Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|931
Gene name
LocationContig_133:17486..21056
Strand-
Gene length (bp)3570
Transcript length (bp)3570
Coding sequence length (bp)3570
Protein length (aa) 1190

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04408 HA2 Helicase associated domain (HA2) 1.2E-24 840 957
PF00271 Helicase_C Helicase conserved C-terminal domain 1.7E-11 689 778
PF07717 OB_NTP_bind Oligonucleotide/oligosaccharide-binding (OB)-fold 2.4E-11 1024 1129
PF00270 DEAD DEAD/DEAH box helicase 1.7E-07 383 548

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HDY4|YK16_SCHPO Putative ATP-dependent RNA helicase PB1A10.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1A10.06c PE=3 SV=1 7 1187 0.0E+00
sp|Q04217|DHR1_YEAST Probable ATP-dependent RNA helicase DHR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM16 PE=1 SV=1 263 1189 0.0E+00
sp|Q8IY37|DHX37_HUMAN Probable ATP-dependent RNA helicase DHX37 OS=Homo sapiens GN=DHX37 PE=1 SV=1 354 1176 0.0E+00
sp|O46072|KZ_DROME Probable ATP-dependent RNA helicase kurz OS=Drosophila melanogaster GN=kz PE=1 SV=1 317 1172 9.0E-179
sp|P34305|RHA2_CAEEL Putative ATP-dependent RNA helicase rha-2 OS=Caenorhabditis elegans GN=rha-2 PE=3 SV=2 346 1172 3.0E-169
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HDY4|YK16_SCHPO Putative ATP-dependent RNA helicase PB1A10.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1A10.06c PE=3 SV=1 7 1187 0.0E+00
sp|Q04217|DHR1_YEAST Probable ATP-dependent RNA helicase DHR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM16 PE=1 SV=1 263 1189 0.0E+00
sp|Q8IY37|DHX37_HUMAN Probable ATP-dependent RNA helicase DHX37 OS=Homo sapiens GN=DHX37 PE=1 SV=1 354 1176 0.0E+00
sp|O46072|KZ_DROME Probable ATP-dependent RNA helicase kurz OS=Drosophila melanogaster GN=kz PE=1 SV=1 317 1172 9.0E-179
sp|P34305|RHA2_CAEEL Putative ATP-dependent RNA helicase rha-2 OS=Caenorhabditis elegans GN=rha-2 PE=3 SV=2 346 1172 3.0E-169
sp|Q9C813|DEAHD_ARATH ATP-dependent RNA helicase DEAH13 OS=Arabidopsis thaliana GN=FAS4 PE=2 SV=1 267 1176 9.0E-162
sp|Q17R09|PRP16_BOVIN Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Bos taurus GN=DHX38 PE=2 SV=1 367 1128 1.0E-108
sp|Q92620|PRP16_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Homo sapiens GN=DHX38 PE=1 SV=2 367 1128 1.0E-108
sp|F4IE66|PRP22_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH10 OS=Arabidopsis thaliana GN=RID1 PE=1 SV=1 366 1128 3.0E-107
sp|Q5RAZ4|DHX15_PONAB Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Pongo abelii GN=DHX15 PE=2 SV=2 363 1001 8.0E-107
sp|O35286|DHX15_MOUSE Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Mus musculus GN=Dhx15 PE=1 SV=2 363 1001 8.0E-107
sp|O43143|DHX15_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Homo sapiens GN=DHX15 PE=1 SV=2 363 1001 1.0E-106
sp|Q93Y16|DEAH4_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH4 OS=Arabidopsis thaliana GN=At1g27900 PE=1 SV=1 373 1101 7.0E-105
sp|Q80VY9|DHX33_MOUSE Putative ATP-dependent RNA helicase DHX33 OS=Mus musculus GN=Dhx33 PE=1 SV=1 343 1105 3.0E-103
sp|P53131|PRP43_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP43 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP43 PE=1 SV=1 366 1099 4.0E-103
sp|Q54F05|DHX8_DICDI ATP-dependent RNA helicase dhx8 OS=Dictyostelium discoideum GN=dhx8 PE=3 SV=1 357 1101 7.0E-103
sp|Q14562|DHX8_HUMAN ATP-dependent RNA helicase DHX8 OS=Homo sapiens GN=DHX8 PE=1 SV=1 367 1101 8.0E-103
sp|A2A4P0|DHX8_MOUSE ATP-dependent RNA helicase DHX8 OS=Mus musculus GN=Dhx8 PE=2 SV=1 367 1101 1.0E-102
sp|Q09530|MOG5_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-5 OS=Caenorhabditis elegans GN=mog-5 PE=1 SV=1 371 1101 3.0E-102
sp|Q03319|PRH1_SCHPO Probable ATP-dependent RNA helicase prh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prh1 PE=3 SV=2 362 995 3.0E-101
sp|O45244|DHX16_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-4 OS=Caenorhabditis elegans GN=mog-4 PE=1 SV=2 360 1128 1.0E-100
sp|Q38953|DEAH5_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5 OS=Arabidopsis thaliana GN=At3g26560 PE=1 SV=2 367 1128 5.0E-100
sp|Q20875|DHX15_CAEEL Pre-mRNA-splicing factor ATP-dependent RNA helicase ddx-15 OS=Caenorhabditis elegans GN=ddx-15 PE=3 SV=1 363 1099 1.0E-99
sp|F4K2E9|PRP16_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH7 OS=Arabidopsis thaliana GN=CUV PE=1 SV=1 371 1128 1.0E-99
sp|Q9LZQ9|DEAH2_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH2 OS=Arabidopsis thaliana GN=At3g62310 PE=2 SV=1 362 1128 1.0E-99
sp|F4JMJ3|DEAH8_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH8 OS=Arabidopsis thaliana GN=At4g16680 PE=2 SV=2 374 1101 3.0E-99
sp|Q7YR39|DHX16_PANTR Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Pan troglodytes GN=DHX16 PE=3 SV=1 345 997 9.0E-99
sp|O60231|DHX16_HUMAN Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Homo sapiens GN=DHX16 PE=1 SV=2 358 997 1.0E-98
sp|Q767K6|DHX16_PIG Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Sus scrofa GN=DHX16 PE=3 SV=1 367 997 1.0E-98
sp|P34498|MOG1_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-1 OS=Caenorhabditis elegans GN=mog-1 PE=1 SV=2 353 1161 1.0E-98
sp|Q54MH3|DHX16_DICDI Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Dictyostelium discoideum GN=dhx16 PE=3 SV=1 367 1033 1.0E-97
sp|F4JRJ6|DEAH9_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH9 OS=Arabidopsis thaliana GN=At4g18465 PE=3 SV=1 367 1107 3.0E-97
sp|P24384|PRP22_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP22 PE=1 SV=1 367 1099 6.0E-97
sp|O22899|PRP43_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH3 OS=Arabidopsis thaliana GN=At2g47250 PE=2 SV=1 355 1129 7.0E-97
sp|Q54NJ4|DHX15_DICDI Putative pre-mRNA-splicing factor ATP-dependent RNA helicase dhx15 OS=Dictyostelium discoideum GN=dhx15 PE=3 SV=1 362 1037 2.0E-96
sp|O42945|DHX15_SCHPO Probable pre-mRNA-splicing factor ATP-dependent RNA helicase prp43 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp43 PE=3 SV=1 344 1099 5.0E-95
sp|P15938|PRP16_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP16 PE=1 SV=2 366 1101 1.0E-94
sp|Q9BKQ8|DHX35_CAEEL Probable ATP-dependent RNA helicase DHX35 homolog OS=Caenorhabditis elegans GN=Y67D2.6 PE=3 SV=1 364 1037 2.0E-92
sp|Q9H6R0|DHX33_HUMAN Putative ATP-dependent RNA helicase DHX33 OS=Homo sapiens GN=DHX33 PE=1 SV=2 367 996 7.0E-90
sp|Q6PE54|DHX40_MOUSE Probable ATP-dependent RNA helicase DHX40 OS=Mus musculus GN=Dhx40 PE=1 SV=1 374 1099 2.0E-89
sp|Q5R864|DHX40_PONAB Probable ATP-dependent RNA helicase DHX40 OS=Pongo abelii GN=DHX40 PE=2 SV=1 374 1099 2.0E-89
sp|Q8IX18|DHX40_HUMAN Probable ATP-dependent RNA helicase DHX40 OS=Homo sapiens GN=DHX40 PE=1 SV=2 374 1099 2.0E-89
sp|Q5XI69|DHX40_RAT Probable ATP-dependent RNA helicase DHX40 OS=Rattus norvegicus GN=Dhx40 PE=2 SV=1 374 1099 2.0E-89
sp|P20095|PRP2_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase-like protein PRP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP2 PE=1 SV=1 301 993 4.0E-88
sp|Q9H5Z1|DHX35_HUMAN Probable ATP-dependent RNA helicase DHX35 OS=Homo sapiens GN=DHX35 PE=1 SV=2 367 997 1.0E-87
sp|Q5RBD4|DHX35_PONAB Probable ATP-dependent RNA helicase DHX35 OS=Pongo abelii GN=DHX35 PE=2 SV=1 367 997 8.0E-87
sp|F4ILR7|DEXH1_ARATH DExH-box ATP-dependent RNA helicase DExH1 OS=Arabidopsis thaliana GN=At2g35920 PE=2 SV=1 321 1099 5.0E-80
sp|Q9HE06|YK99_SCHPO Putative pre-mRNA-splicing factor ATP-dependent RNA helicase C20H4.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC20H4.09 PE=3 SV=1 374 1037 7.0E-80
sp|O17438|DHX15_STRPU Putative pre-mRNA-splicing factor ATP-dependent RNA helicase PRP1 (Fragment) OS=Strongylocentrotus purpuratus GN=PRP1 PE=2 SV=1 471 997 7.0E-78
sp|F4IM84|DEXH5_ARATH DExH-box ATP-dependent RNA helicase DExH5, mitochondrial OS=Arabidopsis thaliana GN=At2g01130 PE=3 SV=1 353 998 3.0E-74
sp|P36009|DHR2_YEAST Probable ATP-dependent RNA helicase DHR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DHR2 PE=1 SV=1 363 993 3.0E-73
sp|Q8VHK9|DHX36_MOUSE ATP-dependent RNA helicase DHX36 OS=Mus musculus GN=Dhx36 PE=1 SV=2 363 1082 7.0E-72
sp|F4HYJ7|DEXH3_ARATH DExH-box ATP-dependent RNA helicase DExH3 OS=Arabidopsis thaliana GN=At1g48650 PE=2 SV=1 364 1013 5.0E-71
sp|Q9C6G0|DEXH4_ARATH DExH-box ATP-dependent RNA helicase DExH4, chloroplastic OS=Arabidopsis thaliana GN=At1g58050 PE=3 SV=1 361 997 5.0E-69
sp|Q9H2U1|DHX36_HUMAN ATP-dependent RNA helicase DHX36 OS=Homo sapiens GN=DHX36 PE=1 SV=2 363 1082 6.0E-68
sp|Q28141|DHX9_BOVIN ATP-dependent RNA helicase A OS=Bos taurus GN=DHX9 PE=2 SV=1 336 997 3.0E-65
sp|Q5R874|DHX9_PONAB ATP-dependent RNA helicase A OS=Pongo abelii GN=DHX9 PE=2 SV=1 361 997 2.0E-64
sp|Q08211|DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 361 997 2.0E-64
sp|Q68FK8|DHX9_XENLA ATP-dependent RNA helicase A-like protein OS=Xenopus laevis GN=dhx9 PE=2 SV=1 371 997 4.0E-63
sp|O70133|DHX9_MOUSE ATP-dependent RNA helicase A OS=Mus musculus GN=Dhx9 PE=1 SV=2 342 997 3.0E-62
sp|P0C7L7|YUM14_USTMA Putative DEAH-box ATP-dependent helicase UM11114 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_11114 PE=3 SV=1 371 1119 9.0E-60
sp|B4PRJ9|SPNE_DROYA Probable ATP-dependent RNA helicase spindle-E OS=Drosophila yakuba GN=spn-E PE=3 SV=1 373 993 2.0E-59
sp|B4HLH4|SPNE_DROSE Probable ATP-dependent RNA helicase spindle-E OS=Drosophila sechellia GN=spn-E PE=3 SV=1 373 901 3.0E-57
sp|B3P3W1|SPNE_DROER Probable ATP-dependent RNA helicase spindle-E OS=Drosophila erecta GN=spn-E PE=3 SV=1 373 904 5.0E-57
sp|Q9VF26|SPNE_DROME Probable ATP-dependent RNA helicase spindle-E OS=Drosophila melanogaster GN=spn-E PE=2 SV=1 373 904 2.0E-56
sp|B4JT42|SPNE_DROGR Probable ATP-dependent RNA helicase spindle-E OS=Drosophila grimshawi GN=spn-E PE=3 SV=1 374 902 1.0E-55
sp|Q7QCW2|SPNE_ANOGA Probable ATP-dependent RNA helicase spindle-E OS=Anopheles gambiae GN=spn-E PE=3 SV=5 373 998 2.0E-55
sp|F4KGU4|DEAHC_ARATH ATP-dependent RNA helicase DEAH12, chloroplastic OS=Arabidopsis thaliana GN=At5g10370 PE=3 SV=1 374 1101 3.0E-55
sp|Q8NDG6|TDRD9_HUMAN Putative ATP-dependent RNA helicase TDRD9 OS=Homo sapiens GN=TDRD9 PE=2 SV=3 374 1032 3.0E-55
sp|Q296Q5|SPNE_DROPS Probable ATP-dependent RNA helicase spindle-E OS=Drosophila pseudoobscura pseudoobscura GN=spn-E PE=3 SV=2 374 902 6.0E-55
sp|F4IJV4|DEAH6_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH6 OS=Arabidopsis thaliana GN=MEE29 PE=2 SV=1 689 1128 9.0E-55
sp|P0CE10|DEAHB_ARATH ATP-dependent RNA helicase DEAH11, chloroplastic OS=Arabidopsis thaliana GN=At4g01020 PE=3 SV=1 374 1101 2.0E-54
sp|Q8VY00|ESP3_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH1 OS=Arabidopsis thaliana GN=ESP3 PE=1 SV=1 689 1128 3.0E-54
sp|Q3MHU3|TDRD9_RAT Putative ATP-dependent RNA helicase TDRD9 OS=Rattus norvegicus GN=Tdrd9 PE=2 SV=3 365 993 4.0E-54
sp|B4NBB0|SPNE_DROWI Probable ATP-dependent RNA helicase spindle-E OS=Drosophila willistoni GN=spn-E PE=3 SV=1 374 1041 6.0E-54
sp|Q5ZI74|DHX30_CHICK Putative ATP-dependent RNA helicase DHX30 OS=Gallus gallus GN=DHX30 PE=2 SV=1 374 896 1.0E-53
sp|Q2NKY8|DHX30_BOVIN Putative ATP-dependent RNA helicase DHX30 OS=Bos taurus GN=DHX30 PE=2 SV=1 363 896 2.0E-53
sp|Q5R607|DHX30_PONAB Putative ATP-dependent RNA helicase DHX30 OS=Pongo abelii GN=DHX30 PE=2 SV=1 363 896 2.0E-53
sp|Q5BJS0|DHX30_RAT Putative ATP-dependent RNA helicase DHX30 OS=Rattus norvegicus GN=Dhx30 PE=1 SV=1 336 896 3.0E-53
sp|Q7L2E3|DHX30_HUMAN Putative ATP-dependent RNA helicase DHX30 OS=Homo sapiens GN=DHX30 PE=1 SV=1 363 896 3.0E-53
sp|B4LX81|SPNE_DROVI Probable ATP-dependent RNA helicase spindle-E OS=Drosophila virilis GN=spn-E PE=3 SV=1 373 902 3.0E-53
sp|Q99PU8|DHX30_MOUSE Putative ATP-dependent RNA helicase DHX30 OS=Mus musculus GN=Dhx30 PE=1 SV=1 336 896 3.0E-53
sp|B4GEU5|SPNE_DROPE Probable ATP-dependent RNA helicase spindle-E OS=Drosophila persimilis GN=spn-E PE=3 SV=1 374 902 1.0E-51
sp|Q14BI7|TDRD9_MOUSE Putative ATP-dependent RNA helicase TDRD9 OS=Mus musculus GN=Tdrd9 PE=1 SV=3 365 993 2.0E-51
sp|Q9P774|PRP16_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp16 PE=3 SV=2 363 657 3.0E-51
sp|B4K5R2|SPNE_DROMO Probable ATP-dependent RNA helicase spindle-E OS=Drosophila mojavensis GN=spn-E PE=3 SV=1 373 906 2.0E-50
sp|O42643|PRP22_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp22 PE=1 SV=1 689 1128 4.0E-50
sp|Q8VY00|ESP3_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH1 OS=Arabidopsis thaliana GN=ESP3 PE=1 SV=1 366 629 7.0E-50
sp|F4IJV4|DEAH6_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH6 OS=Arabidopsis thaliana GN=MEE29 PE=2 SV=1 367 629 1.0E-49
sp|Q22307|DHX9_CAEEL Probable ATP-dependent RNA helicase A OS=Caenorhabditis elegans GN=rha-1 PE=2 SV=3 317 1004 5.0E-49
sp|Q9P774|PRP16_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp16 PE=3 SV=2 690 997 2.0E-48
sp|Q10752|CDC28_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase-like protein cdc28 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc28 PE=3 SV=2 303 621 2.0E-48
sp|O42643|PRP22_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp22 PE=1 SV=1 374 613 2.0E-47
sp|Q10752|CDC28_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase-like protein cdc28 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc28 PE=3 SV=2 692 1098 4.0E-45
sp|Q14147|DHX34_HUMAN Probable ATP-dependent RNA helicase DHX34 OS=Homo sapiens GN=DHX34 PE=1 SV=2 692 997 4.0E-44
sp|Q9DBV3|DHX34_MOUSE Probable ATP-dependent RNA helicase DHX34 OS=Mus musculus GN=Dhx34 PE=1 SV=2 692 997 9.0E-43
sp|F4I9Q5|DEXH7_ARATH DExH-box ATP-dependent RNA helicase DExH7, chloroplastic OS=Arabidopsis thaliana GN=At1g58060 PE=2 SV=1 686 997 2.0E-39
sp|P43329|HRPA_ECOLI ATP-dependent RNA helicase HrpA OS=Escherichia coli (strain K12) GN=hrpA PE=3 SV=3 374 613 3.0E-38
sp|Q7L7V1|DHX32_HUMAN Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32 OS=Homo sapiens GN=DHX32 PE=1 SV=1 371 998 3.0E-38
sp|Q9DBV3|DHX34_MOUSE Probable ATP-dependent RNA helicase DHX34 OS=Mus musculus GN=Dhx34 PE=1 SV=2 360 614 5.0E-38
sp|Q14147|DHX34_HUMAN Probable ATP-dependent RNA helicase DHX34 OS=Homo sapiens GN=DHX34 PE=1 SV=2 360 614 6.0E-38
sp|P45018|HRPA_HAEIN ATP-dependent RNA helicase HrpA homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hrpA PE=3 SV=2 358 621 8.0E-38
sp|P43329|HRPA_ECOLI ATP-dependent RNA helicase HrpA OS=Escherichia coli (strain K12) GN=hrpA PE=3 SV=3 632 960 1.0E-37
sp|Q8BZS9|DHX32_MOUSE Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32 OS=Mus musculus GN=Dhx32 PE=1 SV=2 371 998 2.0E-37
sp|Q6P158|DHX57_HUMAN Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens GN=DHX57 PE=1 SV=2 692 1099 5.0E-37
sp|P45018|HRPA_HAEIN ATP-dependent RNA helicase HrpA homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hrpA PE=3 SV=2 604 1005 3.0E-36
sp|Q5UQ96|YL540_MIMIV Putative ATP-dependent RNA helicase L540 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L540 PE=1 SV=1 375 998 1.0E-35
sp|A3KMI0|DHX29_XENLA ATP-dependent RNA helicase DHX29 OS=Xenopus laevis GN=dhx29 PE=2 SV=1 691 1036 2.0E-35
sp|Q6PGC1|DHX29_MOUSE ATP-dependent RNA helicase Dhx29 OS=Mus musculus GN=Dhx29 PE=1 SV=1 691 1036 2.0E-35
sp|F4INY4|HVT1_ARATH DExH-box ATP-dependent RNA helicase DExH6 OS=Arabidopsis thaliana GN=HVT1 PE=2 SV=1 685 901 4.0E-35
sp|F4IDQ6|NIH_ARATH DExH-box ATP-dependent RNA helicase DExH2 OS=Arabidopsis thaliana GN=NIH PE=1 SV=1 692 901 1.0E-34
sp|Q6P5D3|DHX57_MOUSE Putative ATP-dependent RNA helicase DHX57 OS=Mus musculus GN=Dhx57 PE=1 SV=2 692 1099 3.0E-34
sp|B8A4F4|TDRD9_DANRE Putative ATP-dependent RNA helicase TDRD9 OS=Danio rerio GN=tdrd9 PE=2 SV=1 690 993 2.0E-33
sp|Q9H6S0|YTDC2_HUMAN Probable ATP-dependent RNA helicase YTHDC2 OS=Homo sapiens GN=YTHDC2 PE=1 SV=2 691 907 3.0E-33
sp|B2RR83|YTDC2_MOUSE Probable ATP-dependent RNA helicase YTHDC2 OS=Mus musculus GN=Ythdc2 PE=1 SV=1 691 907 8.0E-33
sp|Q7Z478|DHX29_HUMAN ATP-dependent RNA helicase DHX29 OS=Homo sapiens GN=DHX29 PE=1 SV=2 691 998 1.0E-32
sp|A3KMI0|DHX29_XENLA ATP-dependent RNA helicase DHX29 OS=Xenopus laevis GN=dhx29 PE=2 SV=1 342 573 3.0E-32
sp|F4I9Q5|DEXH7_ARATH DExH-box ATP-dependent RNA helicase DExH7, chloroplastic OS=Arabidopsis thaliana GN=At1g58060 PE=2 SV=1 361 575 5.0E-32
sp|P24785|MLE_DROME Dosage compensation regulator OS=Drosophila melanogaster GN=mle PE=1 SV=2 688 901 2.0E-31
sp|O60114|YG65_SCHPO Uncharacterized helicase C15C4.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.05 PE=3 SV=1 692 901 4.0E-31
sp|Q7Z478|DHX29_HUMAN ATP-dependent RNA helicase DHX29 OS=Homo sapiens GN=DHX29 PE=1 SV=2 345 573 1.0E-30
sp|Q3ZBE0|DQX1_BOVIN ATP-dependent RNA helicase DQX1 OS=Bos taurus GN=DQX1 PE=2 SV=1 371 998 3.0E-29
sp|Q6PGC1|DHX29_MOUSE ATP-dependent RNA helicase Dhx29 OS=Mus musculus GN=Dhx29 PE=1 SV=1 338 573 4.0E-29
sp|B3M383|SPNE_DROAN Probable ATP-dependent RNA helicase spindle-E OS=Drosophila ananassae GN=spn-E PE=3 SV=1 692 1040 1.0E-28
sp|Q16JS8|SPNE_AEDAE Probable ATP-dependent RNA helicase spindle-E OS=Aedes aegypti GN=spn-E PE=3 SV=1 689 907 2.0E-28
sp|Q6P158|DHX57_HUMAN Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens GN=DHX57 PE=1 SV=2 367 575 2.0E-27
sp|Q06698|YL419_YEAST Putative ATP-dependent RNA helicase YLR419W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR419W PE=1 SV=1 367 575 4.0E-27
sp|Q06698|YL419_YEAST Putative ATP-dependent RNA helicase YLR419W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR419W PE=1 SV=1 683 895 5.0E-27
sp|Q6P5D3|DHX57_MOUSE Putative ATP-dependent RNA helicase DHX57 OS=Mus musculus GN=Dhx57 PE=1 SV=2 367 575 3.0E-26
sp|B2RR83|YTDC2_MOUSE Probable ATP-dependent RNA helicase YTHDC2 OS=Mus musculus GN=Ythdc2 PE=1 SV=1 366 575 6.0E-26
sp|Q9H6S0|YTDC2_HUMAN Probable ATP-dependent RNA helicase YTHDC2 OS=Homo sapiens GN=YTHDC2 PE=1 SV=2 366 575 7.0E-26
sp|P24785|MLE_DROME Dosage compensation regulator OS=Drosophila melanogaster GN=mle PE=1 SV=2 371 575 2.0E-25
sp|O94536|UCP12_SCHPO Putative ATP-dependent RNA helicase ucp12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ucp12 PE=3 SV=1 679 1032 3.0E-25
sp|B0XDC4|SPNE_CULQU Probable ATP-dependent RNA helicase spindle-E OS=Culex quinquefasciatus GN=spn-E PE=3 SV=1 689 905 6.0E-25
sp|F4IDQ6|NIH_ARATH DExH-box ATP-dependent RNA helicase DExH2 OS=Arabidopsis thaliana GN=NIH PE=1 SV=1 366 575 7.0E-25
sp|O94536|UCP12_SCHPO Putative ATP-dependent RNA helicase ucp12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ucp12 PE=3 SV=1 363 626 9.0E-25
sp|F4INY4|HVT1_ARATH DExH-box ATP-dependent RNA helicase DExH6 OS=Arabidopsis thaliana GN=HVT1 PE=2 SV=1 366 571 2.0E-24
sp|P37024|HRPB_ECOLI ATP-dependent RNA helicase HrpB OS=Escherichia coli (strain K12) GN=hrpB PE=3 SV=3 688 877 2.0E-24
sp|O60114|YG65_SCHPO Uncharacterized helicase C15C4.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.05 PE=3 SV=1 362 571 2.0E-23
sp|B3M383|SPNE_DROAN Probable ATP-dependent RNA helicase spindle-E OS=Drosophila ananassae GN=spn-E PE=3 SV=1 373 571 2.0E-22
sp|P0C9A4|H962L_ASFK5 Putative RNA Helicase B962L OS=African swine fever virus (isolate Pig/Kenya/KEN-50/1950) GN=Ken-084 PE=3 SV=1 392 1032 1.0E-21
sp|Q8V9U2|H962L_ASFM2 Putative RNA Helicase B962L OS=African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) GN=Mal-080 PE=3 SV=1 392 1032 2.0E-21
sp|P0C9A2|H962L_ASFP4 Putative RNA Helicase B962L OS=African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) GN=Pret-084 PE=3 SV=1 392 1032 2.0E-21
sp|P0C9A3|H962L_ASFWA Putative RNA Helicase B962L OS=African swine fever virus (isolate Warthog/Namibia/Wart80/1980) GN=War-082 PE=3 SV=1 392 1032 3.0E-21
sp|B0XDC4|SPNE_CULQU Probable ATP-dependent RNA helicase spindle-E OS=Culex quinquefasciatus GN=spn-E PE=3 SV=1 374 543 6.0E-21
sp|Q16JS8|SPNE_AEDAE Probable ATP-dependent RNA helicase spindle-E OS=Aedes aegypti GN=spn-E PE=3 SV=1 373 543 8.0E-21
sp|Q89443|H962L_ASFB7 Putative RNA helicase B962L OS=African swine fever virus (strain Badajoz 1971 Vero-adapted) GN=Ba71V-072 PE=3 SV=1 392 1032 8.0E-21
sp|B8A4F4|TDRD9_DANRE Putative ATP-dependent RNA helicase TDRD9 OS=Danio rerio GN=tdrd9 PE=2 SV=1 374 575 9.0E-21
sp|Q5XH12|DHX32_XENLA Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32 OS=Xenopus laevis GN=dhx32 PE=2 SV=1 371 621 1.0E-19
sp|Q8TE96|DQX1_HUMAN ATP-dependent RNA helicase DQX1 OS=Homo sapiens GN=DQX1 PE=2 SV=2 363 620 7.0E-19
sp|P37024|HRPB_ECOLI ATP-dependent RNA helicase HrpB OS=Escherichia coli (strain K12) GN=hrpB PE=3 SV=3 374 625 9.0E-19
sp|Q924H9|DQX1_MOUSE ATP-dependent RNA helicase DQX1 OS=Mus musculus GN=Dqx1 PE=2 SV=1 662 998 2.0E-18
sp|Q5XH12|DHX32_XENLA Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32 OS=Xenopus laevis GN=dhx32 PE=2 SV=1 716 998 1.0E-17
sp|Q924H9|DQX1_MOUSE ATP-dependent RNA helicase DQX1 OS=Mus musculus GN=Dqx1 PE=2 SV=1 366 637 2.0E-17
sp|Q1EHT7|C3H4_ORYSJ Zinc finger CCCH domain-containing protein 4 OS=Oryza sativa subsp. japonica GN=Os01g0256800 PE=2 SV=1 685 850 5.0E-15
sp|Q1EHT7|C3H4_ORYSJ Zinc finger CCCH domain-containing protein 4 OS=Oryza sativa subsp. japonica GN=Os01g0256800 PE=2 SV=1 370 545 2.0E-14
sp|O22243|C3H31_ARATH DExH-box ATP-dependent RNA helicase DExH8 OS=Arabidopsis thaliana GN=At2g47680 PE=2 SV=2 374 545 4.0E-14
sp|O22243|C3H31_ARATH DExH-box ATP-dependent RNA helicase DExH8 OS=Arabidopsis thaliana GN=At2g47680 PE=2 SV=2 716 889 4.0E-12
sp|Q8TE96|DQX1_HUMAN ATP-dependent RNA helicase DQX1 OS=Homo sapiens GN=DQX1 PE=2 SV=2 715 998 9.0E-11
sp|Q5UR20|YR366_MIMIV Putative ATP-dependent RNA helicase R366 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R366 PE=3 SV=1 710 787 1.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0004386 helicase activity Yes
GO:0005524 ATP binding Yes
GO:0003676 nucleic acid binding Yes
GO:0032555 purine ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0030554 adenyl nucleotide binding No
GO:0140657 ATP-dependent activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0000166 nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4139
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2650
Ophiocordyceps australis map64 (Brazil) OphauB2|1625
Ophiocordyceps camponoti-floridani Ophcf2|05858
Ophiocordyceps camponoti-rufipedis Ophun1|931 (this protein)
Ophiocordyceps kimflemingae Ophio5|2580
Ophiocordyceps subramaniannii Hirsu2|8391

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|931
MAKFVPRQRKHKVLAREKAKENERHEVQDTNQPMVSADKKALEEKRAQTKAELRQSGVKVSGKKAKRLEKYIDNK
LRKDENRELLAKLAARKIDTSLFASSRSLGQGRETKKQALSRALREKRAGIEGLDGDELLFERRGLGLGVEEGEE
TDGADDSDGTGPGEDTSLTSCAPPSAVVEPASVASAVVGSGLKRPLELDDDGRPIIKKRQKRGGVATKVQLDRTA
PAVSEYEEWHGFESDIESGDHLSSEDDDASEDVDNDEHGSQENTEEGSESEETSDDDSIDEDEIGENKAQRSSAF
KAWAQQQRNEALGYQPAGASSTTIAPPRPDSFVPRAPEQDPLPAELQPTAETDRKAFSVAVERSPEIQAARLKLP
IVSEEQRLMEAIHNNDIIVICGSTGSGKTTQVPQFLFEAGYGSPKSPTPGMIGVTQPRRVAAVSMSRRVSEELGG
HGDAVAYQIRFEGSVDAKTAIKFMTDGVLLREVSQDIALRKYSAIIIDEAHERSVNTDILIGMLSRVVRLRAEMA
REDPSLRPLKFIIMSATLRIEDLTMNPTLFPTAPPVLEIEGRQHPVTVHFSRRTQHDYVEEAFRKISRGHRKLPP
GGFLVFLTGRNEITQLSKRLKSAFGGLRTAEGPSVKISANEAPVEVEDIEFGHADDGEMDDLPSDEEEDAEQEEK
EFQVEEDQEAGPSDMQILPLYSLLPTREQLRVFEPAPDGSRQVILATNVAETSLTIPGIRFVFDCGRCKERRYDR
VSGVQSYHIGWISKASANQRSGRAGRTGPGHCYRLYSSAVYERDFAEFADPELLRMPIEGVVLQLKAMNLQHVVN
FPFPTPPERQSLARAEKLLGYLSALSDDGRVTDVGKTMAVFPLAPRFARILLVGHLYDCLPYTIALVAALSAAEV
FIPESQAVPALAVRDEAGFRTDANVKAENKQANARNMFNEVHRNFCFLDDRSDAIKLLQVVGEFAHEPTEEWCER
HFVRFKVLREISQLRRQLTELLRLNVDSFSRLGYQDRLPPPSAKQVSALKQMVAAGFIDRVAIRADLAPNPPEQH
RKPRRAIDVPYQPLTASTSSEGDGLVYVHPSSPLAHLSTGELPEYIVYNYLQRSDGQGKKTRMQALTEVSGGQLA
ALAKGTPLVEYGKPIKEVRAGVESRECWVVPYLRAEGLGGGLGWPLPARRVTQRRVPGKGWVVV*
Coding >Ophun1|931
ATGGCCAAATTCGTGCCCCGTCAACGAAAGCACAAGGTGCTGGCCCGTGAAAAGGCCAAAGAAAATGAGCGACAC
GAAGTCCAGGACACGAACCAGCCGATGGTATCGGCCGACAAGAAGGCGCTTGAAGAGAAGAGAGCCCAGACGAAA
GCCGAGTTGCGACAGAGCGGGGTCAAAGTGAGCGGGAAAAAAGCCAAGCGACTGGAAAAGTACATCGACAACAAG
CTCCGCAAAGACGAGAACCGCGAGCTGCTGGCCAAGCTTGCGGCGCGCAAGATCGACACGAGCCTTTTTGCGAGC
AGCAGGTCGCTCGGGCAGGGGCGCGAGACGAAGAAGCAGGCTTTGTCGCGGGCTCTGAGGGAGAAGAGGGCTGGG
ATTGAGGGGTTGGATGGGGATGAGTTGCTGTTTGAGAGGAGGGGGTTGGGTTTGGGGGTGGAGGAGGGTGAGGAG
ACTGACGGTGCCGATGACAGCGACGGGACTGGACCGGGTGAAGATACATCGTTGACTTCTTGCGCTCCTCCGTCA
GCGGTGGTTGAGCCTGCAAGTGTCGCTTCGGCGGTTGTCGGTTCCGGCCTGAAGCGCCCACTCGAGCTTGACGAT
GATGGCCGTCCGATTATCAAAAAGAGACAGAAGAGAGGTGGTGTGGCGACAAAAGTTCAGCTCGATCGTACAGCA
CCGGCCGTGTCTGAGTATGAGGAATGGCATGGGTTTGAGAGCGACATCGAGTCTGGCGACCATTTGTCGAGCGAG
GATGACGATGCGTCTGAGGATGTCGATAACGATGAGCATGGAAGTCAAGAGAACACAGAAGAGGGCTCGGAAAGC
GAGGAGACATCGGATGACGACTCGATAGACGAAGATGAAATTGGCGAGAACAAGGCCCAACGCTCGTCCGCCTTC
AAAGCTTGGGCTCAGCAACAACGCAATGAAGCGCTCGGATACCAACCGGCCGGCGCGTCATCGACGACAATTGCT
CCTCCTCGACCGGACAGCTTCGTGCCCAGAGCCCCTGAGCAGGACCCCCTTCCGGCGGAGCTTCAACCGACGGCA
GAGACGGACCGAAAGGCCTTTAGCGTGGCGGTAGAACGGTCTCCTGAGATACAAGCAGCCCGTCTGAAGCTTCCC
ATCGTCTCCGAAGAGCAGCGGCTGATGGAGGCTATACACAACAACGACATTATTGTGATTTGCGGCTCTACAGGA
TCTGGAAAGACTACTCAGGTTCCTCAGTTTCTCTTCGAGGCCGGCTACGGCTCTCCAAAGTCGCCGACACCGGGG
ATGATTGGCGTCACGCAGCCGCGACGGGTTGCCGCCGTCAGCATGTCGAGGAGGGTCTCCGAAGAGCTGGGCGGC
CACGGTGATGCCGTGGCTTACCAGATCCGATTCGAAGGATCTGTAGATGCCAAGACGGCCATCAAGTTCATGACA
GACGGTGTGCTGCTGCGGGAAGTTTCACAGGACATTGCCCTGCGCAAATACTCGGCCATCATCATCGACGAAGCT
CACGAAAGGAGCGTCAACACGGATATACTGATCGGCATGCTCAGCCGCGTCGTCAGGCTGCGAGCCGAAATGGCA
CGCGAGGACCCAAGTCTGAGGCCACTCAAGTTCATCATCATGTCAGCGACGCTCAGGATAGAAGACTTGACGATG
AATCCCACGCTGTTCCCGACGGCGCCGCCTGTGCTGGAGATTGAAGGGCGGCAACATCCTGTGACGGTTCATTTC
TCGCGGAGGACGCAGCACGACTACGTCGAGGAGGCCTTTCGGAAGATTAGTCGAGGACATCGGAAACTCCCTCCT
GGGGGCTTCTTGGTCTTTCTGACGGGACGGAACGAGATAACGCAGCTGAGCAAGCGGTTGAAATCCGCGTTTGGA
GGCTTGAGGACCGCTGAGGGGCCGAGTGTGAAGATTTCGGCCAACGAGGCGCCGGTCGAGGTCGAAGACATTGAA
TTCGGCCATGCAGACGATGGCGAGATGGATGACTTACCGTCGGATGAGGAGGAGGATGCTGAGCAAGAGGAGAAG
GAGTTTCAGGTGGAAGAAGACCAGGAGGCGGGACCGTCTGACATGCAGATCCTACCTCTCTACTCTCTACTACCG
ACTCGAGAGCAGTTGAGAGTATTCGAGCCAGCGCCAGACGGCAGCCGTCAGGTGATACTGGCAACCAACGTGGCG
GAGACGAGCCTGACGATCCCGGGCATCCGCTTCGTCTTCGACTGCGGACGATGCAAGGAGCGGCGTTACGACCGC
GTCAGCGGAGTGCAGAGCTATCACATCGGCTGGATCAGCAAGGCCAGCGCCAACCAGCGATCAGGTCGGGCCGGA
CGAACGGGTCCGGGCCACTGCTACCGGCTCTACTCTTCGGCCGTCTACGAGCGGGACTTTGCCGAGTTTGCGGAC
CCGGAGCTGCTACGGATGCCCATCGAGGGCGTCGTGCTGCAGCTCAAGGCCATGAATTTGCAGCATGTCGTCAAC
TTTCCCTTTCCCACGCCGCCTGAGAGACAGAGCCTCGCCCGGGCTGAGAAGCTGCTGGGATACTTGTCTGCTCTC
TCAGACGATGGCCGGGTGACGGACGTGGGCAAGACGATGGCCGTGTTCCCTCTGGCACCACGGTTCGCCCGTATC
CTGCTGGTCGGGCATCTATACGACTGCCTGCCCTATACCATCGCCCTGGTAGCCGCCCTCTCAGCCGCCGAAGTC
TTCATCCCGGAGAGTCAGGCGGTGCCGGCGCTGGCAGTCCGAGACGAGGCCGGATTCCGGACAGACGCCAACGTC
AAAGCCGAGAACAAACAGGCCAACGCCCGCAACATGTTCAACGAGGTACACCGCAACTTTTGCTTCCTCGACGAC
CGATCCGATGCCATCAAGCTCCTGCAAGTCGTCGGCGAGTTCGCGCACGAGCCGACGGAGGAATGGTGTGAGCGT
CACTTTGTTCGCTTCAAGGTGCTCAGGGAGATTTCTCAGTTACGCAGACAGCTGACGGAGCTGCTTCGTCTCAAC
GTCGACTCCTTCTCCCGTCTCGGCTATCAGGATAGGCTTCCTCCTCCTTCGGCTAAGCAGGTCAGCGCGTTGAAG
CAGATGGTGGCCGCCGGCTTCATCGACCGCGTTGCTATCCGCGCTGATCTGGCGCCGAATCCGCCCGAGCAGCAC
CGCAAGCCTCGCAGGGCCATCGACGTGCCCTACCAGCCCCTGACGGCATCAACCTCGTCCGAAGGCGACGGCCTG
GTCTACGTCCATCCGAGCTCACCGCTGGCGCACCTCAGCACGGGCGAGCTGCCGGAGTACATCGTCTACAACTAC
CTCCAGCGATCGGACGGACAGGGCAAGAAGACGAGGATGCAGGCGCTGACAGAGGTTTCGGGTGGGCAGCTGGCT
GCGCTGGCCAAGGGGACGCCGCTGGTTGAGTATGGGAAGCCTATCAAGGAGGTGAGGGCGGGAGTTGAGAGCAGG
GAGTGCTGGGTTGTGCCGTATCTGAGGGCTGAGGGCTTGGGGGGCGGGCTGGGATGGCCGCTGCCTGCGAGGAGG
GTTACGCAGAGGAGGGTTCCGGGGAAGGGGTGGGTTGTTGTGTGA
Transcript >Ophun1|931
ATGGCCAAATTCGTGCCCCGTCAACGAAAGCACAAGGTGCTGGCCCGTGAAAAGGCCAAAGAAAATGAGCGACAC
GAAGTCCAGGACACGAACCAGCCGATGGTATCGGCCGACAAGAAGGCGCTTGAAGAGAAGAGAGCCCAGACGAAA
GCCGAGTTGCGACAGAGCGGGGTCAAAGTGAGCGGGAAAAAAGCCAAGCGACTGGAAAAGTACATCGACAACAAG
CTCCGCAAAGACGAGAACCGCGAGCTGCTGGCCAAGCTTGCGGCGCGCAAGATCGACACGAGCCTTTTTGCGAGC
AGCAGGTCGCTCGGGCAGGGGCGCGAGACGAAGAAGCAGGCTTTGTCGCGGGCTCTGAGGGAGAAGAGGGCTGGG
ATTGAGGGGTTGGATGGGGATGAGTTGCTGTTTGAGAGGAGGGGGTTGGGTTTGGGGGTGGAGGAGGGTGAGGAG
ACTGACGGTGCCGATGACAGCGACGGGACTGGACCGGGTGAAGATACATCGTTGACTTCTTGCGCTCCTCCGTCA
GCGGTGGTTGAGCCTGCAAGTGTCGCTTCGGCGGTTGTCGGTTCCGGCCTGAAGCGCCCACTCGAGCTTGACGAT
GATGGCCGTCCGATTATCAAAAAGAGACAGAAGAGAGGTGGTGTGGCGACAAAAGTTCAGCTCGATCGTACAGCA
CCGGCCGTGTCTGAGTATGAGGAATGGCATGGGTTTGAGAGCGACATCGAGTCTGGCGACCATTTGTCGAGCGAG
GATGACGATGCGTCTGAGGATGTCGATAACGATGAGCATGGAAGTCAAGAGAACACAGAAGAGGGCTCGGAAAGC
GAGGAGACATCGGATGACGACTCGATAGACGAAGATGAAATTGGCGAGAACAAGGCCCAACGCTCGTCCGCCTTC
AAAGCTTGGGCTCAGCAACAACGCAATGAAGCGCTCGGATACCAACCGGCCGGCGCGTCATCGACGACAATTGCT
CCTCCTCGACCGGACAGCTTCGTGCCCAGAGCCCCTGAGCAGGACCCCCTTCCGGCGGAGCTTCAACCGACGGCA
GAGACGGACCGAAAGGCCTTTAGCGTGGCGGTAGAACGGTCTCCTGAGATACAAGCAGCCCGTCTGAAGCTTCCC
ATCGTCTCCGAAGAGCAGCGGCTGATGGAGGCTATACACAACAACGACATTATTGTGATTTGCGGCTCTACAGGA
TCTGGAAAGACTACTCAGGTTCCTCAGTTTCTCTTCGAGGCCGGCTACGGCTCTCCAAAGTCGCCGACACCGGGG
ATGATTGGCGTCACGCAGCCGCGACGGGTTGCCGCCGTCAGCATGTCGAGGAGGGTCTCCGAAGAGCTGGGCGGC
CACGGTGATGCCGTGGCTTACCAGATCCGATTCGAAGGATCTGTAGATGCCAAGACGGCCATCAAGTTCATGACA
GACGGTGTGCTGCTGCGGGAAGTTTCACAGGACATTGCCCTGCGCAAATACTCGGCCATCATCATCGACGAAGCT
CACGAAAGGAGCGTCAACACGGATATACTGATCGGCATGCTCAGCCGCGTCGTCAGGCTGCGAGCCGAAATGGCA
CGCGAGGACCCAAGTCTGAGGCCACTCAAGTTCATCATCATGTCAGCGACGCTCAGGATAGAAGACTTGACGATG
AATCCCACGCTGTTCCCGACGGCGCCGCCTGTGCTGGAGATTGAAGGGCGGCAACATCCTGTGACGGTTCATTTC
TCGCGGAGGACGCAGCACGACTACGTCGAGGAGGCCTTTCGGAAGATTAGTCGAGGACATCGGAAACTCCCTCCT
GGGGGCTTCTTGGTCTTTCTGACGGGACGGAACGAGATAACGCAGCTGAGCAAGCGGTTGAAATCCGCGTTTGGA
GGCTTGAGGACCGCTGAGGGGCCGAGTGTGAAGATTTCGGCCAACGAGGCGCCGGTCGAGGTCGAAGACATTGAA
TTCGGCCATGCAGACGATGGCGAGATGGATGACTTACCGTCGGATGAGGAGGAGGATGCTGAGCAAGAGGAGAAG
GAGTTTCAGGTGGAAGAAGACCAGGAGGCGGGACCGTCTGACATGCAGATCCTACCTCTCTACTCTCTACTACCG
ACTCGAGAGCAGTTGAGAGTATTCGAGCCAGCGCCAGACGGCAGCCGTCAGGTGATACTGGCAACCAACGTGGCG
GAGACGAGCCTGACGATCCCGGGCATCCGCTTCGTCTTCGACTGCGGACGATGCAAGGAGCGGCGTTACGACCGC
GTCAGCGGAGTGCAGAGCTATCACATCGGCTGGATCAGCAAGGCCAGCGCCAACCAGCGATCAGGTCGGGCCGGA
CGAACGGGTCCGGGCCACTGCTACCGGCTCTACTCTTCGGCCGTCTACGAGCGGGACTTTGCCGAGTTTGCGGAC
CCGGAGCTGCTACGGATGCCCATCGAGGGCGTCGTGCTGCAGCTCAAGGCCATGAATTTGCAGCATGTCGTCAAC
TTTCCCTTTCCCACGCCGCCTGAGAGACAGAGCCTCGCCCGGGCTGAGAAGCTGCTGGGATACTTGTCTGCTCTC
TCAGACGATGGCCGGGTGACGGACGTGGGCAAGACGATGGCCGTGTTCCCTCTGGCACCACGGTTCGCCCGTATC
CTGCTGGTCGGGCATCTATACGACTGCCTGCCCTATACCATCGCCCTGGTAGCCGCCCTCTCAGCCGCCGAAGTC
TTCATCCCGGAGAGTCAGGCGGTGCCGGCGCTGGCAGTCCGAGACGAGGCCGGATTCCGGACAGACGCCAACGTC
AAAGCCGAGAACAAACAGGCCAACGCCCGCAACATGTTCAACGAGGTACACCGCAACTTTTGCTTCCTCGACGAC
CGATCCGATGCCATCAAGCTCCTGCAAGTCGTCGGCGAGTTCGCGCACGAGCCGACGGAGGAATGGTGTGAGCGT
CACTTTGTTCGCTTCAAGGTGCTCAGGGAGATTTCTCAGTTACGCAGACAGCTGACGGAGCTGCTTCGTCTCAAC
GTCGACTCCTTCTCCCGTCTCGGCTATCAGGATAGGCTTCCTCCTCCTTCGGCTAAGCAGGTCAGCGCGTTGAAG
CAGATGGTGGCCGCCGGCTTCATCGACCGCGTTGCTATCCGCGCTGATCTGGCGCCGAATCCGCCCGAGCAGCAC
CGCAAGCCTCGCAGGGCCATCGACGTGCCCTACCAGCCCCTGACGGCATCAACCTCGTCCGAAGGCGACGGCCTG
GTCTACGTCCATCCGAGCTCACCGCTGGCGCACCTCAGCACGGGCGAGCTGCCGGAGTACATCGTCTACAACTAC
CTCCAGCGATCGGACGGACAGGGCAAGAAGACGAGGATGCAGGCGCTGACAGAGGTTTCGGGTGGGCAGCTGGCT
GCGCTGGCCAAGGGGACGCCGCTGGTTGAGTATGGGAAGCCTATCAAGGAGGTGAGGGCGGGAGTTGAGAGCAGG
GAGTGCTGGGTTGTGCCGTATCTGAGGGCTGAGGGCTTGGGGGGCGGGCTGGGATGGCCGCTGCCTGCGAGGAGG
GTTACGCAGAGGAGGGTTCCGGGGAAGGGGTGGGTTGTTGTGTGA
Gene >Ophun1|931
ATGGCCAAATTCGTGCCCCGTCAACGAAAGCACAAGGTGCTGGCCCGTGAAAAGGCCAAAGAAAATGAGCGACAC
GAAGTCCAGGACACGAACCAGCCGATGGTATCGGCCGACAAGAAGGCGCTTGAAGAGAAGAGAGCCCAGACGAAA
GCCGAGTTGCGACAGAGCGGGGTCAAAGTGAGCGGGAAAAAAGCCAAGCGACTGGAAAAGTACATCGACAACAAG
CTCCGCAAAGACGAGAACCGCGAGCTGCTGGCCAAGCTTGCGGCGCGCAAGATCGACACGAGCCTTTTTGCGAGC
AGCAGGTCGCTCGGGCAGGGGCGCGAGACGAAGAAGCAGGCTTTGTCGCGGGCTCTGAGGGAGAAGAGGGCTGGG
ATTGAGGGGTTGGATGGGGATGAGTTGCTGTTTGAGAGGAGGGGGTTGGGTTTGGGGGTGGAGGAGGGTGAGGAG
ACTGACGGTGCCGATGACAGCGACGGGACTGGACCGGGTGAAGATACATCGTTGACTTCTTGCGCTCCTCCGTCA
GCGGTGGTTGAGCCTGCAAGTGTCGCTTCGGCGGTTGTCGGTTCCGGCCTGAAGCGCCCACTCGAGCTTGACGAT
GATGGCCGTCCGATTATCAAAAAGAGACAGAAGAGAGGTGGTGTGGCGACAAAAGTTCAGCTCGATCGTACAGCA
CCGGCCGTGTCTGAGTATGAGGAATGGCATGGGTTTGAGAGCGACATCGAGTCTGGCGACCATTTGTCGAGCGAG
GATGACGATGCGTCTGAGGATGTCGATAACGATGAGCATGGAAGTCAAGAGAACACAGAAGAGGGCTCGGAAAGC
GAGGAGACATCGGATGACGACTCGATAGACGAAGATGAAATTGGCGAGAACAAGGCCCAACGCTCGTCCGCCTTC
AAAGCTTGGGCTCAGCAACAACGCAATGAAGCGCTCGGATACCAACCGGCCGGCGCGTCATCGACGACAATTGCT
CCTCCTCGACCGGACAGCTTCGTGCCCAGAGCCCCTGAGCAGGACCCCCTTCCGGCGGAGCTTCAACCGACGGCA
GAGACGGACCGAAAGGCCTTTAGCGTGGCGGTAGAACGGTCTCCTGAGATACAAGCAGCCCGTCTGAAGCTTCCC
ATCGTCTCCGAAGAGCAGCGGCTGATGGAGGCTATACACAACAACGACATTATTGTGATTTGCGGCTCTACAGGA
TCTGGAAAGACTACTCAGGTTCCTCAGTTTCTCTTCGAGGCCGGCTACGGCTCTCCAAAGTCGCCGACACCGGGG
ATGATTGGCGTCACGCAGCCGCGACGGGTTGCCGCCGTCAGCATGTCGAGGAGGGTCTCCGAAGAGCTGGGCGGC
CACGGTGATGCCGTGGCTTACCAGATCCGATTCGAAGGATCTGTAGATGCCAAGACGGCCATCAAGTTCATGACA
GACGGTGTGCTGCTGCGGGAAGTTTCACAGGACATTGCCCTGCGCAAATACTCGGCCATCATCATCGACGAAGCT
CACGAAAGGAGCGTCAACACGGATATACTGATCGGCATGCTCAGCCGCGTCGTCAGGCTGCGAGCCGAAATGGCA
CGCGAGGACCCAAGTCTGAGGCCACTCAAGTTCATCATCATGTCAGCGACGCTCAGGATAGAAGACTTGACGATG
AATCCCACGCTGTTCCCGACGGCGCCGCCTGTGCTGGAGATTGAAGGGCGGCAACATCCTGTGACGGTTCATTTC
TCGCGGAGGACGCAGCACGACTACGTCGAGGAGGCCTTTCGGAAGATTAGTCGAGGACATCGGAAACTCCCTCCT
GGGGGCTTCTTGGTCTTTCTGACGGGACGGAACGAGATAACGCAGCTGAGCAAGCGGTTGAAATCCGCGTTTGGA
GGCTTGAGGACCGCTGAGGGGCCGAGTGTGAAGATTTCGGCCAACGAGGCGCCGGTCGAGGTCGAAGACATTGAA
TTCGGCCATGCAGACGATGGCGAGATGGATGACTTACCGTCGGATGAGGAGGAGGATGCTGAGCAAGAGGAGAAG
GAGTTTCAGGTGGAAGAAGACCAGGAGGCGGGACCGTCTGACATGCAGATCCTACCTCTCTACTCTCTACTACCG
ACTCGAGAGCAGTTGAGAGTATTCGAGCCAGCGCCAGACGGCAGCCGTCAGGTGATACTGGCAACCAACGTGGCG
GAGACGAGCCTGACGATCCCGGGCATCCGCTTCGTCTTCGACTGCGGACGATGCAAGGAGCGGCGTTACGACCGC
GTCAGCGGAGTGCAGAGCTATCACATCGGCTGGATCAGCAAGGCCAGCGCCAACCAGCGATCAGGTCGGGCCGGA
CGAACGGGTCCGGGCCACTGCTACCGGCTCTACTCTTCGGCCGTCTACGAGCGGGACTTTGCCGAGTTTGCGGAC
CCGGAGCTGCTACGGATGCCCATCGAGGGCGTCGTGCTGCAGCTCAAGGCCATGAATTTGCAGCATGTCGTCAAC
TTTCCCTTTCCCACGCCGCCTGAGAGACAGAGCCTCGCCCGGGCTGAGAAGCTGCTGGGATACTTGTCTGCTCTC
TCAGACGATGGCCGGGTGACGGACGTGGGCAAGACGATGGCCGTGTTCCCTCTGGCACCACGGTTCGCCCGTATC
CTGCTGGTCGGGCATCTATACGACTGCCTGCCCTATACCATCGCCCTGGTAGCCGCCCTCTCAGCCGCCGAAGTC
TTCATCCCGGAGAGTCAGGCGGTGCCGGCGCTGGCAGTCCGAGACGAGGCCGGATTCCGGACAGACGCCAACGTC
AAAGCCGAGAACAAACAGGCCAACGCCCGCAACATGTTCAACGAGGTACACCGCAACTTTTGCTTCCTCGACGAC
CGATCCGATGCCATCAAGCTCCTGCAAGTCGTCGGCGAGTTCGCGCACGAGCCGACGGAGGAATGGTGTGAGCGT
CACTTTGTTCGCTTCAAGGTGCTCAGGGAGATTTCTCAGTTACGCAGACAGCTGACGGAGCTGCTTCGTCTCAAC
GTCGACTCCTTCTCCCGTCTCGGCTATCAGGATAGGCTTCCTCCTCCTTCGGCTAAGCAGGTCAGCGCGTTGAAG
CAGATGGTGGCCGCCGGCTTCATCGACCGCGTTGCTATCCGCGCTGATCTGGCGCCGAATCCGCCCGAGCAGCAC
CGCAAGCCTCGCAGGGCCATCGACGTGCCCTACCAGCCCCTGACGGCATCAACCTCGTCCGAAGGCGACGGCCTG
GTCTACGTCCATCCGAGCTCACCGCTGGCGCACCTCAGCACGGGCGAGCTGCCGGAGTACATCGTCTACAACTAC
CTCCAGCGATCGGACGGACAGGGCAAGAAGACGAGGATGCAGGCGCTGACAGAGGTTTCGGGTGGGCAGCTGGCT
GCGCTGGCCAAGGGGACGCCGCTGGTTGAGTATGGGAAGCCTATCAAGGAGGTGAGGGCGGGAGTTGAGAGCAGG
GAGTGCTGGGTTGTGCCGTATCTGAGGGCTGAGGGCTTGGGGGGCGGGCTGGGATGGCCGCTGCCTGCGAGGAGG
GTTACGCAGAGGAGGGTTCCGGGGAAGGGGTGGGTTGTTGTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail