Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|936
Gene name
LocationContig_133:31882..33333
Strand+
Gene length (bp)1451
Transcript length (bp)1335
Coding sequence length (bp)1335
Protein length (aa) 445

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03151 TPT Triose-phosphate Transporter family 6.9E-20 118 375

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SUV2|PT432_ARATH Probable sugar phosphate/phosphate translocator At4g32390 OS=Arabidopsis thaliana GN=At4g32390 PE=3 SV=1 51 407 1.0E-49
sp|Q3E6T0|PT525_ARATH Probable sugar phosphate/phosphate translocator At5g25400 OS=Arabidopsis thaliana GN=At5g25400 PE=2 SV=1 51 407 1.0E-48
sp|Q9LFN3|PT511_ARATH Probable sugar phosphate/phosphate translocator At5g11230 OS=Arabidopsis thaliana GN=At5g11230 PE=2 SV=1 51 375 6.0E-48
sp|Q9SKJ7|PT225_ARATH Probable sugar phosphate/phosphate translocator At2g25520 OS=Arabidopsis thaliana GN=At2g25520 PE=1 SV=1 51 407 3.0E-47
sp|Q9LRP2|PT317_ARATH Probable sugar phosphate/phosphate translocator At3g17430 OS=Arabidopsis thaliana GN=At3g17430 PE=1 SV=1 117 386 3.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SUV2|PT432_ARATH Probable sugar phosphate/phosphate translocator At4g32390 OS=Arabidopsis thaliana GN=At4g32390 PE=3 SV=1 51 407 1.0E-49
sp|Q3E6T0|PT525_ARATH Probable sugar phosphate/phosphate translocator At5g25400 OS=Arabidopsis thaliana GN=At5g25400 PE=2 SV=1 51 407 1.0E-48
sp|Q9LFN3|PT511_ARATH Probable sugar phosphate/phosphate translocator At5g11230 OS=Arabidopsis thaliana GN=At5g11230 PE=2 SV=1 51 375 6.0E-48
sp|Q9SKJ7|PT225_ARATH Probable sugar phosphate/phosphate translocator At2g25520 OS=Arabidopsis thaliana GN=At2g25520 PE=1 SV=1 51 407 3.0E-47
sp|Q9LRP2|PT317_ARATH Probable sugar phosphate/phosphate translocator At3g17430 OS=Arabidopsis thaliana GN=At3g17430 PE=1 SV=1 117 386 3.0E-38
sp|Q9LNH5|PT148_ARATH Probable sugar phosphate/phosphate translocator At1g48230 OS=Arabidopsis thaliana GN=At1g48230 PE=2 SV=2 117 375 5.0E-34
sp|Q9C8M1|PT153_ARATH Probable sugar phosphate/phosphate translocator At1g53660 OS=Arabidopsis thaliana GN=At1g53660 PE=3 SV=2 119 375 6.0E-33
sp|Q94EI9|PT314_ARATH Probable sugar phosphate/phosphate translocator At3g14410 OS=Arabidopsis thaliana GN=At3g14410 PE=2 SV=1 51 375 4.0E-32
sp|Q8H184|PT106_ARATH Probable sugar phosphate/phosphate translocator At1g06470 OS=Arabidopsis thaliana GN=At1g06470 PE=2 SV=1 152 383 5.0E-21
sp|Q9SFE9|GONS5_ARATH GDP-mannose transporter GONST5 OS=Arabidopsis thaliana GN=GONST5 PE=2 SV=1 119 388 4.0E-17
sp|Q9C521|UGAL1_ARATH UDP-galactose transporter 1 OS=Arabidopsis thaliana GN=UDP-GALT1 PE=2 SV=1 119 387 1.0E-16
sp|Q9LDH3|PT112_ARATH Probable sugar phosphate/phosphate translocator At1g12500 OS=Arabidopsis thaliana GN=At1g12500 PE=1 SV=1 117 375 9.0E-13
sp|Q9NQQ7|S35C2_HUMAN Solute carrier family 35 member C2 OS=Homo sapiens GN=SLC35C2 PE=1 SV=2 154 374 2.0E-12
sp|Q8VCX2|S35C2_MOUSE Solute carrier family 35 member C2 OS=Mus musculus GN=Slc35c2 PE=1 SV=1 154 374 6.0E-12
sp|Q5VQL3|PPT3_ORYSJ Phosphoenolpyruvate/phosphate translocator 3, chloroplastic OS=Oryza sativa subsp. japonica GN=PPT3 PE=2 SV=1 146 375 3.0E-11
sp|Q6DBP3|PT505_ARATH Probable sugar phosphate/phosphate translocator At5g05820 OS=Arabidopsis thaliana GN=At5g05820 PE=2 SV=1 147 375 3.0E-10
sp|P0CK96|S352B_HUMAN Solute carrier family 35 member E2B OS=Homo sapiens GN=SLC35E2B PE=2 SV=1 50 395 1.0E-09
sp|Q9SS40|PT310_ARATH Probable sugar phosphate/phosphate translocator At3g10290 OS=Arabidopsis thaliana GN=At3g10290 PE=3 SV=1 147 374 4.0E-09
sp|Q10354|YDB1_SCHPO Uncharacterized transporter C22E12.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22E12.01 PE=3 SV=2 216 386 1.0E-08
sp|Q5XF09|PT311_ARATH Probable sugar phosphate/phosphate translocator At3g11320 OS=Arabidopsis thaliana GN=At3g11320 PE=2 SV=1 152 375 2.0E-08
sp|Q9FYE5|PT504_ARATH Probable sugar phosphate/phosphate translocator At5g04160 OS=Arabidopsis thaliana GN=At5g04160 PE=2 SV=1 117 374 3.0E-08
sp|Q84QU8|PPT2_ORYSJ Phosphoenolpyruvate/phosphate translocator 2, chloroplastic OS=Oryza sativa subsp. japonica GN=PPT2 PE=2 SV=1 155 375 4.0E-07
sp|Q8C811|S35E2_MOUSE Solute carrier family 35 member E2 OS=Mus musculus GN=Slc35e2 PE=2 SV=1 50 402 9.0E-07
sp|Q94B38|GPT2_ARATH Glucose-6-phosphate/phosphate translocator 2, chloroplastic OS=Arabidopsis thaliana GN=GPT2 PE=2 SV=2 148 375 1.0E-06
sp|Q9M5A9|GPT1_ARATH Glucose-6-phosphate/phosphate translocator 1, chloroplastic OS=Arabidopsis thaliana GN=GPT1 PE=2 SV=1 146 375 3.0E-06
sp|Q6PGC7|S35E3_MOUSE Solute carrier family 35 member E3 OS=Mus musculus GN=Slc35e3 PE=2 SV=1 165 375 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.5

Transmembrane Domains

Domain # Start End Length
1 111 133 22
2 153 172 19
3 179 201 22
4 211 228 17
5 235 254 19
6 269 291 22
7 303 325 22
8 330 352 22
9 359 378 19
10 404 426 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|936
MAPTSSPSSSADASPVLSQSSTDVFDMGYDEHAVDKAPEPSPSKGVHPALYIANWIFFSNLTILFNKWILDSAGF
SELPPSSPVTDVRKLTALNRIPYVVSRARQTAEPSLTVLAAILLTCWHLVFSVVATQILARSTTLLDSRHKLPMT
PRLYLRTICPIGLFYSGSLVCSNLVYLYLSVAFIQMLKSAAPVAVLFASWAWRVADPSLDALVNVLVIVAGVALA
SFGEIQFSLIGFLYQLGGIVFEAVRIVMIQVMLSGQGLNMDPIVGLYYYAPVCAGMNILVALFTEIPRFKWEDAA
SVGFFMLILNALVAFMLNIASVFLIGKTSGLVMTLSGILKNILLIVVSVIIWRTEITPLQGVGYTIALAGLTYYS
VGYDQLAKCSQGAVAWMAASMPPSTSTLQARRLVLIAIFALTGLLVLLVGLQRFDGRTGYSPRVDVGTE*
Coding >Ophun1|936
ATGGCTCCGACGTCGTCTCCTTCGTCGTCTGCCGACGCCTCGCCCGTTCTCTCTCAATCGTCGACCGATGTCTTC
GACATGGGCTATGACGAGCATGCAGTTGATAAAGCACCCGAGCCGTCGCCTTCTAAGGGCGTGCATCCCGCGCTA
TACATTGCGAATTGGATCTTCTTCTCAAACCTCACCATATTGTTTAACAAATGGATACTCGACTCTGCTGGCTTC
AGTGAGCTCCCCCCGTCTTCCCCCGTCACAGACGTCCGCAAGCTAACAGCCCTCAACAGGATACCGTACGTCGTC
TCCCGAGCTCGGCAGACAGCAGAGCCCTCGCTGACAGTCCTCGCAGCCATCCTCCTGACGTGCTGGCATCTCGTC
TTCTCCGTCGTCGCCACCCAAATCCTCGCTCGTTCGACGACGCTCCTCGACTCGCGCCACAAGCTGCCCATGACG
CCCCGTCTCTACCTCCGCACCATCTGCCCCATCGGCCTCTTCTACTCGGGCTCCCTCGTCTGCTCCAACCTCGTG
TACCTCTACCTCTCCGTCGCCTTTATCCAGATGCTCAAATCGGCTGCCCCTGTCGCCGTTCTCTTCGCTTCGTGG
GCATGGCGCGTCGCCGATCCGAGCCTGGACGCTCTGGTCAACGTCCTCGTCATCGTCGCCGGCGTCGCCCTCGCC
TCCTTTGGTGAGATTCAATTCTCCCTCATTGGCTTTCTCTACCAGCTGGGTGGCATCGTCTTCGAGGCTGTCCGC
ATTGTCATGATCCAGGTCATGCTCAGCGGCCAGGGCCTCAACATGGATCCCATCGTCGGCCTCTACTACTATGCC
CCCGTCTGCGCCGGCATGAACATCCTTGTCGCGCTCTTCACCGAGATTCCCCGCTTCAAGTGGGAGGACGCGGCC
AGCGTTGGCTTCTTCATGCTCATCCTCAACGCCCTCGTCGCCTTTATGCTCAACATCGCTAGTGTATTCCTGATC
GGCAAGACGTCAGGCCTCGTCATGACGCTAAGTGGCATCCTAAAGAACATTCTACTCATCGTTGTCTCAGTCATC
ATCTGGCGCACCGAAATCACCCCCCTCCAAGGCGTCGGCTACACCATCGCCCTGGCCGGCCTCACCTACTACTCC
GTCGGCTACGACCAGCTAGCCAAGTGCTCGCAAGGAGCCGTCGCCTGGATGGCAGCCTCGATGCCGCCCTCGACC
TCGACGCTACAGGCCCGCAGGCTCGTCCTCATCGCCATCTTCGCCCTCACGGGTCTTCTGGTCCTGCTCGTCGGC
CTGCAGCGCTTCGACGGGAGAACCGGATATTCTCCCAGGGTCGATGTTGGCACCGAGTGA
Transcript >Ophun1|936
ATGGCTCCGACGTCGTCTCCTTCGTCGTCTGCCGACGCCTCGCCCGTTCTCTCTCAATCGTCGACCGATGTCTTC
GACATGGGCTATGACGAGCATGCAGTTGATAAAGCACCCGAGCCGTCGCCTTCTAAGGGCGTGCATCCCGCGCTA
TACATTGCGAATTGGATCTTCTTCTCAAACCTCACCATATTGTTTAACAAATGGATACTCGACTCTGCTGGCTTC
AGTGAGCTCCCCCCGTCTTCCCCCGTCACAGACGTCCGCAAGCTAACAGCCCTCAACAGGATACCGTACGTCGTC
TCCCGAGCTCGGCAGACAGCAGAGCCCTCGCTGACAGTCCTCGCAGCCATCCTCCTGACGTGCTGGCATCTCGTC
TTCTCCGTCGTCGCCACCCAAATCCTCGCTCGTTCGACGACGCTCCTCGACTCGCGCCACAAGCTGCCCATGACG
CCCCGTCTCTACCTCCGCACCATCTGCCCCATCGGCCTCTTCTACTCGGGCTCCCTCGTCTGCTCCAACCTCGTG
TACCTCTACCTCTCCGTCGCCTTTATCCAGATGCTCAAATCGGCTGCCCCTGTCGCCGTTCTCTTCGCTTCGTGG
GCATGGCGCGTCGCCGATCCGAGCCTGGACGCTCTGGTCAACGTCCTCGTCATCGTCGCCGGCGTCGCCCTCGCC
TCCTTTGGTGAGATTCAATTCTCCCTCATTGGCTTTCTCTACCAGCTGGGTGGCATCGTCTTCGAGGCTGTCCGC
ATTGTCATGATCCAGGTCATGCTCAGCGGCCAGGGCCTCAACATGGATCCCATCGTCGGCCTCTACTACTATGCC
CCCGTCTGCGCCGGCATGAACATCCTTGTCGCGCTCTTCACCGAGATTCCCCGCTTCAAGTGGGAGGACGCGGCC
AGCGTTGGCTTCTTCATGCTCATCCTCAACGCCCTCGTCGCCTTTATGCTCAACATCGCTAGTGTATTCCTGATC
GGCAAGACGTCAGGCCTCGTCATGACGCTAAGTGGCATCCTAAAGAACATTCTACTCATCGTTGTCTCAGTCATC
ATCTGGCGCACCGAAATCACCCCCCTCCAAGGCGTCGGCTACACCATCGCCCTGGCCGGCCTCACCTACTACTCC
GTCGGCTACGACCAGCTAGCCAAGTGCTCGCAAGGAGCCGTCGCCTGGATGGCAGCCTCGATGCCGCCCTCGACC
TCGACGCTACAGGCCCGCAGGCTCGTCCTCATCGCCATCTTCGCCCTCACGGGTCTTCTGGTCCTGCTCGTCGGC
CTGCAGCGCTTCGACGGGAGAACCGGATATTCTCCCAGGGTCGATGTTGGCACCGAGTGA
Gene >Ophun1|936
ATGGCTCCGACGTCGTCTCCTTCGTCGTCTGCCGACGCCTCGCCCGTTCTCTCTCAATCGTCGACCGATGTCTTC
GACATGGGCTATGACGAGCATGCAGTTGATAAAGCACCCGAGCCGTCGCCTTCTAAGGGCGTGCATCCCGCGCTA
TACATTGCGTACGACCGCTTCGTTTCCTTTACCGACGGCGCTGACTCTCGGTCACAGGAATTGGATCTTCTTCTC
AAACCTCACCATATTGTTTAACAAATGGATACTCGACTCTGCTGGCTTCAGTGAGCTCCCCCCGTCTTCCCCCGT
CACAGACGTCCGCAAGCTAACAGCCCTCAACAGGATACCGTACGTCGTCTCCCGAGCTCGGCAGACAGCAGAGCC
CTCGCTGACAGTCCTCGCAGCCATCCTCCTGACGTGCTGGCATCTCGTCTTCTCCGTCGTCGCCACCCAAATCCT
CGCTCGTTCGACGACGCTCCTCGACTCGCGCCACAAGCTGCCCATGACGCCCCGTCTCTACCTCCGCACCATCTG
CCCCATCGGCCTCTTCTACTCGGGCTCCCTCGTCTGCTCCAACCTCGTGTACCTCTACCTCTCCGTCGCCTTTAT
CCAGATGCTCAAATCGGCTGCCCCTGTCGCCGTTCTCTTCGCTTCGTGGGCATGGCGCGTCGCCGATCCGAGCCT
GGACGCTCTGGTCAACGTCCTCGTCATCGTCGCCGGCGTCGCCCTCGCCTCCTTTGGTGAGATTCAATTCTCCCT
CATTGGCTTTCTCTACCAGCTGGGTGGCATCGTCTTCGAGGCTGTCCGCATTGTCATGATCCAGGTCATGCTCAG
CGGCCAGGGCCTCAACATGGATCCCATCGTCGGCCTCTACTACTATGCCCCCGTCTGCGCCGGCATGAACATCCT
TGTCGCGCTCTTCACCGAGATTCCCCGCTTCAAGTGGGAGGACGCGGCCAGCGTTGGCTTCTTCATGCTCATCCT
CAACGCCCTCGTCGCCTTTATGCTCAACATCGCTAGTGTATTCCTGGTAAGGCGTCACCCACCCGCGCGATCCCC
TCCACATCAAGACAGGCTAACCGTCGGCGTATCTACAGATCGGCAAGACGTCAGGCCTCGTCATGACGCTAAGTG
GCATCCTAAAGAACATTCTACTCATCGTTGTCTCAGTCATCATCTGGCGCACCGAAATCACCCCCCTCCAAGGCG
TCGGCTACACCATCGCCCTGGCCGGCCTCACCTACTACTCCGTCGGCTACGACCAGCTAGCCAAGTGCTCGCAAG
GAGCCGTCGCCTGGATGGCAGCCTCGATGCCGCCCTCGACCTCGACGCTACAGGCCCGCAGGCTCGTCCTCATCG
CCATCTTCGCCCTCACGGGTCTTCTGGTCCTGCTCGTCGGCCTGCAGCGCTTCGACGGGAGAACCGGATATTCTC
CCAGGGTCGATGTTGGCACCGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail