Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|935
Gene name
LocationContig_133:28364..30365
Strand+
Gene length (bp)2001
Transcript length (bp)2001
Coding sequence length (bp)2001
Protein length (aa) 667

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00443 UCH Ubiquitin carboxyl-terminal hydrolase 2.3E-35 148 586
PF13423 UCH_1 Ubiquitin carboxyl-terminal hydrolase 3.1E-05 147 563

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P25037|UBP1_YEAST Ubiquitin carboxyl-terminal hydrolase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP1 PE=1 SV=2 147 476 1.0E-28
sp|Q9FPS0|UBP27_ARATH Ubiquitin carboxyl-terminal hydrolase 27 OS=Arabidopsis thaliana GN=UBP27 PE=2 SV=1 142 582 5.0E-17
sp|P25037|UBP1_YEAST Ubiquitin carboxyl-terminal hydrolase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP1 PE=1 SV=2 523 587 3.0E-09
sp|Q17361|UBP14_CAEEL Ubiquitin carboxyl-terminal hydrolase 14 OS=Caenorhabditis elegans GN=usp-14 PE=2 SV=2 425 587 4.0E-08
sp|Q9W462|UBP30_DROME Ubiquitin carboxyl-terminal hydrolase 30 homolog OS=Drosophila melanogaster GN=Usp30 PE=2 SV=1 386 587 5.0E-08

GO

GO Term Description Terminal node
GO:0004843 cysteine-type deubiquitinase activity Yes
GO:0016579 protein deubiquitination Yes
GO:0070647 protein modification by small protein conjugation or removal No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0070646 protein modification by small protein removal No
GO:0006508 proteolysis No
GO:0140096 catalytic activity, acting on a protein No
GO:0043170 macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:0043412 macromolecule modification No
GO:0036211 protein modification process No
GO:0008233 peptidase activity No
GO:0003674 molecular_function No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0019783 ubiquitin-like protein peptidase activity No
GO:0071704 organic substance metabolic process No
GO:0101005 deubiquitinase activity No
GO:0008234 cysteine-type peptidase activity No
GO:0006807 nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 49 71 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|935
MSFDRADPRNLHEDTVPRNHFYWNEPSIVLSLVVVLVALVAKNLGLQQALAGFFAFLQHLLWNSIVYVLPAPLVF
ALDHRLESTSSPRRALDQAQGGTHAAKSEAMRRILGLDNPGGVLASVSEARTRALSMTGSVLGLRSDSQRPAGLG
NRDNSCYQNSILQGLAALDSLPEFLSACVRAVGPQHEDDDVAQTLRDLLGDLNDSSNNGKTIWTPSLLKSMSTWT
QQDAQEYYSKLLDDIDKAVAKAVSESRRFSGLEADCGRDEAAASQHSDDSGYQSLPSGPDLSAIKPLRNPLEGLL
AQRVACVQCGFSEGLSMIPFNCLTLSLGLDKNRHDLFERLDAYSRVESIEGVDCPKCTLLKSQRLLKKLIDRIRD
GGAAEDQLHEPQRRLDAVEAALDEDDFDEKTLTERCKISSQAKVTSTKTKQIVIARPPQSLAIHVNRSVFDPSTF
DMIKNSAPLSFPLTLDLGPWCLGSSEDSEASIEAGNLTVGDADEVEERWQPGCPNASMIAGDTGPSRLTGPIYEL
RAVVTHAGRHENGHYICYRRVVGQTAEKSEGGWWRLSDHNVTMVDDDMIPALAPGVFMLLYDCVDPSMVPRGELD
SSEATARASSDGSSECTSGREDGGVWDGAELSFGTDSSPGRVPLPDSDDGGPDSETETETETELGL*
Coding >Ophun1|935
ATGAGTTTCGATCGCGCCGATCCCAGAAACCTGCACGAGGACACGGTGCCGCGCAACCATTTCTATTGGAACGAG
CCGAGCATCGTCCTGAGCCTTGTCGTTGTCCTGGTCGCTCTCGTCGCCAAAAATTTGGGCTTGCAGCAGGCGCTC
GCCGGCTTCTTCGCTTTCCTGCAACATCTGCTGTGGAACTCGATCGTATACGTTCTCCCTGCGCCCCTGGTGTTC
GCTTTGGACCATCGCCTCGAGTCCACATCCTCACCTCGTCGAGCGCTCGATCAAGCGCAAGGGGGAACCCATGCC
GCAAAGAGCGAAGCCATGAGAAGAATACTCGGTCTAGACAACCCCGGTGGTGTGTTGGCATCCGTGTCTGAAGCT
CGCACGAGGGCCCTGTCTATGACGGGCAGCGTCCTAGGCCTGAGATCGGACTCGCAGAGGCCGGCCGGTCTGGGC
AACCGAGACAACTCGTGCTACCAGAACAGCATACTTCAAGGCTTGGCGGCCCTCGATTCTTTGCCAGAGTTTCTT
TCTGCGTGCGTGCGTGCTGTCGGTCCGCAGCATGAAGACGACGATGTTGCTCAAACCCTACGAGACCTACTGGGT
GATCTCAACGACTCGTCCAACAACGGTAAAACCATCTGGACGCCGAGCTTGCTGAAATCGATGAGCACCTGGACC
CAGCAAGATGCACAGGAATACTACTCGAAGCTGCTCGACGACATCGACAAGGCCGTGGCCAAGGCCGTCAGCGAG
TCGCGCCGCTTCTCGGGCCTGGAAGCCGACTGTGGCAGGGATGAGGCGGCCGCAAGCCAGCACAGCGATGACAGT
GGCTATCAGAGCTTGCCGTCGGGCCCGGACCTGTCGGCAATCAAGCCGCTACGCAACCCGCTCGAGGGCCTGCTA
GCACAGCGAGTCGCGTGTGTCCAATGTGGATTCTCAGAAGGGCTCTCCATGATTCCTTTTAACTGCCTGACTCTC
AGCCTCGGCCTAGACAAAAATCGGCACGACCTCTTTGAGCGACTGGACGCCTACAGCCGCGTCGAAAGCATCGAA
GGCGTCGACTGCCCCAAATGTACGCTACTCAAGTCGCAGCGGCTTTTGAAGAAGCTCATCGATAGGATACGCGAC
GGTGGCGCGGCGGAGGATCAGCTGCACGAACCCCAGCGTCGGCTTGATGCGGTCGAAGCGGCGCTCGACGAGGAC
GACTTTGACGAAAAGACGCTAACGGAGAGGTGCAAGATTTCGAGCCAAGCAAAGGTCACCTCGACCAAGACGAAG
CAAATCGTCATCGCACGGCCGCCTCAGAGCCTCGCCATCCACGTTAACCGGTCCGTCTTCGATCCGTCGACGTTT
GATATGATCAAGAACTCGGCTCCGCTTAGCTTCCCGCTTACGCTCGATTTGGGGCCGTGGTGTCTGGGGAGCTCC
GAGGACTCGGAGGCGTCCATCGAGGCGGGCAACTTGACGGTGGGCGACGCCGATGAGGTCGAGGAGCGATGGCAG
CCGGGCTGCCCAAACGCGTCAATGATAGCTGGTGACACGGGCCCGTCAAGACTGACAGGGCCGATATACGAACTG
CGAGCAGTGGTGACGCACGCCGGACGGCATGAGAACGGTCACTATATCTGCTATCGACGAGTCGTCGGCCAGACG
GCGGAGAAGAGCGAAGGAGGGTGGTGGAGGCTCAGCGACCACAACGTGACCATGGTGGACGATGACATGATACCG
GCGTTGGCGCCCGGCGTCTTCATGCTGCTGTACGACTGCGTCGACCCGAGCATGGTGCCGCGCGGCGAGCTGGAC
TCTTCCGAGGCGACTGCGCGCGCCAGCAGTGACGGGTCGAGCGAGTGTACGTCTGGGCGTGAAGACGGAGGCGTA
TGGGATGGAGCAGAGCTGTCTTTCGGTACGGATTCCTCACCGGGGAGGGTCCCGCTACCGGACAGCGATGATGGC
GGTCCCGACTCTGAGACGGAGACGGAGACGGAGACGGAGCTGGGGCTATGA
Transcript >Ophun1|935
ATGAGTTTCGATCGCGCCGATCCCAGAAACCTGCACGAGGACACGGTGCCGCGCAACCATTTCTATTGGAACGAG
CCGAGCATCGTCCTGAGCCTTGTCGTTGTCCTGGTCGCTCTCGTCGCCAAAAATTTGGGCTTGCAGCAGGCGCTC
GCCGGCTTCTTCGCTTTCCTGCAACATCTGCTGTGGAACTCGATCGTATACGTTCTCCCTGCGCCCCTGGTGTTC
GCTTTGGACCATCGCCTCGAGTCCACATCCTCACCTCGTCGAGCGCTCGATCAAGCGCAAGGGGGAACCCATGCC
GCAAAGAGCGAAGCCATGAGAAGAATACTCGGTCTAGACAACCCCGGTGGTGTGTTGGCATCCGTGTCTGAAGCT
CGCACGAGGGCCCTGTCTATGACGGGCAGCGTCCTAGGCCTGAGATCGGACTCGCAGAGGCCGGCCGGTCTGGGC
AACCGAGACAACTCGTGCTACCAGAACAGCATACTTCAAGGCTTGGCGGCCCTCGATTCTTTGCCAGAGTTTCTT
TCTGCGTGCGTGCGTGCTGTCGGTCCGCAGCATGAAGACGACGATGTTGCTCAAACCCTACGAGACCTACTGGGT
GATCTCAACGACTCGTCCAACAACGGTAAAACCATCTGGACGCCGAGCTTGCTGAAATCGATGAGCACCTGGACC
CAGCAAGATGCACAGGAATACTACTCGAAGCTGCTCGACGACATCGACAAGGCCGTGGCCAAGGCCGTCAGCGAG
TCGCGCCGCTTCTCGGGCCTGGAAGCCGACTGTGGCAGGGATGAGGCGGCCGCAAGCCAGCACAGCGATGACAGT
GGCTATCAGAGCTTGCCGTCGGGCCCGGACCTGTCGGCAATCAAGCCGCTACGCAACCCGCTCGAGGGCCTGCTA
GCACAGCGAGTCGCGTGTGTCCAATGTGGATTCTCAGAAGGGCTCTCCATGATTCCTTTTAACTGCCTGACTCTC
AGCCTCGGCCTAGACAAAAATCGGCACGACCTCTTTGAGCGACTGGACGCCTACAGCCGCGTCGAAAGCATCGAA
GGCGTCGACTGCCCCAAATGTACGCTACTCAAGTCGCAGCGGCTTTTGAAGAAGCTCATCGATAGGATACGCGAC
GGTGGCGCGGCGGAGGATCAGCTGCACGAACCCCAGCGTCGGCTTGATGCGGTCGAAGCGGCGCTCGACGAGGAC
GACTTTGACGAAAAGACGCTAACGGAGAGGTGCAAGATTTCGAGCCAAGCAAAGGTCACCTCGACCAAGACGAAG
CAAATCGTCATCGCACGGCCGCCTCAGAGCCTCGCCATCCACGTTAACCGGTCCGTCTTCGATCCGTCGACGTTT
GATATGATCAAGAACTCGGCTCCGCTTAGCTTCCCGCTTACGCTCGATTTGGGGCCGTGGTGTCTGGGGAGCTCC
GAGGACTCGGAGGCGTCCATCGAGGCGGGCAACTTGACGGTGGGCGACGCCGATGAGGTCGAGGAGCGATGGCAG
CCGGGCTGCCCAAACGCGTCAATGATAGCTGGTGACACGGGCCCGTCAAGACTGACAGGGCCGATATACGAACTG
CGAGCAGTGGTGACGCACGCCGGACGGCATGAGAACGGTCACTATATCTGCTATCGACGAGTCGTCGGCCAGACG
GCGGAGAAGAGCGAAGGAGGGTGGTGGAGGCTCAGCGACCACAACGTGACCATGGTGGACGATGACATGATACCG
GCGTTGGCGCCCGGCGTCTTCATGCTGCTGTACGACTGCGTCGACCCGAGCATGGTGCCGCGCGGCGAGCTGGAC
TCTTCCGAGGCGACTGCGCGCGCCAGCAGTGACGGGTCGAGCGAGTGTACGTCTGGGCGTGAAGACGGAGGCGTA
TGGGATGGAGCAGAGCTGTCTTTCGGTACGGATTCCTCACCGGGGAGGGTCCCGCTACCGGACAGCGATGATGGC
GGTCCCGACTCTGAGACGGAGACGGAGACGGAGACGGAGCTGGGGCTATGA
Gene >Ophun1|935
ATGAGTTTCGATCGCGCCGATCCCAGAAACCTGCACGAGGACACGGTGCCGCGCAACCATTTCTATTGGAACGAG
CCGAGCATCGTCCTGAGCCTTGTCGTTGTCCTGGTCGCTCTCGTCGCCAAAAATTTGGGCTTGCAGCAGGCGCTC
GCCGGCTTCTTCGCTTTCCTGCAACATCTGCTGTGGAACTCGATCGTATACGTTCTCCCTGCGCCCCTGGTGTTC
GCTTTGGACCATCGCCTCGAGTCCACATCCTCACCTCGTCGAGCGCTCGATCAAGCGCAAGGGGGAACCCATGCC
GCAAAGAGCGAAGCCATGAGAAGAATACTCGGTCTAGACAACCCCGGTGGTGTGTTGGCATCCGTGTCTGAAGCT
CGCACGAGGGCCCTGTCTATGACGGGCAGCGTCCTAGGCCTGAGATCGGACTCGCAGAGGCCGGCCGGTCTGGGC
AACCGAGACAACTCGTGCTACCAGAACAGCATACTTCAAGGCTTGGCGGCCCTCGATTCTTTGCCAGAGTTTCTT
TCTGCGTGCGTGCGTGCTGTCGGTCCGCAGCATGAAGACGACGATGTTGCTCAAACCCTACGAGACCTACTGGGT
GATCTCAACGACTCGTCCAACAACGGTAAAACCATCTGGACGCCGAGCTTGCTGAAATCGATGAGCACCTGGACC
CAGCAAGATGCACAGGAATACTACTCGAAGCTGCTCGACGACATCGACAAGGCCGTGGCCAAGGCCGTCAGCGAG
TCGCGCCGCTTCTCGGGCCTGGAAGCCGACTGTGGCAGGGATGAGGCGGCCGCAAGCCAGCACAGCGATGACAGT
GGCTATCAGAGCTTGCCGTCGGGCCCGGACCTGTCGGCAATCAAGCCGCTACGCAACCCGCTCGAGGGCCTGCTA
GCACAGCGAGTCGCGTGTGTCCAATGTGGATTCTCAGAAGGGCTCTCCATGATTCCTTTTAACTGCCTGACTCTC
AGCCTCGGCCTAGACAAAAATCGGCACGACCTCTTTGAGCGACTGGACGCCTACAGCCGCGTCGAAAGCATCGAA
GGCGTCGACTGCCCCAAATGTACGCTACTCAAGTCGCAGCGGCTTTTGAAGAAGCTCATCGATAGGATACGCGAC
GGTGGCGCGGCGGAGGATCAGCTGCACGAACCCCAGCGTCGGCTTGATGCGGTCGAAGCGGCGCTCGACGAGGAC
GACTTTGACGAAAAGACGCTAACGGAGAGGTGCAAGATTTCGAGCCAAGCAAAGGTCACCTCGACCAAGACGAAG
CAAATCGTCATCGCACGGCCGCCTCAGAGCCTCGCCATCCACGTTAACCGGTCCGTCTTCGATCCGTCGACGTTT
GATATGATCAAGAACTCGGCTCCGCTTAGCTTCCCGCTTACGCTCGATTTGGGGCCGTGGTGTCTGGGGAGCTCC
GAGGACTCGGAGGCGTCCATCGAGGCGGGCAACTTGACGGTGGGCGACGCCGATGAGGTCGAGGAGCGATGGCAG
CCGGGCTGCCCAAACGCGTCAATGATAGCTGGTGACACGGGCCCGTCAAGACTGACAGGGCCGATATACGAACTG
CGAGCAGTGGTGACGCACGCCGGACGGCATGAGAACGGTCACTATATCTGCTATCGACGAGTCGTCGGCCAGACG
GCGGAGAAGAGCGAAGGAGGGTGGTGGAGGCTCAGCGACCACAACGTGACCATGGTGGACGATGACATGATACCG
GCGTTGGCGCCCGGCGTCTTCATGCTGCTGTACGACTGCGTCGACCCGAGCATGGTGCCGCGCGGCGAGCTGGAC
TCTTCCGAGGCGACTGCGCGCGCCAGCAGTGACGGGTCGAGCGAGTGTACGTCTGGGCGTGAAGACGGAGGCGTA
TGGGATGGAGCAGAGCTGTCTTTCGGTACGGATTCCTCACCGGGGAGGGTCCCGCTACCGGACAGCGATGATGGC
GGTCCCGACTCTGAGACGGAGACGGAGACGGAGACGGAGCTGGGGCTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail