Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|93
Gene name
LocationContig_100:8941..11721
Strand-
Gene length (bp)2780
Transcript length (bp)2103
Coding sequence length (bp)2103
Protein length (aa) 701

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08690 GET2 GET complex subunit GET2 7.3E-31 396 693

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P28348|NIRA_EMENI Nitrogen assimilation transcription factor nirA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nirA PE=3 SV=1 207 373 2.0E-12
sp|P28349|NIT4_NEUCR Nitrogen assimilation transcription factor nit-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nit-4 PE=3 SV=2 197 373 7.0E-10
sp|O13360|FLUF_NEUCR Conidial development protein fluffy OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fl PE=2 SV=1 192 362 8.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

Domain # Start End Length
1 572 594 22
2 623 642 19
3 676 698 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|93
MISRLPTPLDFSSAASLSSIRRNGRWPRFPIPTAPPRSEPQSDNKPGAASEDAVVEEAAKTSRLLVWPVARGSPG
CLGPFAACLDAAADALVTSSVMACGLGATSPTETHAQTTKREYAELCSSESTSEEFLELLRTCPEADADQMLRRL
GAGVSPGEILRQARDGNLLVQASLAPEARFRRLSSPYLKPFHAAQLIEEKLSDLRPSKWTLVVSDDALLRRLLSV
YFLREYPYLAMFHKDYFLQDMATGRPRFCSRLLVHAVLARACQNWEGSQNQADFWNPETLYYRFLAEARRLWELA
YRGSSAKLTTIQAATLIDVCYRLNGLHKPATSYLDEALDMAEQTGLFREAPSTMDADTRNARDFTAWCLYTQDVS
EPADSQTMVQDAGDETAAQRASEQARLRKERREAKIRAGGSARLNKITGMGGRVVGGEAALSSSLCVLSELTPSL
FFLFFLDDEQVTTTTTASTPMAVADPEEVDLSQHLVEAMSPSPRGPSSPTVLSEAQLRKRVAELDGGDGSNDDAF
VKMLSQMMSGSSSSSSSSPFPGLPFPQPPSQQQEPTRQGHLLLFRLLHGMLSLGLGLYLSASLVGPALFTGSKAE
RERASLEALTTTTAEEQRRRRMVFLWVFATGEAVLLSSRFFWDKGRGTPPGLLWSVVGFLPEPLRGYVSVVIRYG
QILMTVRADVLACVFVLGAACWCRA*
Coding >Ophun1|93
ATGATCAGCCGCCTGCCGACTCCCCTGGATTTTTCCTCAGCAGCCAGCCTCTCAAGCATCCGCCGCAATGGGAGA
TGGCCAAGGTTCCCGATACCGACCGCTCCTCCGCGGTCCGAACCCCAGTCTGACAACAAGCCCGGTGCCGCCTCC
GAAGACGCCGTTGTCGAGGAAGCGGCCAAAACATCACGGCTGCTTGTGTGGCCTGTCGCTCGCGGAAGTCCAGGG
TGCCTCGGTCCGTTTGCTGCGTGTCTCGATGCAGCGGCTGATGCCTTGGTTACGAGCAGTGTGATGGCGTGCGGC
CTCGGTGCCACATCTCCGACGGAGACGCATGCGCAGACGACGAAGCGGGAATACGCCGAGCTTTGTAGCAGCGAG
AGCACGTCCGAAGAGTTTCTGGAGCTGCTCCGGACGTGCCCGGAGGCCGACGCGGATCAAATGCTGCGTCGGCTG
GGGGCCGGTGTGTCGCCTGGGGAGATATTGCGTCAGGCTCGAGACGGCAATCTCCTAGTTCAGGCTTCTCTGGCC
CCGGAGGCTCGGTTTCGCCGCCTTAGCAGCCCGTATCTAAAGCCGTTTCACGCCGCCCAGCTCATCGAAGAGAAG
CTCTCGGACCTGCGGCCGTCAAAGTGGACCTTGGTGGTCTCGGATGACGCGCTGCTGAGAAGGCTCCTCAGCGTC
TACTTTTTGCGCGAGTACCCATATCTCGCCATGTTCCACAAGGATTACTTCCTGCAAGACATGGCTACGGGACGC
CCGCGCTTCTGCTCTCGGCTCCTCGTTCATGCTGTGCTAGCCAGGGCTTGTCAAAACTGGGAGGGATCACAGAAC
CAGGCTGATTTCTGGAATCCTGAGACCTTGTATTACCGCTTTCTGGCCGAAGCCAGGAGACTCTGGGAGCTGGCC
TACCGAGGCAGCTCGGCAAAGCTGACGACGATACAGGCAGCGACCTTGATCGACGTATGCTATCGCCTGAATGGG
CTGCACAAGCCCGCCACGTCGTACCTGGACGAGGCTCTGGACATGGCCGAGCAAACGGGGCTGTTCAGGGAGGCG
CCGAGCACCATGGACGCGGACACGCGTAACGCGCGAGACTTTACCGCTTGGTGTTTATATACTCAGGATGTCTCA
GAACCGGCCGATAGCCAGACAATGGTCCAAGACGCAGGCGACGAGACGGCAGCCCAGCGCGCCTCGGAACAGGCC
CGTCTCCGCAAGGAGCGGCGCGAAGCCAAGATCAGGGCTGGGGGCTCGGCTCGACTGAATAAGATTACCGGCATG
GGCGGCCGCGTCGTCGGAGGTGAGGCGGCTCTCTCCTCTTCTCTCTGTGTGCTTTCTGAACTGACGCCTTCTCTC
TTTTTTCTTTTCTTTTTAGATGACGAGCAGGTGACGACGACGACGACGGCGTCGACTCCCATGGCAGTCGCCGAT
CCGGAAGAAGTTGATCTCTCGCAACACCTTGTTGAGGCCATGTCTCCATCGCCGCGGGGTCCATCATCGCCGACG
GTCCTTTCTGAAGCGCAGCTGCGGAAGAGAGTAGCCGAGCTCGACGGCGGCGACGGCTCCAACGACGACGCCTTT
GTCAAGATGCTATCCCAAATGATGAGCGGCTCCTCCTCCTCCTCCTCCTCCTCCCCTTTCCCCGGCCTCCCCTTC
CCACAACCCCCCTCCCAGCAGCAAGAACCCACACGGCAAGGCCACCTCCTCCTGTTCCGCCTGCTGCACGGCATG
CTAAGCCTCGGTCTGGGCCTGTACCTGTCCGCCTCGCTCGTCGGCCCCGCGCTCTTCACGGGCAGCAAGGCGGAG
CGCGAGCGGGCCAGCCTGGAGGCGTTGACGACGACGACGGCGGAGGAGCAGCGTCGGAGGCGGATGGTCTTCTTG
TGGGTCTTTGCTACGGGCGAGGCTGTGCTGCTGTCGTCGCGCTTCTTTTGGGATAAGGGGAGGGGGACGCCGCCG
GGGTTGCTTTGGTCGGTGGTTGGCTTCTTGCCTGAGCCGCTGAGGGGGTATGTCTCTGTGGTGATTCGCTATGGG
CAGATTTTGATGACGGTTCGGGCGGATGTTTTGGCTTGTGTTTTTGTGCTGGGGGCTGCGTGTTGGTGTAGAGCT
TAA
Transcript >Ophun1|93
ATGATCAGCCGCCTGCCGACTCCCCTGGATTTTTCCTCAGCAGCCAGCCTCTCAAGCATCCGCCGCAATGGGAGA
TGGCCAAGGTTCCCGATACCGACCGCTCCTCCGCGGTCCGAACCCCAGTCTGACAACAAGCCCGGTGCCGCCTCC
GAAGACGCCGTTGTCGAGGAAGCGGCCAAAACATCACGGCTGCTTGTGTGGCCTGTCGCTCGCGGAAGTCCAGGG
TGCCTCGGTCCGTTTGCTGCGTGTCTCGATGCAGCGGCTGATGCCTTGGTTACGAGCAGTGTGATGGCGTGCGGC
CTCGGTGCCACATCTCCGACGGAGACGCATGCGCAGACGACGAAGCGGGAATACGCCGAGCTTTGTAGCAGCGAG
AGCACGTCCGAAGAGTTTCTGGAGCTGCTCCGGACGTGCCCGGAGGCCGACGCGGATCAAATGCTGCGTCGGCTG
GGGGCCGGTGTGTCGCCTGGGGAGATATTGCGTCAGGCTCGAGACGGCAATCTCCTAGTTCAGGCTTCTCTGGCC
CCGGAGGCTCGGTTTCGCCGCCTTAGCAGCCCGTATCTAAAGCCGTTTCACGCCGCCCAGCTCATCGAAGAGAAG
CTCTCGGACCTGCGGCCGTCAAAGTGGACCTTGGTGGTCTCGGATGACGCGCTGCTGAGAAGGCTCCTCAGCGTC
TACTTTTTGCGCGAGTACCCATATCTCGCCATGTTCCACAAGGATTACTTCCTGCAAGACATGGCTACGGGACGC
CCGCGCTTCTGCTCTCGGCTCCTCGTTCATGCTGTGCTAGCCAGGGCTTGTCAAAACTGGGAGGGATCACAGAAC
CAGGCTGATTTCTGGAATCCTGAGACCTTGTATTACCGCTTTCTGGCCGAAGCCAGGAGACTCTGGGAGCTGGCC
TACCGAGGCAGCTCGGCAAAGCTGACGACGATACAGGCAGCGACCTTGATCGACGTATGCTATCGCCTGAATGGG
CTGCACAAGCCCGCCACGTCGTACCTGGACGAGGCTCTGGACATGGCCGAGCAAACGGGGCTGTTCAGGGAGGCG
CCGAGCACCATGGACGCGGACACGCGTAACGCGCGAGACTTTACCGCTTGGTGTTTATATACTCAGGATGTCTCA
GAACCGGCCGATAGCCAGACAATGGTCCAAGACGCAGGCGACGAGACGGCAGCCCAGCGCGCCTCGGAACAGGCC
CGTCTCCGCAAGGAGCGGCGCGAAGCCAAGATCAGGGCTGGGGGCTCGGCTCGACTGAATAAGATTACCGGCATG
GGCGGCCGCGTCGTCGGAGGTGAGGCGGCTCTCTCCTCTTCTCTCTGTGTGCTTTCTGAACTGACGCCTTCTCTC
TTTTTTCTTTTCTTTTTAGATGACGAGCAGGTGACGACGACGACGACGGCGTCGACTCCCATGGCAGTCGCCGAT
CCGGAAGAAGTTGATCTCTCGCAACACCTTGTTGAGGCCATGTCTCCATCGCCGCGGGGTCCATCATCGCCGACG
GTCCTTTCTGAAGCGCAGCTGCGGAAGAGAGTAGCCGAGCTCGACGGCGGCGACGGCTCCAACGACGACGCCTTT
GTCAAGATGCTATCCCAAATGATGAGCGGCTCCTCCTCCTCCTCCTCCTCCTCCCCTTTCCCCGGCCTCCCCTTC
CCACAACCCCCCTCCCAGCAGCAAGAACCCACACGGCAAGGCCACCTCCTCCTGTTCCGCCTGCTGCACGGCATG
CTAAGCCTCGGTCTGGGCCTGTACCTGTCCGCCTCGCTCGTCGGCCCCGCGCTCTTCACGGGCAGCAAGGCGGAG
CGCGAGCGGGCCAGCCTGGAGGCGTTGACGACGACGACGGCGGAGGAGCAGCGTCGGAGGCGGATGGTCTTCTTG
TGGGTCTTTGCTACGGGCGAGGCTGTGCTGCTGTCGTCGCGCTTCTTTTGGGATAAGGGGAGGGGGACGCCGCCG
GGGTTGCTTTGGTCGGTGGTTGGCTTCTTGCCTGAGCCGCTGAGGGGGTATGTCTCTGTGGTGATTCGCTATGGG
CAGATTTTGATGACGGTTCGGGCGGATGTTTTGGCTTGTGTTTTTGTGCTGGGGGCTGCGTGTTGGTGTAGAGCT
TAA
Gene >Ophun1|93
ATGATCAGCCGCCTGCCGACTCCCCTGGATTTTTCCTCAGCAGCCAGCCTCTCAAGCATCCGCCGCAATGGGAGA
TGGCCAAGGTTCCCGATACCGACCGCTCCTCCGCGGTCCGAACCCCAGTCTGACAACAAGCCCGGTGCCGCCTCC
GAAGACGCCGTTGTCGAGGAAGCGGCCAAAACATCACGGCTGCTTGTGTGGCCTGTCGCTCGCGGAAGTCCAGGG
TGCCTCGGTCCGTTTGCTGCGTGTCTCGATGCAGCGGCTGATGCCTTGGTTACGAGCAGTGTGATGGCGTGCGGC
CTCGGTGCCACATCTGTACTTTCAAGGGCACGGCTTGCGTTTACACGGGACAGCCGACGGAGACGCATGCGCAGA
CGACGAAGCGGGAATACGCCGAGCTTTGTAGCAGCGAGAGCACGTCCGAAGAGTTTCTGGAGCTGCTCCGGACGT
GCCCGGAGGCCGACGCGGATCAAATGCTGCGTCGGCTGGGGGCCGGTGTGTCGCCTGGGGAGATATTGCGTCAGG
CTCGAGACGGCAATCTCCTAGTTCAGGCTTCTCTGGCCCCGGAGGCTCGGTTTCGGTATGACTTTATGCCCATCA
AGTCGCTACCGTCCTTTCTCATCACGCCGGACAATCAATACCTTGGCACGACGCTCTATGAATCCGCATTCTCCA
ACGTCAGCGGCTCTTCCGAGTAGCAGCCGCCTTAGCAGCCCGTATCTAAAGCCGTTTCACGCCGCCCAGCTCATC
GAAGAGAAGCTCTCGGACCTGCGGCCGTCAAAGTGGACCTTGGTGGTCTCGGATGACGCGCTGCTGAGAAGGCTC
CTCAGCGTCTACTTTTTGCGCGAGTACCCATATCTCGCCATGTTCCACAAGGATTACTTCCTGCAAGACATGGCT
ACGGGACGCCCGCGCTTCTGCTCTCGGCTCCTCGTTCATGCTGTGCTAGCCAGGGCTTGTGTGAGAGCCGGACTC
CAGGGCTTGACGTCGATGCACGACAGCCTGCTAACAGGCTCGGCAGCAAAACTGGGAGGGATCACAGAACCAGGC
TGATTTCTGGAATCCTGAGACCTTGTATTACCGCTTTCTGGCCGAAGCCAGGAGACTCTGGGAGCTGGCCTACCG
AGGCAGCTCGGCAAAGCTGACGACGATACAGGCAGCGACCTTGATCGACGTATGCTATCGCCTGAATGGGCTGCA
CAAGCCCGCCACGTCGTACCTGGACGAGGCTCTGGACATGGCCGAGCAAACGGGGCTGTTCAGGGAGGCGCCGAG
CACCATGGACGCGGACACGCGTAACGCGCGAGACTTTACCGCTTGGTGTTTATATACTCAGGATGTGTAAGTGAC
GGCTCGCTCATGGGACGGAAGGACGTTTCACAAGATTGTCTGCACGCTGCGGGAGTTTCTGACGGAGGACGAGCC
CGATGATCAAGAGGCAAAAGGACACATATCAGATTATCAGTTCTGTGTGCGGACTTGTGGGTAGACGACTGCTAG
AGATGAGCGGAGACGAGAGCGCCAGGACATGAGAAAAGAAGAGTGAATGATGGTAGAGCATCTTGGAAGCGATGG
GAGGATGATAGGGTCATGTTGACCGTGAAGATAAAGACCGAGGTGGGTTAACGGCCGTTCATCAACAGTCAATGC
CCTGTGGAGTGGGAGAGGTTCAAAAGGTGGCACGTGACAGCTCCCTCAAGCCAATCACGACGCACCACTCCGACA
ACCTTCCACCCACAGCAGTCTTAAGACTGCCTCTCTACCGTCAAACCCCCATCACCTGCTCCCTCTCCCGCAGCT
CAGAACCGGCCGATAGCCAGACAATGGTCCAAGACGCAGGCGACGAGACGGCAGCCCAGCGCGCCTCGGAACAGG
CCCGTCTCCGCAAGGAGCGGCGCGAAGCCAAGATCAGGGCTGGGGGCTCGGCTCGACTGAATAAGATTACCGGCA
TGGGCGGCCGCGTCGTCGGAGGTGAGGCGGCTCTCTCCTCTTCTCTCTGTGTGCTTTCTGAACTGACGCCTTCTC
TCTTTTTTCTTTTCTTTTTAGATGACGAGCAGGTGACGACGACGACGACGGCGTCGACTCCCATGGCAGTCGCCG
ATCCGGAAGAAGTTGATCTCTCGCAACACCTTGTTGAGGCCATGTCTCCATCGCCGCGGGGTCCATCATCGCCGA
CGGTCCTTTCTGAAGCGCAGCTGCGGAAGAGAGTAGCCGAGCTCGACGGCGGCGACGGCTCCAACGACGACGCCT
TTGTCAAGATGCTATCCCAAATGATGAGCGGCTCCTCCTCCTCCTCCTCCTCCTCCCCTTTCCCCGGCCTCCCCT
TCCCACAACCCCCCTCCCAGCAGCAAGAACCCACACGGCAAGGCCACCTCCTCCTGTTCCGCCTGCTGCACGGCA
TGCTAAGCCTCGGTCTGGGCCTGTACCTGTCCGCCTCGCTCGTCGGCCCCGCGCTCTTCACGGGCAGCAAGGCGG
AGCGCGAGCGGGCCAGCCTGGAGGCGTTGACGACGACGACGGCGGAGGAGCAGCGTCGGAGGCGGATGGTCTTCT
TGTGGGTCTTTGCTACGGGCGAGGCTGTGCTGCTGTCGTCGCGCTTCTTTTGGGATAAGGGGAGGGGGACGCCGC
CGGGGTTGCTTTGGTCGGTGGTTGGCTTCTTGCCTGAGCCGCTGAGGGGGTATGTCTCTGTGGTGATTCGCTATG
GGCAGATTTTGATGACGGTTCGGGCGGATGTTTTGGCTTGTGTTTTTGTGCTGGGGGCTGCGTGTTGGTGTAGAG
CTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail