCTTT
GTCTACACGGGCATCTATAATAACAACTTCACCTCACTCCTCTACCCGCTCTTCTGCATGGAGCTACAACCCGAC
GGCTCCTTTTTGTGGCAGGCGCCCTTTCACGAGGACGCCAAGCTGCCCTGGCTCGACGCCGAGCATGACGTCGGG
CCCGCCATCTTACAAATCTTCAAGGACGGCGTCACCAAGTGGAAGGGCGAGCGCGTCGCCCTGGCCTACGAGTAT
CTGACGCCCACCGAGGCCTGTCAGCTCTTTTCCCGCGGCGTCGGTCGTCCCGTCTACTATTCCCGCGGGCCCATC
GAGATCAAAGTACGCATCCCGACGGGCTATCGCCAGCAGCTCGAGGCCCTGGCCCGCCTCTTCAGGGCAGACGAG
CCCGACGTCCGAAAGCAGCCTCCCTACTTTGGCGACGCAAAGCTCGAGGCTAGCTGCCCGGCCGAGGCGCTCGAG
CTGTGGGAGGGACCCCGGGGGTTGGAGGAGTACGCGAGAGAGATGTTCCCGCTGGAAGAGGAGGCCAACGGCTTG
ACGTGGATGCTCGCCGACGACGACGGTCACGATCACGAGGACAAGGTTCACGCGACGGCTGCCTCGGTCGAGCAG
CTCAAGATCCACGACGACGAGTCGGACGACGAAGATGAGGGGCTGGTCATGAGGGGGCTGAAGCGAGACGAGGAG
CAATGGCTTGCGTGA
Transcript >Ophun1|946
ATGCCGGCCCAAATCTCCGGCTCCGTCAAGGGCACGGCCCCGATCCGCATCGTCGACGACCAGACCAACGGTTAC
CGCAAGCAGCACAAGCATTCGCGCTCCTCCTACTCCGAGTCGTCGCCTCTCGCAGGCTCGCGCAACAACTCGCTG
ACGTTCCGCCCGCCCAAGAGGCTCAACTCGGCACCCAACAAGACCATTGCCGTCATCAACGCCAGCGGTCGTCAG
GCTGCCTCGCTGATCCGCGTCGCCACTGCTGTTGGCTACCGCGTCCGCGCTCAGCTGCGTAACCTCGAGGGCGTC
GTCGCTACCGAAGTCTCGACCAACTCAAACGTCACCGTCCTTGTCGGCGAGCTCTACACCCGCCACGACGAGCCT
ACTACCGAAGATGTGACACAGGATGGGCCCTTGTCCGGCATCGGAGTCAACCATGAACTCATCTCCAACCTGTTC
CGCGGCGCTCAGCTGGCCTTTATAAACACCACATTTTACGGAGACGAGCTTGCCATTGGCATGGCCCTCGCCGAC
GCCGCAAAAGCCGCCGGCGTTCAGCACTATGTCTACTCGTCCATGCCCGATCACGCCGCCTACCACAAGGACTGG
CCGTCGTTGCCGCTCTGGGCTGCCAAGCACAAGGTCGAAGACTATGTCCGCGCTCTCGATCTGCCCGCCACCTTT
GTCTACACGGGCATCTATAATAACAACTTCACCTCACTCCTCTACCCGCTCTTCTGCATGGAGCTACAACCCGAC
GGCTCCTTTTTGTGGCAGGCGCCCTTTCACGAGGACGCCAAGCTGCCCTGGCTCGACGCCGAGCATGACGTCGGG
CCCGCCATCTTACAAATCTTCAAGGACGGCGTCACCAAGTGGAAGGGCGAGCGCGTCGCCCTGGCCTACGAGTAT
CTGACGCCCACCGAGGCCTGTCAGCTCTTTTCCCGCGGCGTCGGTCGTCCCGTCTACTATTCCCGCGGGCCCATC
GAGATCAAAGTACGCATCCCGACGGGCTATCGCCAGCAGCTCGAGGCCCTGGCCCGCCTCTTCAGGGCAGACGAG
CCCGACGTCCGAAAGCAGCCTCCCTACTTTGGCGACGCAAAGCTCGAGGCTAGCTGCCCGGCCGAGGCGCTCGAG
CTGTGGGAGGGACCCCGGGGGTTGGAGGAGTACGCGAGAGAGATGTTCCCGCTGGAAGAGGAGGCCAACGGCTTG
ACGTGGATGCTCGCCGACGACGACGGTCACGATCACGAGGACAAGGTTCACGCGACGGCTGCCTCGGTCGAGCAG
CTCAAGATCCACGACGACGAGTCGGACGACGAAGATGAGGGGCTGGTCATGAGGGGGCTGAAGCGAGACGAGGAG
CAATGGCTTGCGTGA
Gene >Ophun1|946
ATGCCGGCCCAAATCTCCGGCTCCGTCAAGGGCACGGCCCCGATCCGCATCGTCGACGACCAGACCAACGGTTAC
CGCAAGCAGCACAAGCATTCGCGCTCCTCCTACTCCGAGTCGTCGCCTCTCGCAGGCTCGCGCAACAACTCGCTG
ACGTTCCGCCCGCCCAAGAGGCTCAACTCGGCACCCAACAAGACCATTGCCGTCATCAACGCCAGCGGTCGTCAG
GCTGCCTCGCTGATCCGCGTCGCCACTGCTGTTGGCTACCGCGTCCGCGCTCAGCTGCGTAACCTCGAGGGCGTC
GTCGCTACCGAAGTCTCGACCAACTCAAACGTCACCGTCCTTGTCGGCGAGCTCTACACCCGCCACGACGAGCCT
ACTACCGAAGATGTGACACAGGATGGGCCCTTGTCCGGCATCGGAGTCAACCATGAACTCATCTCCAACCTGTTC
CGCGGCGCTCAGCTGGCCTTTATAAACACCACATTTTACGGAGACGAGCTTGCCATTGGCATGGCCCTCGCCGAC
GCCGCAAAAGCCGCCGGCGTTCAGCACTATGTCTACTCGTCCATGCCCGATCACGCCGCCTACCACAAGGACTGG
CCGTCGTTGCCGCTCTGGGCTGCCAAGCACAAGGTCGAAGACTATGTCCGCGCTCTCGATCTGCCCGCCACCTTT
GTCTACACGGGCATCTATAATAACAACTTCACCTCACTCCTCTACCCGCTCTTCTGCATGGAGCTACAACCCGAC
GGCTCCTTTTTGTGGCAGGCGCCCTTTCACGAGGACGCCAAGCTGCCCTGGCTCGACGCCGAGCATGACGTCGGG
CCCGCCATCTTACAAATCTTCAAGGACGGCGTCACCAAGTGGAAGGGCGAGCGCGTCGCCCTGGCCTACGAGTAT
CTGACGCCCACCGAGGCCTGTCAGCTCTTTTCCCGCGGCGTCGGTCGTCCCGTCTACTATTCCCGCGGGCCCATC
GAGATCAAAGTACGCATCCCGACGGGCTATCGCCAGCAGCTCGAGGCCCTGGCCCGCCTCTTCAGGGCAGACGAG
CCCGACGTCCGAAAGCAGCCTCCCTACTTTGGCGACGCAAAGCTCGAGGCTAGCTGCCCGGCCGAGGCGCTCGAG
CTGTGGGAGGGACCCCGGGGGTTGGAGGAGTACGCGAGAGAGATGTTCCCGCTGGAAGAGGAGGCCAACGGCTTG
ACGTGGATGCTCGCCGACGACGACGGTCACGATCACGAGGACAAGGTTCACGCGACGGCTGCCTCGGTCGAGCAG
CTCAAGATCCACGACGACGAGTCGGACGACGAAGATGAGGGGCTGGTCATGAGGGGGCTGAAGCGAGACGAGGAG
CAATGGCTTGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail