Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|940
Gene name
LocationContig_1335:620..2134
Strand+
Gene length (bp)1514
Transcript length (bp)1410
Coding sequence length (bp)1410
Protein length (aa) 470

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06398 Pex24p Integral peroxisomal membrane peroxin 9.5E-88 61 455

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q03370|PEX29_YEAST Peroxisomal membrane protein PEX29 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX29 PE=1 SV=1 26 406 3.0E-45
sp|P38848|PEX28_YEAST Peroxisomal membrane protein PEX28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX28 PE=1 SV=1 28 406 2.0E-33

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 115 137 22
2 218 240 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|940
MDDDDDAQPPPSESSGLSAMRERTGLQDRLVNKLLQQVIPSDGGSQPSDSKAGSSPFPQRPGFNLTTMSYNFRHF
NARIGVVFRFQAKAERLLSWRRPTQTLSMLAVYSFVCLDPHLLPVLPLVVLLLGVLVPAFVARHPAPPKGTLSSE
QAVGYSPHGPPLAPPAPTVRPPAKELSRDFFRNMRDLQNSMADFSHAHDRIVKLVVPVTDFSDEALSSTVFHILV
VAALVMALAAHVVPWRLIFFVGGWSLVLSRHPRIKPLVRSRLRRPTPPKHLDGNPQPRDDDSLSLLDRWTASDVI
LDSAPETREAEIFELQRADPDAAAWEPWLFSPEPYDPLSPSRIAGHRPRGSRFFEDVLPPPGWHWSEKKWALDLW
SREWVEDRIITGVEVETEGERWVYDMFDDRQGRIGVVDYSQPPNSPKKQADASAQPSWEEGDDEEGGGRRGEWRR
RRWVRLVKRRAVLPSAVTA*
Coding >Ophun1|940
ATGGACGACGATGATGATGCCCAGCCACCCCCGTCAGAGTCCTCTGGCCTCTCTGCCATGCGTGAGAGGACCGGG
CTGCAGGATCGACTGGTTAACAAACTGCTTCAGCAGGTAATCCCCTCCGACGGCGGCAGCCAACCGTCCGACTCG
AAAGCCGGCTCTTCTCCCTTCCCGCAGCGCCCGGGCTTCAACCTGACGACCATGTCGTATAACTTCCGGCACTTC
AACGCCCGCATCGGCGTCGTCTTCCGCTTCCAAGCCAAGGCCGAACGGCTGCTATCATGGCGGCGTCCCACGCAG
ACGCTGTCGATGCTAGCCGTCTACTCCTTCGTCTGCCTCGATCCTCACCTCCTGCCCGTGTTACCGCTGGTAGTC
CTCCTCCTCGGCGTCCTGGTCCCGGCCTTTGTGGCCCGGCATCCCGCGCCGCCCAAGGGCACGCTCTCGAGCGAG
CAGGCCGTCGGATACTCGCCTCATGGCCCGCCTCTTGCGCCGCCCGCGCCGACGGTCCGGCCGCCAGCCAAGGAG
CTGAGCCGTGACTTCTTCCGCAACATGCGCGATCTACAGAACAGCATGGCCGACTTCTCCCACGCCCACGACCGC
ATCGTCAAGCTCGTCGTGCCCGTCACCGACTTTAGCGACGAGGCCCTCTCCTCGACAGTCTTCCACATCCTCGTC
GTCGCCGCCCTCGTCATGGCGCTGGCCGCCCACGTCGTCCCCTGGCGCCTCATCTTCTTCGTCGGCGGCTGGTCC
CTCGTCCTTTCACGCCATCCGCGCATCAAGCCCCTCGTCCGCAGCCGGCTCCGGAGGCCGACTCCGCCGAAACAC
CTCGACGGCAACCCCCAACCACGAGACGACGACTCCCTCTCGCTGCTCGACCGCTGGACAGCCTCTGACGTCATC
CTCGACTCTGCGCCCGAGACGCGCGAGGCTGAAATCTTTGAGCTCCAGCGCGCCGACCCGGACGCAGCCGCCTGG
GAGCCCTGGCTCTTCTCGCCGGAGCCCTACGATCCGCTCTCGCCCTCGCGCATCGCCGGCCACCGTCCACGAGGA
TCGCGCTTCTTCGAGGACGTCCTGCCACCGCCAGGATGGCACTGGAGCGAGAAGAAGTGGGCTCTCGACCTCTGG
AGCCGCGAGTGGGTCGAGGATCGCATCATCACCGGCGTCGAGGTCGAGACCGAGGGCGAGCGCTGGGTGTACGAT
ATGTTCGACGACCGTCAGGGCCGCATCGGAGTCGTCGACTACTCTCAGCCACCCAACTCCCCAAAGAAGCAGGCC
GATGCCTCGGCGCAACCCAGCTGGGAGGAGGGCGATGACGAAGAGGGCGGTGGCAGGAGAGGCGAGTGGCGGAGG
AGGAGATGGGTGAGGTTGGTCAAGAGACGAGCCGTCTTGCCATCGGCAGTCACGGCCTGA
Transcript >Ophun1|940
ATGGACGACGATGATGATGCCCAGCCACCCCCGTCAGAGTCCTCTGGCCTCTCTGCCATGCGTGAGAGGACCGGG
CTGCAGGATCGACTGGTTAACAAACTGCTTCAGCAGGTAATCCCCTCCGACGGCGGCAGCCAACCGTCCGACTCG
AAAGCCGGCTCTTCTCCCTTCCCGCAGCGCCCGGGCTTCAACCTGACGACCATGTCGTATAACTTCCGGCACTTC
AACGCCCGCATCGGCGTCGTCTTCCGCTTCCAAGCCAAGGCCGAACGGCTGCTATCATGGCGGCGTCCCACGCAG
ACGCTGTCGATGCTAGCCGTCTACTCCTTCGTCTGCCTCGATCCTCACCTCCTGCCCGTGTTACCGCTGGTAGTC
CTCCTCCTCGGCGTCCTGGTCCCGGCCTTTGTGGCCCGGCATCCCGCGCCGCCCAAGGGCACGCTCTCGAGCGAG
CAGGCCGTCGGATACTCGCCTCATGGCCCGCCTCTTGCGCCGCCCGCGCCGACGGTCCGGCCGCCAGCCAAGGAG
CTGAGCCGTGACTTCTTCCGCAACATGCGCGATCTACAGAACAGCATGGCCGACTTCTCCCACGCCCACGACCGC
ATCGTCAAGCTCGTCGTGCCCGTCACCGACTTTAGCGACGAGGCCCTCTCCTCGACAGTCTTCCACATCCTCGTC
GTCGCCGCCCTCGTCATGGCGCTGGCCGCCCACGTCGTCCCCTGGCGCCTCATCTTCTTCGTCGGCGGCTGGTCC
CTCGTCCTTTCACGCCATCCGCGCATCAAGCCCCTCGTCCGCAGCCGGCTCCGGAGGCCGACTCCGCCGAAACAC
CTCGACGGCAACCCCCAACCACGAGACGACGACTCCCTCTCGCTGCTCGACCGCTGGACAGCCTCTGACGTCATC
CTCGACTCTGCGCCCGAGACGCGCGAGGCTGAAATCTTTGAGCTCCAGCGCGCCGACCCGGACGCAGCCGCCTGG
GAGCCCTGGCTCTTCTCGCCGGAGCCCTACGATCCGCTCTCGCCCTCGCGCATCGCCGGCCACCGTCCACGAGGA
TCGCGCTTCTTCGAGGACGTCCTGCCACCGCCAGGATGGCACTGGAGCGAGAAGAAGTGGGCTCTCGACCTCTGG
AGCCGCGAGTGGGTCGAGGATCGCATCATCACCGGCGTCGAGGTCGAGACCGAGGGCGAGCGCTGGGTGTACGAT
ATGTTCGACGACCGTCAGGGCCGCATCGGAGTCGTCGACTACTCTCAGCCACCCAACTCCCCAAAGAAGCAGGCC
GATGCCTCGGCGCAACCCAGCTGGGAGGAGGGCGATGACGAAGAGGGCGGTGGCAGGAGAGGCGAGTGGCGGAGG
AGGAGATGGGTGAGGTTGGTCAAGAGACGAGCCGTCTTGCCATCGGCAGTCACGGCCTGA
Gene >Ophun1|940
ATGGACGACGATGATGATGCCCAGCCACCCCCGTCAGAGTCCTCTGGCCTCTCTGCCATGCGTGAGAGGACCGGG
CTGCAGGATCGACTGGTTAACAAGTGCGCTCGGCTCCTCCTCTCCGGAGAACACCACGTCCCCCATCTCGATAAC
CCAATCCATCATCGTCGAAAAAGACAGTCGACTAACCACTTCCATTCCTCAGACTGCTTCAGCAGGTAATCCCCT
CCGACGGCGGCAGCCAACCGTCCGACTCGAAAGCCGGCTCTTCTCCCTTCCCGCAGCGCCCGGGCTTCAACCTGA
CGACCATGTCGTATAACTTCCGGCACTTCAACGCCCGCATCGGCGTCGTCTTCCGCTTCCAAGCCAAGGCCGAAC
GGCTGCTATCATGGCGGCGTCCCACGCAGACGCTGTCGATGCTAGCCGTCTACTCCTTCGTCTGCCTCGATCCTC
ACCTCCTGCCCGTGTTACCGCTGGTAGTCCTCCTCCTCGGCGTCCTGGTCCCGGCCTTTGTGGCCCGGCATCCCG
CGCCGCCCAAGGGCACGCTCTCGAGCGAGCAGGCCGTCGGATACTCGCCTCATGGCCCGCCTCTTGCGCCGCCCG
CGCCGACGGTCCGGCCGCCAGCCAAGGAGCTGAGCCGTGACTTCTTCCGCAACATGCGCGATCTACAGAACAGCA
TGGCCGACTTCTCCCACGCCCACGACCGCATCGTCAAGCTCGTCGTGCCCGTCACCGACTTTAGCGACGAGGCCC
TCTCCTCGACAGTCTTCCACATCCTCGTCGTCGCCGCCCTCGTCATGGCGCTGGCCGCCCACGTCGTCCCCTGGC
GCCTCATCTTCTTCGTCGGCGGCTGGTCCCTCGTCCTTTCACGCCATCCGCGCATCAAGCCCCTCGTCCGCAGCC
GGCTCCGGAGGCCGACTCCGCCGAAACACCTCGACGGCAACCCCCAACCACGAGACGACGACTCCCTCTCGCTGC
TCGACCGCTGGACAGCCTCTGACGTCATCCTCGACTCTGCGCCCGAGACGCGCGAGGCTGAAATCTTTGAGCTCC
AGCGCGCCGACCCGGACGCAGCCGCCTGGGAGCCCTGGCTCTTCTCGCCGGAGCCCTACGATCCGCTCTCGCCCT
CGCGCATCGCCGGCCACCGTCCACGAGGATCGCGCTTCTTCGAGGACGTCCTGCCACCGCCAGGATGGCACTGGA
GCGAGAAGAAGTGGGCTCTCGACCTCTGGAGCCGCGAGTGGGTCGAGGATCGCATCATCACCGGCGTCGAGGTCG
AGACCGAGGGCGAGCGCTGGGTGTACGATATGTTCGACGACCGTCAGGGCCGCATCGGAGTCGTCGACTACTCTC
AGCCACCCAACTCCCCAAAGAAGCAGGCCGATGCCTCGGCGCAACCCAGCTGGGAGGAGGGCGATGACGAAGAGG
GCGGTGGCAGGAGAGGCGAGTGGCGGAGGAGGAGATGGGTGAGGTTGGTCAAGAGACGAGCCGTCTTGCCATCGG
CAGTCACGGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail