Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|945
Gene name
LocationContig_1339:290..749
Strand+
Gene length (bp)459
Transcript length (bp)393
Coding sequence length (bp)393
Protein length (aa) 131

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04622 ERG2_Sigma1R ERG2 and Sigma1 receptor like protein 1.3E-69 1 129

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q92254|ERG2_NEUCR C-8 sterol isomerase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erg-1 PE=3 SV=2 1 129 1.0E-68
sp|P33281|ERG2_MAGO7 C-8 sterol isomerase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ERG2 PE=3 SV=1 1 129 4.0E-68
sp|P32360|ERG2_USTMA C-8 sterol isomerase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ERG2 PE=3 SV=1 1 129 1.0E-50
sp|P32352|ERG2_YEAST C-8 sterol isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG2 PE=1 SV=1 1 129 3.0E-50
sp|P87113|ERG2_SCHPO C-8 sterol isomerase erg2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg2 PE=3 SV=1 1 129 4.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q92254|ERG2_NEUCR C-8 sterol isomerase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erg-1 PE=3 SV=2 1 129 1.0E-68
sp|P33281|ERG2_MAGO7 C-8 sterol isomerase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ERG2 PE=3 SV=1 1 129 4.0E-68
sp|P32360|ERG2_USTMA C-8 sterol isomerase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ERG2 PE=3 SV=1 1 129 1.0E-50
sp|P32352|ERG2_YEAST C-8 sterol isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG2 PE=1 SV=1 1 129 3.0E-50
sp|P87113|ERG2_SCHPO C-8 sterol isomerase erg2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg2 PE=3 SV=1 1 129 4.0E-37
sp|Q66IM1|SGMR1_XENTR Sigma non-opioid intracellular receptor 1 OS=Xenopus tropicalis GN=sigmar1 PE=2 SV=1 1 121 1.0E-22
sp|Q645J3|SGMR1_TARGR Sigma non-opioid intracellular receptor 1 OS=Taricha granulosa GN=SIGMAR1 PE=2 SV=1 1 121 2.0E-22
sp|Q5ZL84|SGMR1_CHICK Sigma non-opioid intracellular receptor 1 OS=Gallus gallus GN=SIGMAR1 PE=2 SV=1 1 114 3.0E-22
sp|Q6DCU6|SGMR1_XENLA Sigma non-opioid intracellular receptor 1 OS=Xenopus laevis GN=sigmar1 PE=2 SV=1 1 121 3.0E-22
sp|Q7ZWG9|SGMR1_DANRE Sigma non-opioid intracellular receptor 1 OS=Danio rerio GN=sigmar1 PE=2 SV=1 1 121 1.0E-20
sp|O55242|SGMR1_MOUSE Sigma non-opioid intracellular receptor 1 OS=Mus musculus GN=Sigmar1 PE=1 SV=1 1 119 1.0E-20
sp|Q5PXE2|SGMR1_TRIVU Sigma non-opioid intracellular receptor 1 OS=Trichosurus vulpecula GN=SIGMAR1 PE=2 SV=1 1 119 3.0E-20
sp|Q5PXE3|SGMR1_MUSER Sigma non-opioid intracellular receptor 1 OS=Mustela erminea GN=SIGMAR1 PE=2 SV=1 1 119 3.0E-20
sp|Q99720|SGMR1_HUMAN Sigma non-opioid intracellular receptor 1 OS=Homo sapiens GN=SIGMAR1 PE=1 SV=1 1 119 3.0E-20
sp|Q58DH7|SGMR1_BOVIN Sigma non-opioid intracellular receptor 1 OS=Bos taurus GN=SIGMAR1 PE=2 SV=1 1 119 3.0E-20
sp|Q9R0C9|SGMR1_RAT Sigma non-opioid intracellular receptor 1 OS=Rattus norvegicus GN=Sigmar1 PE=1 SV=1 1 119 4.0E-20
sp|Q60492|SGMR1_CAVPO Sigma non-opioid intracellular receptor 1 OS=Cavia porcellus GN=SIGMAR1 PE=1 SV=1 1 121 1.0E-19
sp|Q55BU8|ERG2_DICDI Protein erg2 homolog OS=Dictyostelium discoideum GN=erg2 PE=3 SV=1 1 130 2.0E-17
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|945
MGAMLVLHASITEYLIIFGTTIGTEGHTGRHTADDYFHILTGVQEAYTPGSFAPEVYTPGSVHHLRRGEAKQYKM
PGSCFALEYARGWIPPMLFFGFADGVTSTLDFVTLWETVVVSARQMGGHLLRGKI*
Coding >Ophun1|945
ATGGGAGCGATGCTCGTTTTACATGCTAGTATAACGGAGTATCTCATCATCTTCGGCACAACCATCGGAACAGAA
GGCCACACCGGCCGCCACACCGCCGACGACTACTTCCACATCCTAACCGGCGTGCAAGAAGCCTACACGCCCGGC
AGCTTCGCGCCCGAGGTCTACACGCCGGGAAGCGTGCACCACCTGCGCCGCGGCGAGGCCAAGCAGTACAAGATG
CCCGGGTCGTGCTTCGCGCTCGAGTACGCGCGCGGGTGGATCCCGCCCATGCTGTTCTTTGGCTTCGCGGATGGG
GTGACTAGCACGCTGGACTTCGTGACGCTTTGGGAGACGGTTGTTGTTTCGGCGAGGCAGATGGGGGGGCATTTG
CTGAGGGGGAAGATTTAG
Transcript >Ophun1|945
ATGGGAGCGATGCTCGTTTTACATGCTAGTATAACGGAGTATCTCATCATCTTCGGCACAACCATCGGAACAGAA
GGCCACACCGGCCGCCACACCGCCGACGACTACTTCCACATCCTAACCGGCGTGCAAGAAGCCTACACGCCCGGC
AGCTTCGCGCCCGAGGTCTACACGCCGGGAAGCGTGCACCACCTGCGCCGCGGCGAGGCCAAGCAGTACAAGATG
CCCGGGTCGTGCTTCGCGCTCGAGTACGCGCGCGGGTGGATCCCGCCCATGCTGTTCTTTGGCTTCGCGGATGGG
GTGACTAGCACGCTGGACTTCGTGACGCTTTGGGAGACGGTTGTTGTTTCGGCGAGGCAGATGGGGGGGCATTTG
CTGAGGGGGAAGATTTAG
Gene >Ophun1|945
ATGGGAGCGATGCTCGTTTTACATGCTAGTCCGTTCCCCCCCCCTTCTTTTCTTCACGATGATGATGATGATGAT
GATGCTGATGATGGGGTAGGTATAACGGAGTATCTCATCATCTTCGGCACAACCATCGGAACAGAAGGCCACACC
GGCCGCCACACCGCCGACGACTACTTCCACATCCTAACCGGCGTGCAAGAAGCCTACACGCCCGGCAGCTTCGCG
CCCGAGGTCTACACGCCGGGAAGCGTGCACCACCTGCGCCGCGGCGAGGCCAAGCAGTACAAGATGCCCGGGTCG
TGCTTCGCGCTCGAGTACGCGCGCGGGTGGATCCCGCCCATGCTGTTCTTTGGCTTCGCGGATGGGGTGACTAGC
ACGCTGGACTTCGTGACGCTTTGGGAGACGGTTGTTGTTTCGGCGAGGCAGATGGGGGGGCATTTGCTGAGGGGG
AAGATTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail