Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|916
Gene name
LocationContig_1324:172..1123
Strand+
Gene length (bp)951
Transcript length (bp)951
Coding sequence length (bp)951
Protein length (aa) 317

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00701 DHDPS Dihydrodipicolinate synthetase family 1.1E-40 10 272

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5BD77|HOGA1_EMENI Probable 4-hydroxy-2-oxoglutarate aldolase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN1503 PE=1 SV=1 5 307 3.0E-110
sp|A8DRH7|LGA1_ASPNG L-threo-3-deoxy-hexylosonate aldolase OS=Aspergillus niger GN=gaaC PE=3 SV=1 3 302 5.0E-82
sp|A6Y9S5|LGA1_HYPJE L-threo-3-deoxy-hexylosonate aldolase OS=Hypocrea jecorina GN=lga1 PE=1 SV=1 1 307 2.0E-79
sp|P0CL20|HOGA1_COCIM Putative 4-hydroxy-2-oxoglutarate aldolase, mitochondrial OS=Coccidioides immitis (strain RS) GN=CIMG_00151 PE=3 SV=1 4 307 7.0E-57
sp|Q5M8W9|HOGA1_XENTR 4-hydroxy-2-oxoglutarate aldolase, mitochondrial OS=Xenopus tropicalis GN=hoga1 PE=2 SV=2 10 307 3.0E-51
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5BD77|HOGA1_EMENI Probable 4-hydroxy-2-oxoglutarate aldolase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN1503 PE=1 SV=1 5 307 3.0E-110
sp|A8DRH7|LGA1_ASPNG L-threo-3-deoxy-hexylosonate aldolase OS=Aspergillus niger GN=gaaC PE=3 SV=1 3 302 5.0E-82
sp|A6Y9S5|LGA1_HYPJE L-threo-3-deoxy-hexylosonate aldolase OS=Hypocrea jecorina GN=lga1 PE=1 SV=1 1 307 2.0E-79
sp|P0CL20|HOGA1_COCIM Putative 4-hydroxy-2-oxoglutarate aldolase, mitochondrial OS=Coccidioides immitis (strain RS) GN=CIMG_00151 PE=3 SV=1 4 307 7.0E-57
sp|Q5M8W9|HOGA1_XENTR 4-hydroxy-2-oxoglutarate aldolase, mitochondrial OS=Xenopus tropicalis GN=hoga1 PE=2 SV=2 10 307 3.0E-51
sp|Q5XGL6|HOGA1_XENLA 4-hydroxy-2-oxoglutarate aldolase, mitochondrial OS=Xenopus laevis GN=hoga1 PE=2 SV=1 10 307 1.0E-50
sp|Q0P5I5|HOGA1_BOVIN 4-hydroxy-2-oxoglutarate aldolase, mitochondrial OS=Bos taurus GN=HOGA1 PE=1 SV=1 10 281 2.0E-47
sp|Q86XE5|HOGA1_HUMAN 4-hydroxy-2-oxoglutarate aldolase, mitochondrial OS=Homo sapiens GN=HOGA1 PE=1 SV=1 10 281 7.0E-47
sp|Q9DCU9|HOGA1_MOUSE 4-hydroxy-2-oxoglutarate aldolase, mitochondrial OS=Mus musculus GN=Hoga1 PE=1 SV=1 10 293 3.0E-46
sp|Q6NY77|HOGA1_DANRE 4-hydroxy-2-oxoglutarate aldolase, mitochondrial OS=Danio rerio GN=zgc:77082 PE=2 SV=1 10 296 5.0E-45
sp|P75682|YAGE_ECOLI Probable 2-keto-3-deoxy-galactonate aldolase YagE OS=Escherichia coli (strain K12) GN=yagE PE=1 SV=2 3 292 2.0E-31
sp|Q5JGK8|DAPAL_THEKO Uncharacterized DapA-like lyase TK1237 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=dapAL PE=3 SV=1 10 294 5.0E-28
sp|B5YKK4|DAPA_THEYD 4-hydroxy-tetrahydrodipicolinate synthase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=dapA PE=3 SV=1 35 305 1.0E-27
sp|B0SL58|DAPA_LEPBP 4-hydroxy-tetrahydrodipicolinate synthase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=dapA PE=3 SV=1 10 301 2.0E-27
sp|B0SCT0|DAPA_LEPBA 4-hydroxy-tetrahydrodipicolinate synthase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=dapA PE=3 SV=1 10 301 2.0E-27
sp|Q12ZG2|DAPA_METBU 4-hydroxy-tetrahydrodipicolinate synthase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=dapA PE=3 SV=1 10 250 8.0E-27
sp|A0LDB5|DAPA_MAGMM 4-hydroxy-tetrahydrodipicolinate synthase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=dapA PE=3 SV=1 10 246 3.0E-26
sp|Q5V5D4|DAPA_HALMA 4-hydroxy-tetrahydrodipicolinate synthase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=dapA PE=3 SV=1 10 227 6.0E-26
sp|O29352|DAPA_ARCFU 4-hydroxy-tetrahydrodipicolinate synthase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=dapA PE=3 SV=1 10 302 2.0E-25
sp|Q39Z67|DAPA_GEOMG 4-hydroxy-tetrahydrodipicolinate synthase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=dapA PE=3 SV=1 49 294 3.0E-25
sp|Q46DC4|DAPA_METBF 4-hydroxy-tetrahydrodipicolinate synthase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=dapA PE=3 SV=1 17 250 3.0E-25
sp|A9NGC2|DAPA_ACHLI 4-hydroxy-tetrahydrodipicolinate synthase OS=Acholeplasma laidlawii (strain PG-8A) GN=dapA PE=3 SV=1 35 282 6.0E-25
sp|Q3A1U7|DAPA_PELCD 4-hydroxy-tetrahydrodipicolinate synthase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=dapA PE=3 SV=1 49 297 7.0E-25
sp|C4L2D2|DAPA_EXISA 4-hydroxy-tetrahydrodipicolinate synthase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=dapA PE=3 SV=1 10 300 8.0E-25
sp|Q2FNR0|DAPA_METHJ 4-hydroxy-tetrahydrodipicolinate synthase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=dapA PE=3 SV=1 24 301 8.0E-25
sp|A3DE17|DAPA_CLOTH 4-hydroxy-tetrahydrodipicolinate synthase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=dapA PE=3 SV=1 42 302 1.0E-24
sp|A5FZS7|DAPA_ACICJ 4-hydroxy-tetrahydrodipicolinate synthase OS=Acidiphilium cryptum (strain JF-5) GN=dapA PE=3 SV=1 44 247 3.0E-24
sp|Q67P59|DAPA_SYMTH 4-hydroxy-tetrahydrodipicolinate synthase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=dapA PE=3 SV=1 17 307 4.0E-24
sp|C0QT41|DAPA_PERMH 4-hydroxy-tetrahydrodipicolinate synthase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=dapA PE=3 SV=1 18 246 6.0E-24
sp|Q9KC32|DAPA1_BACHD 4-hydroxy-tetrahydrodipicolinate synthase 1 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=dapA1 PE=3 SV=1 17 291 9.0E-24
sp|B8DKU0|DAPA_DESVM 4-hydroxy-tetrahydrodipicolinate synthase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=dapA PE=3 SV=1 16 253 1.0E-23
sp|Q8Y766|DAPA_LISMO 4-hydroxy-tetrahydrodipicolinate synthase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dapA PE=3 SV=1 44 299 1.0E-23
sp|Q8PXL7|DAPA_METMA 4-hydroxy-tetrahydrodipicolinate synthase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=dapA PE=3 SV=1 17 250 1.0E-23
sp|Q74GT6|DAPA_GEOSL 4-hydroxy-tetrahydrodipicolinate synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=dapA PE=3 SV=1 49 288 3.0E-23
sp|B9MRD1|DAPA_CALBD 4-hydroxy-tetrahydrodipicolinate synthase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=dapA PE=3 SV=1 82 282 4.0E-23
sp|A5ULF8|DAPA_METS3 4-hydroxy-tetrahydrodipicolinate synthase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=dapA PE=3 SV=1 10 295 4.0E-23
sp|C5CHX9|DAPA_KOSOT 4-hydroxy-tetrahydrodipicolinate synthase OS=Kosmotoga olearia (strain TBF 19.5.1) GN=dapA PE=3 SV=1 16 245 6.0E-23
sp|Q71ZN5|DAPA_LISMF 4-hydroxy-tetrahydrodipicolinate synthase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dapA PE=3 SV=1 44 299 6.0E-23
sp|C1L2Z1|DAPA_LISMC 4-hydroxy-tetrahydrodipicolinate synthase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dapA PE=3 SV=1 44 299 6.0E-23
sp|A4XJU0|DAPA_CALS8 4-hydroxy-tetrahydrodipicolinate synthase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=dapA PE=3 SV=1 82 282 7.0E-23
sp|A3CVI7|DAPA_METMJ 4-hydroxy-tetrahydrodipicolinate synthase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=dapA PE=3 SV=1 25 240 7.0E-23
sp|A0PZM3|DAPA_CLONN 4-hydroxy-tetrahydrodipicolinate synthase OS=Clostridium novyi (strain NT) GN=dapA PE=3 SV=1 45 302 9.0E-23
sp|A4FYQ3|DAPA_METM5 4-hydroxy-tetrahydrodipicolinate synthase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=dapA PE=3 SV=1 10 293 1.0E-22
sp|B8DE74|DAPA_LISMH 4-hydroxy-tetrahydrodipicolinate synthase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dapA PE=3 SV=1 44 299 1.0E-22
sp|B9DS79|DAPA_STRU0 4-hydroxy-tetrahydrodipicolinate synthase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=dapA PE=3 SV=1 35 246 1.0E-22
sp|Q8THP1|DAPA_METAC 4-hydroxy-tetrahydrodipicolinate synthase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=dapA PE=3 SV=1 17 250 2.0E-22
sp|Q8F132|DAPA_LEPIN 4-hydroxy-tetrahydrodipicolinate synthase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=dapA PE=3 SV=1 10 281 2.0E-22
sp|Q72U22|DAPA_LEPIC 4-hydroxy-tetrahydrodipicolinate synthase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=dapA PE=3 SV=1 10 281 2.0E-22
sp|B8GKG7|DAPA_METPE 4-hydroxy-tetrahydrodipicolinate synthase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=dapA PE=3 SV=1 37 250 2.0E-22
sp|B2V6F1|DAPA_SULSY 4-hydroxy-tetrahydrodipicolinate synthase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=dapA PE=3 SV=1 35 246 2.0E-22
sp|A6UVG7|DAPA_META3 4-hydroxy-tetrahydrodipicolinate synthase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=dapA PE=3 SV=1 18 291 2.0E-22
sp|Q5WUD4|DAPA_LEGPL 4-hydroxy-tetrahydrodipicolinate synthase OS=Legionella pneumophila (strain Lens) GN=dapA PE=3 SV=1 33 281 2.0E-22
sp|Q5ZT51|DAPA_LEGPH 4-hydroxy-tetrahydrodipicolinate synthase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=dapA PE=3 SV=1 33 281 2.0E-22
sp|Q15SZ4|DAPA_PSEA6 4-hydroxy-tetrahydrodipicolinate synthase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=dapA PE=3 SV=1 10 250 3.0E-22
sp|A0B7E1|DAPA_METTP 4-hydroxy-tetrahydrodipicolinate synthase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=dapA PE=3 SV=1 10 246 3.0E-22
sp|A0LEA7|DAPA_SYNFM 4-hydroxy-tetrahydrodipicolinate synthase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=dapA PE=3 SV=1 44 245 3.0E-22
sp|B5EGX4|DAPA_GEOBB 4-hydroxy-tetrahydrodipicolinate synthase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=dapA PE=3 SV=1 49 281 3.0E-22
sp|B9DP23|DAPA_STACT 4-hydroxy-tetrahydrodipicolinate synthase OS=Staphylococcus carnosus (strain TM300) GN=dapA PE=3 SV=1 7 299 4.0E-22
sp|Q8EQJ1|DAPA_OCEIH 4-hydroxy-tetrahydrodipicolinate synthase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=dapA PE=3 SV=1 16 301 4.0E-22
sp|A8MF40|DAPA_ALKOO 4-hydroxy-tetrahydrodipicolinate synthase OS=Alkaliphilus oremlandii (strain OhILAs) GN=dapA PE=3 SV=1 35 246 4.0E-22
sp|C6E9Q9|DAPA_GEOSM 4-hydroxy-tetrahydrodipicolinate synthase OS=Geobacter sp. (strain M21) GN=dapA PE=3 SV=1 49 281 5.0E-22
sp|A5IEB3|DAPA_LEGPC 4-hydroxy-tetrahydrodipicolinate synthase OS=Legionella pneumophila (strain Corby) GN=dapA PE=3 SV=1 33 281 5.0E-22
sp|Q6MDD9|DAPA_PARUW 4-hydroxy-tetrahydrodipicolinate synthase OS=Protochlamydia amoebophila (strain UWE25) GN=dapA PE=3 SV=1 10 285 6.0E-22
sp|A9A656|DAPA_METM6 4-hydroxy-tetrahydrodipicolinate synthase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=dapA PE=3 SV=1 10 293 6.0E-22
sp|Q3ISQ0|DAPA_NATPD 4-hydroxy-tetrahydrodipicolinate synthase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=dapA PE=3 SV=1 10 246 6.0E-22
sp|Q8PLN5|DAPA_XANAC 4-hydroxy-tetrahydrodipicolinate synthase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=dapA PE=3 SV=1 10 270 7.0E-22
sp|B2A3B2|DAPA_NATTJ 4-hydroxy-tetrahydrodipicolinate synthase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=dapA PE=3 SV=1 16 302 7.0E-22
sp|A4TMN2|DAPA_YERPP 4-hydroxy-tetrahydrodipicolinate synthase OS=Yersinia pestis (strain Pestoides F) GN=dapA PE=3 SV=2 18 295 8.0E-22
sp|Q8ZCD0|DAPA_YERPE 4-hydroxy-tetrahydrodipicolinate synthase OS=Yersinia pestis GN=dapA PE=3 SV=1 18 295 8.0E-22
sp|A7FG49|DAPA_YERP3 4-hydroxy-tetrahydrodipicolinate synthase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=dapA PE=3 SV=1 18 295 8.0E-22
sp|Q5F849|DAPA_NEIG1 4-hydroxy-tetrahydrodipicolinate synthase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=dapA PE=3 SV=1 44 246 9.0E-22
sp|Q92WP0|NANA_RHIME N-acetylneuraminate lyase OS=Rhizobium meliloti (strain 1021) GN=nanA PE=3 SV=1 10 301 1.0E-21
sp|Q9HS19|DAPAL_HALSA Uncharacterized DapA-like lyase VNG_0444G OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=dapAL PE=3 SV=2 10 281 1.0E-21
sp|B0R3D6|DAPAL_HALS3 Uncharacterized DapA-like lyase OE_1665R OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=dapAL PE=3 SV=1 10 281 1.0E-21
sp|Q8Y099|DAPA_RALSO 4-hydroxy-tetrahydrodipicolinate synthase OS=Ralstonia solanacearum (strain GMI1000) GN=dapA PE=3 SV=1 35 282 1.0E-21
sp|Q8P9V6|DAPA_XANCP 4-hydroxy-tetrahydrodipicolinate synthase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=dapA PE=3 SV=1 10 270 1.0E-21
sp|Q9A900|DAPA_CAUCR 4-hydroxy-tetrahydrodipicolinate synthase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=dapA PE=3 SV=1 18 246 1.0E-21
sp|A0AIN8|DAPA_LISW6 4-hydroxy-tetrahydrodipicolinate synthase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dapA PE=3 SV=1 44 246 2.0E-21
sp|B9M380|DAPA_GEODF 4-hydroxy-tetrahydrodipicolinate synthase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=dapA PE=3 SV=1 35 268 2.0E-21
sp|A1JL07|DAPA_YERE8 4-hydroxy-tetrahydrodipicolinate synthase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=dapA PE=3 SV=1 18 295 2.0E-21
sp|P39359|YJHH_ECOLI Uncharacterized lyase YjhH OS=Escherichia coli (strain K12) GN=yjhH PE=3 SV=2 10 269 2.0E-21
sp|B6YU51|DAPAL_THEON Uncharacterized DapA-like lyase TON_0506 OS=Thermococcus onnurineus (strain NA1) GN=dapAL PE=3 SV=1 10 301 2.0E-21
sp|B1YJ39|DAPA_EXIS2 4-hydroxy-tetrahydrodipicolinate synthase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=dapA PE=3 SV=1 17 283 2.0E-21
sp|Q97GI9|DAPA1_CLOAB 4-hydroxy-tetrahydrodipicolinate synthase 1 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=dapA1 PE=3 SV=1 35 297 3.0E-21
sp|B2GC11|DAPA_LACF3 4-hydroxy-tetrahydrodipicolinate synthase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=dapA PE=3 SV=1 16 246 4.0E-21
sp|Q21HE7|DAPA_SACD2 4-hydroxy-tetrahydrodipicolinate synthase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=dapA PE=3 SV=1 45 250 5.0E-21
sp|O26892|DAPA_METTH 4-hydroxy-tetrahydrodipicolinate synthase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=dapA PE=3 SV=1 10 282 5.0E-21
sp|B0K4I3|DAPA_THEPX 4-hydroxy-tetrahydrodipicolinate synthase OS=Thermoanaerobacter sp. (strain X514) GN=dapA PE=3 SV=1 45 291 6.0E-21
sp|B0KAL7|DAPA_THEP3 4-hydroxy-tetrahydrodipicolinate synthase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=dapA PE=3 SV=1 45 291 6.0E-21
sp|Q668F7|DAPA_YERPS 4-hydroxy-tetrahydrodipicolinate synthase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=dapA PE=3 SV=2 18 295 6.0E-21
sp|B2VE56|DAPA_ERWT9 4-hydroxy-tetrahydrodipicolinate synthase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=dapA PE=3 SV=1 18 246 9.0E-21
sp|Q9JZR4|DAPA_NEIMB 4-hydroxy-tetrahydrodipicolinate synthase OS=Neisseria meningitidis serogroup B (strain MC58) GN=dapA PE=1 SV=1 44 246 9.0E-21
sp|A9HIW2|DAPA_GLUDA 4-hydroxy-tetrahydrodipicolinate synthase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=dapA PE=3 SV=1 43 251 9.0E-21
sp|A5GD89|DAPA_GEOUR 4-hydroxy-tetrahydrodipicolinate synthase OS=Geobacter uraniireducens (strain Rf4) GN=dapA PE=3 SV=1 49 281 1.0E-20
sp|Q57695|DAPA_METJA 4-hydroxy-tetrahydrodipicolinate synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=dapA PE=1 SV=1 10 302 1.0E-20
sp|Q8TUZ4|DAPA_METKA 4-hydroxy-tetrahydrodipicolinate synthase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=dapA PE=3 SV=1 18 304 1.0E-20
sp|B4SRX7|DAPA_STRM5 4-hydroxy-tetrahydrodipicolinate synthase OS=Stenotrophomonas maltophilia (strain R551-3) GN=dapA PE=3 SV=1 81 283 1.0E-20
sp|B9EBZ6|DAPA_MACCJ 4-hydroxy-tetrahydrodipicolinate synthase OS=Macrococcus caseolyticus (strain JCSC5402) GN=dapA PE=3 SV=1 25 283 1.0E-20
sp|A9M4C8|DAPA_NEIM0 4-hydroxy-tetrahydrodipicolinate synthase OS=Neisseria meningitidis serogroup C (strain 053442) GN=dapA PE=3 SV=1 44 246 1.0E-20
sp|Q92BS0|DAPA_LISIN 4-hydroxy-tetrahydrodipicolinate synthase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dapA PE=3 SV=1 44 299 2.0E-20
sp|Q9JUU9|DAPA_NEIMA 4-hydroxy-tetrahydrodipicolinate synthase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=dapA PE=3 SV=1 44 246 2.0E-20
sp|Q8RQM8|DAPA_COREF 4-hydroxy-tetrahydrodipicolinate synthase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=dapA PE=3 SV=1 11 292 2.0E-20
sp|B2FL61|DAPA_STRMK 4-hydroxy-tetrahydrodipicolinate synthase OS=Stenotrophomonas maltophilia (strain K279a) GN=dapA PE=3 SV=1 81 283 2.0E-20
sp|Q8RBI5|DAPA_CALS4 4-hydroxy-tetrahydrodipicolinate synthase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=dapA PE=3 SV=1 45 307 2.0E-20
sp|A1KTJ9|DAPA_NEIMF 4-hydroxy-tetrahydrodipicolinate synthase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=dapA PE=3 SV=1 44 246 2.0E-20
sp|Q1WU86|DAPA_LACS1 4-hydroxy-tetrahydrodipicolinate synthase OS=Lactobacillus salivarius (strain UCC118) GN=dapA PE=3 SV=1 16 283 2.0E-20
sp|A6US71|DAPA_METVS 4-hydroxy-tetrahydrodipicolinate synthase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=dapA PE=3 SV=1 10 293 2.0E-20
sp|B0THT2|DAPA_HELMI 4-hydroxy-tetrahydrodipicolinate synthase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=dapA PE=3 SV=1 16 305 2.0E-20
sp|A7MP70|DAPA_CROS8 4-hydroxy-tetrahydrodipicolinate synthase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=dapA PE=3 SV=1 18 243 3.0E-20
sp|A1WZ50|DAPA_HALHL 4-hydroxy-tetrahydrodipicolinate synthase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=dapA PE=3 SV=1 10 246 3.0E-20
sp|Q3YZ74|DAPA_SHISS 4-hydroxy-tetrahydrodipicolinate synthase OS=Shigella sonnei (strain Ss046) GN=dapA PE=3 SV=1 18 243 4.0E-20
sp|Q31Y13|DAPA_SHIBS 4-hydroxy-tetrahydrodipicolinate synthase OS=Shigella boydii serotype 4 (strain Sb227) GN=dapA PE=3 SV=1 18 243 4.0E-20
sp|B2TXQ4|DAPA_SHIB3 4-hydroxy-tetrahydrodipicolinate synthase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=dapA PE=3 SV=1 18 243 4.0E-20
sp|B1LNC8|DAPA_ECOSM 4-hydroxy-tetrahydrodipicolinate synthase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=dapA PE=3 SV=1 18 243 4.0E-20
sp|B6I548|DAPA_ECOSE 4-hydroxy-tetrahydrodipicolinate synthase OS=Escherichia coli (strain SE11) GN=dapA PE=3 SV=1 18 243 4.0E-20
sp|P63943|DAPA_ECOL6 4-hydroxy-tetrahydrodipicolinate synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dapA PE=3 SV=1 18 243 4.0E-20
sp|A8A2X1|DAPA_ECOHS 4-hydroxy-tetrahydrodipicolinate synthase OS=Escherichia coli O9:H4 (strain HS) GN=dapA PE=3 SV=1 18 243 4.0E-20
sp|B7MYB7|DAPA_ECO81 4-hydroxy-tetrahydrodipicolinate synthase OS=Escherichia coli O81 (strain ED1a) GN=dapA PE=3 SV=1 18 243 4.0E-20
sp|B7NQL6|DAPA_ECO7I 4-hydroxy-tetrahydrodipicolinate synthase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=dapA PE=3 SV=1 18 243 4.0E-20
sp|B5Z015|DAPA_ECO5E 4-hydroxy-tetrahydrodipicolinate synthase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=dapA PE=3 SV=1 18 243 4.0E-20
sp|P63944|DAPA_ECO57 4-hydroxy-tetrahydrodipicolinate synthase OS=Escherichia coli O157:H7 GN=dapA PE=3 SV=1 18 243 4.0E-20
sp|B7LCL6|DAPA_ECO55 4-hydroxy-tetrahydrodipicolinate synthase OS=Escherichia coli (strain 55989 / EAEC) GN=dapA PE=3 SV=1 18 243 4.0E-20
sp|A7ZPS4|DAPA_ECO24 4-hydroxy-tetrahydrodipicolinate synthase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=dapA PE=3 SV=1 18 243 4.0E-20
sp|A6VJM9|DAPA_METM7 4-hydroxy-tetrahydrodipicolinate synthase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=dapA PE=3 SV=1 10 293 4.0E-20
sp|Q053P3|DAPA_LEPBL 4-hydroxy-tetrahydrodipicolinate synthase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=dapA PE=3 SV=1 10 271 5.0E-20
sp|Q9UZ94|DAPAL_PYRAB Uncharacterized DapA-like lyase PYRAB12600 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=dapAL PE=3 SV=1 10 249 5.0E-20
sp|B7LKG3|DAPA_ESCF3 4-hydroxy-tetrahydrodipicolinate synthase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=dapA PE=3 SV=1 18 243 5.0E-20
sp|A1VCZ9|DAPA_DESVV 4-hydroxy-tetrahydrodipicolinate synthase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=dapA PE=3 SV=1 42 245 5.0E-20
sp|Q72AX2|DAPA_DESVH 4-hydroxy-tetrahydrodipicolinate synthase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=dapA PE=3 SV=1 42 245 5.0E-20
sp|Q1MPX7|DAPA_LAWIP 4-hydroxy-tetrahydrodipicolinate synthase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=dapA PE=3 SV=2 42 281 6.0E-20
sp|Q4ZW75|DAPA_PSEU2 4-hydroxy-tetrahydrodipicolinate synthase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=dapA PE=3 SV=1 33 271 6.0E-20
sp|Q89AY0|DAPA_BUCBP 4-hydroxy-tetrahydrodipicolinate synthase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=dapA PE=3 SV=1 32 243 7.0E-20
sp|Q6LZP8|DAPA_METMP 4-hydroxy-tetrahydrodipicolinate synthase OS=Methanococcus maripaludis (strain S2 / LL) GN=dapA PE=3 SV=1 10 293 7.0E-20
sp|Q5FUW9|DAPA_GLUOX 4-hydroxy-tetrahydrodipicolinate synthase OS=Gluconobacter oxydans (strain 621H) GN=dapA PE=3 SV=2 16 286 8.0E-20
sp|Q04U80|DAPA_LEPBJ 4-hydroxy-tetrahydrodipicolinate synthase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=dapA PE=3 SV=1 10 271 1.0E-19
sp|Q49XJ7|DAPA_STAS1 4-hydroxy-tetrahydrodipicolinate synthase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=dapA PE=3 SV=1 10 297 1.0E-19
sp|Q60B13|DAPA_METCA 4-hydroxy-tetrahydrodipicolinate synthase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=dapA PE=3 SV=1 10 248 1.0E-19
sp|Q310Q2|DAPA_DESAG 4-hydroxy-tetrahydrodipicolinate synthase OS=Desulfovibrio alaskensis (strain G20) GN=dapA PE=3 SV=1 16 245 1.0E-19
sp|B4S5J5|DAPA_PROA2 4-hydroxy-tetrahydrodipicolinate synthase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=dapA PE=3 SV=1 10 246 1.0E-19
sp|Q3SJU8|DAPA_THIDA 4-hydroxy-tetrahydrodipicolinate synthase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=dapA PE=3 SV=1 18 244 1.0E-19
sp|Q8NWS5|DAPA_STAAW 4-hydroxy-tetrahydrodipicolinate synthase OS=Staphylococcus aureus (strain MW2) GN=dapA PE=3 SV=1 7 225 1.0E-19
sp|Q6G9G6|DAPA_STAAS 4-hydroxy-tetrahydrodipicolinate synthase OS=Staphylococcus aureus (strain MSSA476) GN=dapA PE=3 SV=1 7 225 1.0E-19
sp|P0A6L3|DAPA_SHIFL 4-hydroxy-tetrahydrodipicolinate synthase OS=Shigella flexneri GN=dapA PE=3 SV=1 18 243 1.0E-19
sp|P0A6L2|DAPA_ECOLI 4-hydroxy-tetrahydrodipicolinate synthase OS=Escherichia coli (strain K12) GN=dapA PE=1 SV=1 18 243 1.0E-19
sp|B1IWI1|DAPA_ECOLC 4-hydroxy-tetrahydrodipicolinate synthase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=dapA PE=3 SV=1 18 243 1.0E-19
sp|B7M7I1|DAPA_ECO8A 4-hydroxy-tetrahydrodipicolinate synthase OS=Escherichia coli O8 (strain IAI1) GN=dapA PE=3 SV=1 18 243 1.0E-19
sp|A1S0T1|DAPAL_THEPD Uncharacterized DapA-like lyase Tpen_1666 OS=Thermofilum pendens (strain Hrk 5) GN=dapAL PE=3 SV=1 10 298 1.0E-19
sp|Q6GH13|DAPA_STAAR 4-hydroxy-tetrahydrodipicolinate synthase OS=Staphylococcus aureus (strain MRSA252) GN=dapA PE=1 SV=1 7 225 1.0E-19
sp|Q8DUE5|DAPA_STRMU 4-hydroxy-tetrahydrodipicolinate synthase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dapA PE=3 SV=1 37 217 2.0E-19
sp|Q8DJK4|DAPA_THEEB 4-hydroxy-tetrahydrodipicolinate synthase OS=Thermosynechococcus elongatus (strain BP-1) GN=dapA PE=3 SV=1 17 281 2.0E-19
sp|A8Z3X3|DAPA_STAAT 4-hydroxy-tetrahydrodipicolinate synthase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dapA PE=3 SV=1 7 297 2.0E-19
sp|A6QGU6|DAPA_STAAE 4-hydroxy-tetrahydrodipicolinate synthase OS=Staphylococcus aureus (strain Newman) GN=dapA PE=3 SV=1 7 297 2.0E-19
sp|Q5HG25|DAPA_STAAC 4-hydroxy-tetrahydrodipicolinate synthase OS=Staphylococcus aureus (strain COL) GN=dapA PE=1 SV=1 7 297 2.0E-19
sp|Q9EZ12|DAPA_STAA8 4-hydroxy-tetrahydrodipicolinate synthase OS=Staphylococcus aureus (strain NCTC 8325) GN=dapA PE=3 SV=1 7 297 2.0E-19
sp|Q2FH43|DAPA_STAA3 4-hydroxy-tetrahydrodipicolinate synthase OS=Staphylococcus aureus (strain USA300) GN=dapA PE=3 SV=1 7 297 2.0E-19
sp|Q0SRS5|DAPA_CLOPS 4-hydroxy-tetrahydrodipicolinate synthase OS=Clostridium perfringens (strain SM101 / Type A) GN=dapA PE=3 SV=1 41 296 2.0E-19
sp|Q32D87|DAPA_SHIDS 4-hydroxy-tetrahydrodipicolinate synthase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=dapA PE=3 SV=1 18 243 3.0E-19
sp|C6BSH4|DAPA_DESAD 4-hydroxy-tetrahydrodipicolinate synthase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=dapA PE=3 SV=1 16 246 3.0E-19
sp|Q5NPL6|DAPA_ZYMMO 4-hydroxy-tetrahydrodipicolinate synthase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=dapA PE=3 SV=1 25 246 3.0E-19
sp|Q0T239|DAPA_SHIF8 4-hydroxy-tetrahydrodipicolinate synthase OS=Shigella flexneri serotype 5b (strain 8401) GN=dapA PE=3 SV=1 18 243 3.0E-19
sp|Q2RJK7|DAPA_MOOTA 4-hydroxy-tetrahydrodipicolinate synthase OS=Moorella thermoacetica (strain ATCC 39073) GN=dapA PE=3 SV=1 44 307 3.0E-19
sp|Q8XJ56|DAPA_CLOPE 4-hydroxy-tetrahydrodipicolinate synthase OS=Clostridium perfringens (strain 13 / Type A) GN=dapA PE=3 SV=1 41 296 4.0E-19
sp|A1ATI8|DAPA_PELPD 4-hydroxy-tetrahydrodipicolinate synthase OS=Pelobacter propionicus (strain DSM 2379) GN=dapA PE=3 SV=1 49 267 4.0E-19
sp|C1DD55|DAPA_LARHH 4-hydroxy-tetrahydrodipicolinate synthase OS=Laribacter hongkongensis (strain HLHK9) GN=dapA PE=3 SV=1 35 246 5.0E-19
sp|Q0TP55|DAPA_CLOP1 4-hydroxy-tetrahydrodipicolinate synthase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=dapA PE=3 SV=1 41 296 5.0E-19
sp|Q2YXX4|DAPA_STAAB 4-hydroxy-tetrahydrodipicolinate synthase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dapA PE=3 SV=1 7 225 6.0E-19
sp|Q48LD5|DAPA_PSE14 4-hydroxy-tetrahydrodipicolinate synthase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=dapA PE=3 SV=1 44 278 6.0E-19
sp|B3E936|DAPA_GEOLS 4-hydroxy-tetrahydrodipicolinate synthase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=dapA PE=3 SV=1 45 268 6.0E-19
sp|B3PC19|DAPA_CELJU 4-hydroxy-tetrahydrodipicolinate synthase OS=Cellvibrio japonicus (strain Ueda107) GN=dapA PE=3 SV=1 33 245 6.0E-19
sp|B9K865|DAPA_THENN 4-hydroxy-tetrahydrodipicolinate synthase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=dapA PE=3 SV=1 16 307 7.0E-19
sp|Q8U319|DAPAL_PYRFU Uncharacterized DapA-like lyase PF0657 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=dapAL PE=3 SV=1 10 284 7.0E-19
sp|Q2LTA1|DAPA_SYNAS 4-hydroxy-tetrahydrodipicolinate synthase OS=Syntrophus aciditrophicus (strain SB) GN=dapA PE=3 SV=2 18 305 8.0E-19
sp|Q5QU03|DAPA_IDILO 4-hydroxy-tetrahydrodipicolinate synthase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=dapA PE=3 SV=1 10 286 8.0E-19
sp|Q2NS74|DAPA_SODGM 4-hydroxy-tetrahydrodipicolinate synthase OS=Sodalis glossinidius (strain morsitans) GN=dapA PE=3 SV=1 18 246 9.0E-19
sp|B1LBR1|DAPA_THESQ 4-hydroxy-tetrahydrodipicolinate synthase OS=Thermotoga sp. (strain RQ2) GN=dapA PE=3 SV=1 16 291 9.0E-19
sp|B3EMS4|DAPA_CHLPB 4-hydroxy-tetrahydrodipicolinate synthase OS=Chlorobium phaeobacteroides (strain BS1) GN=dapA PE=3 SV=1 10 243 1.0E-18
sp|B1JDB7|DAPA_PSEPW 4-hydroxy-tetrahydrodipicolinate synthase OS=Pseudomonas putida (strain W619) GN=dapA PE=3 SV=1 33 246 1.0E-18
sp|Q83CA6|DAPA_COXBU 4-hydroxy-tetrahydrodipicolinate synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=dapA PE=3 SV=1 32 225 1.0E-18
sp|A9NDT3|DAPA_COXBR 4-hydroxy-tetrahydrodipicolinate synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=dapA PE=3 SV=1 32 225 1.0E-18
sp|A9KFS0|DAPA_COXBN 4-hydroxy-tetrahydrodipicolinate synthase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=dapA PE=3 SV=1 32 225 1.0E-18
sp|B4U7D7|DAPA_HYDS0 4-hydroxy-tetrahydrodipicolinate synthase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=dapA PE=3 SV=1 35 302 1.0E-18
sp|B2RMB9|DAPA_PORG3 4-hydroxy-tetrahydrodipicolinate synthase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=dapA PE=3 SV=1 37 246 2.0E-18
sp|Q5PB64|DAPA_ANAMM 4-hydroxy-tetrahydrodipicolinate synthase OS=Anaplasma marginale (strain St. Maries) GN=dapA PE=3 SV=1 10 255 2.0E-18
sp|Q3B2G4|DAPA_CHLL7 4-hydroxy-tetrahydrodipicolinate synthase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=dapA PE=3 SV=1 49 246 2.0E-18
sp|A1SVX2|DAPA_PSYIN 4-hydroxy-tetrahydrodipicolinate synthase OS=Psychromonas ingrahamii (strain 37) GN=dapA PE=3 SV=1 35 309 2.0E-18
sp|B9KI57|DAPA_ANAMF 4-hydroxy-tetrahydrodipicolinate synthase OS=Anaplasma marginale (strain Florida) GN=dapA PE=3 SV=1 10 255 2.0E-18
sp|Q9X1K9|DAPA_THEMA 4-hydroxy-tetrahydrodipicolinate synthase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=dapA PE=1 SV=1 16 291 2.0E-18
sp|B8D8P8|DAPA_BUCA5 4-hydroxy-tetrahydrodipicolinate synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=dapA PE=3 SV=1 35 246 2.0E-18
sp|Q8ZN71|DAPA_SALTY 4-hydroxy-tetrahydrodipicolinate synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dapA PE=1 SV=1 35 246 2.0E-18
sp|B4TR62|DAPA_SALSV 4-hydroxy-tetrahydrodipicolinate synthase OS=Salmonella schwarzengrund (strain CVM19633) GN=dapA PE=3 SV=1 35 246 2.0E-18
sp|B5BB16|DAPA_SALPK 4-hydroxy-tetrahydrodipicolinate synthase OS=Salmonella paratyphi A (strain AKU_12601) GN=dapA PE=3 SV=1 35 246 2.0E-18
sp|Q5PLS1|DAPA_SALPA 4-hydroxy-tetrahydrodipicolinate synthase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=dapA PE=3 SV=1 35 246 2.0E-18
sp|A6TCA1|DAPA_KLEP7 4-hydroxy-tetrahydrodipicolinate synthase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=dapA PE=3 SV=1 18 246 2.0E-18
sp|Q8Z4R8|DAPA_SALTI 4-hydroxy-tetrahydrodipicolinate synthase OS=Salmonella typhi GN=dapA PE=3 SV=1 35 246 2.0E-18
sp|A5IM62|DAPA_THEP1 4-hydroxy-tetrahydrodipicolinate synthase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=dapA PE=3 SV=1 16 307 2.0E-18
sp|A9MHQ2|DAPA_SALAR 4-hydroxy-tetrahydrodipicolinate synthase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=dapA PE=3 SV=1 35 243 3.0E-18
sp|B8D702|DAPA_BUCAT 4-hydroxy-tetrahydrodipicolinate synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=dapA PE=3 SV=1 35 246 3.0E-18
sp|P57197|DAPA_BUCAI 4-hydroxy-tetrahydrodipicolinate synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=dapA PE=3 SV=1 35 246 3.0E-18
sp|O58577|DAPAL_PYRHO Uncharacterized DapA-like lyase PH0847 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=dapAL PE=3 SV=1 10 248 3.0E-18
sp|Q9CBW4|DAPA_MYCLE 4-hydroxy-tetrahydrodipicolinate synthase OS=Mycobacterium leprae (strain TN) GN=dapA PE=3 SV=1 16 302 3.0E-18
sp|B8ZRR3|DAPA_MYCLB 4-hydroxy-tetrahydrodipicolinate synthase OS=Mycobacterium leprae (strain Br4923) GN=dapA PE=3 SV=1 16 302 3.0E-18
sp|A2SIX7|DAPA_METPP 4-hydroxy-tetrahydrodipicolinate synthase OS=Methylibium petroleiphilum (strain PM1) GN=dapA PE=3 SV=1 35 295 4.0E-18
sp|Q47HS9|DAPA_DECAR 4-hydroxy-tetrahydrodipicolinate synthase OS=Dechloromonas aromatica (strain RCB) GN=dapA PE=3 SV=1 81 251 4.0E-18
sp|Q5P838|DAPA_AROAE 4-hydroxy-tetrahydrodipicolinate synthase OS=Aromatoleum aromaticum (strain EbN1) GN=dapA PE=3 SV=1 44 246 5.0E-18
sp|B3GXP5|DAPA_ACTP7 4-hydroxy-tetrahydrodipicolinate synthase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=dapA PE=3 SV=1 35 263 5.0E-18
sp|P63948|DAPA_STAAN 4-hydroxy-tetrahydrodipicolinate synthase OS=Staphylococcus aureus (strain N315) GN=dapA PE=3 SV=1 7 225 5.0E-18
sp|P63947|DAPA_STAAM 4-hydroxy-tetrahydrodipicolinate synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dapA PE=3 SV=1 7 225 5.0E-18
sp|A5ISS7|DAPA_STAA9 4-hydroxy-tetrahydrodipicolinate synthase OS=Staphylococcus aureus (strain JH9) GN=dapA PE=3 SV=1 7 225 5.0E-18
sp|A6U1L6|DAPA_STAA2 4-hydroxy-tetrahydrodipicolinate synthase OS=Staphylococcus aureus (strain JH1) GN=dapA PE=3 SV=1 7 225 5.0E-18
sp|A7X271|DAPA_STAA1 4-hydroxy-tetrahydrodipicolinate synthase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dapA PE=3 SV=1 7 225 5.0E-18
sp|A2RJL6|DAPA_LACLM 4-hydroxy-tetrahydrodipicolinate synthase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=dapA PE=3 SV=1 17 296 6.0E-18
sp|A1U1A6|DAPA_MARHV 4-hydroxy-tetrahydrodipicolinate synthase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=dapA PE=3 SV=1 23 311 6.0E-18
sp|Q97R25|DAPA_STRPN 4-hydroxy-tetrahydrodipicolinate synthase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dapA PE=1 SV=1 37 316 6.0E-18
sp|B1IBH4|DAPA_STRPI 4-hydroxy-tetrahydrodipicolinate synthase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=dapA PE=3 SV=1 37 316 6.0E-18
sp|B5E4D5|DAPA_STRP4 4-hydroxy-tetrahydrodipicolinate synthase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=dapA PE=3 SV=1 37 316 6.0E-18
sp|C5BQD1|DAPA_TERTT 4-hydroxy-tetrahydrodipicolinate synthase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=dapA PE=3 SV=1 33 281 6.0E-18
sp|C1CK93|DAPA_STRZP 4-hydroxy-tetrahydrodipicolinate synthase OS=Streptococcus pneumoniae (strain P1031) GN=dapA PE=3 SV=1 37 316 6.0E-18
sp|C1C6Z0|DAPA_STRP7 4-hydroxy-tetrahydrodipicolinate synthase OS=Streptococcus pneumoniae (strain 70585) GN=dapA PE=3 SV=1 37 316 6.0E-18
sp|A6LP58|DAPA_THEM4 4-hydroxy-tetrahydrodipicolinate synthase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=dapA PE=3 SV=1 16 245 6.0E-18
sp|A3N0Q9|DAPA_ACTP2 4-hydroxy-tetrahydrodipicolinate synthase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=dapA PE=3 SV=1 35 263 7.0E-18
sp|Q9I4W3|DAPA_PSEAE 4-hydroxy-tetrahydrodipicolinate synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=dapA PE=1 SV=1 45 230 8.0E-18
sp|Q1RIJ3|DAPA_RICBR 4-hydroxy-tetrahydrodipicolinate synthase OS=Rickettsia bellii (strain RML369-C) GN=dapA PE=3 SV=1 16 230 8.0E-18
sp|C1CE08|DAPA_STRZJ 4-hydroxy-tetrahydrodipicolinate synthase OS=Streptococcus pneumoniae (strain JJA) GN=dapA PE=3 SV=1 37 316 9.0E-18
sp|B8ZPG7|DAPA_STRPJ 4-hydroxy-tetrahydrodipicolinate synthase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dapA PE=3 SV=1 37 316 9.0E-18
sp|Q02XU7|DAPA_LACLS 4-hydroxy-tetrahydrodipicolinate synthase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=dapA PE=3 SV=1 17 296 9.0E-18
sp|Q7MIL2|DAPA_VIBVY 4-hydroxy-tetrahydrodipicolinate synthase OS=Vibrio vulnificus (strain YJ016) GN=dapA PE=3 SV=2 35 243 9.0E-18
sp|A4VN86|DAPA_PSEU5 4-hydroxy-tetrahydrodipicolinate synthase OS=Pseudomonas stutzeri (strain A1501) GN=dapA PE=3 SV=1 45 246 9.0E-18
sp|Q2Y8S8|DAPA_NITMU 4-hydroxy-tetrahydrodipicolinate synthase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=dapA PE=3 SV=1 35 230 9.0E-18
sp|A7Z4U8|DAPA_BACMF 4-hydroxy-tetrahydrodipicolinate synthase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dapA PE=3 SV=1 15 242 1.0E-17
sp|Q8UGL3|DAPA_AGRFC 4-hydroxy-tetrahydrodipicolinate synthase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=dapA PE=1 SV=1 17 283 1.0E-17
sp|B2IPH2|DAPA_STRPS 4-hydroxy-tetrahydrodipicolinate synthase OS=Streptococcus pneumoniae (strain CGSP14) GN=dapA PE=3 SV=1 35 316 1.0E-17
sp|Q2NHW2|DAPA_METST 4-hydroxy-tetrahydrodipicolinate synthase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=dapA PE=3 SV=1 10 245 1.0E-17
sp|B0C142|DAPA_ACAM1 4-hydroxy-tetrahydrodipicolinate synthase OS=Acaryochloris marina (strain MBIC 11017) GN=dapA PE=3 SV=1 17 287 1.0E-17
sp|Q891S3|DAPA_CLOTE 4-hydroxy-tetrahydrodipicolinate synthase OS=Clostridium tetani (strain Massachusetts / E88) GN=dapA PE=3 SV=1 35 288 1.0E-17
sp|Q058B1|DAPA_BUCCC 4-hydroxy-tetrahydrodipicolinate synthase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=dapA PE=3 SV=1 18 246 1.0E-17
sp|Q1INQ6|DAPA_KORVE 4-hydroxy-tetrahydrodipicolinate synthase OS=Koribacter versatilis (strain Ellin345) GN=dapA PE=3 SV=1 17 302 1.0E-17
sp|Q5HPE7|DAPA_STAEQ 4-hydroxy-tetrahydrodipicolinate synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dapA PE=3 SV=1 10 241 1.0E-17
sp|Q5LMK7|DAPA_RUEPO 4-hydroxy-tetrahydrodipicolinate synthase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dapA PE=3 SV=1 44 271 1.0E-17
sp|Q0AI27|DAPA_NITEC 4-hydroxy-tetrahydrodipicolinate synthase OS=Nitrosomonas eutropha (strain C91) GN=dapA PE=3 SV=1 44 247 2.0E-17
sp|Q8DPZ9|DAPA_STRR6 4-hydroxy-tetrahydrodipicolinate synthase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dapA PE=3 SV=1 35 316 2.0E-17
sp|Q04KR9|DAPA_STRP2 4-hydroxy-tetrahydrodipicolinate synthase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dapA PE=3 SV=1 35 316 2.0E-17
sp|Q7VXZ8|DAPA_BORPE 4-hydroxy-tetrahydrodipicolinate synthase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=dapA PE=3 SV=1 10 271 2.0E-17
sp|A0LZ30|DAPA_GRAFK 4-hydroxy-tetrahydrodipicolinate synthase OS=Gramella forsetii (strain KT0803) GN=dapA PE=3 SV=1 10 283 2.0E-17
sp|Q04FS1|DAPA_OENOB 4-hydroxy-tetrahydrodipicolinate synthase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=dapA PE=3 SV=1 16 303 2.0E-17
sp|Q07607|DAPA_RHIML 4-hydroxy-tetrahydrodipicolinate synthase OS=Rhizobium meliloti GN=dapA PE=1 SV=2 16 283 2.0E-17
sp|Q92R55|DAPA_RHIME 4-hydroxy-tetrahydrodipicolinate synthase OS=Rhizobium meliloti (strain 1021) GN=dapA PE=3 SV=1 17 281 2.0E-17
sp|Q2JWL7|DAPA_SYNJA 4-hydroxy-tetrahydrodipicolinate synthase OS=Synechococcus sp. (strain JA-3-3Ab) GN=dapA PE=3 SV=1 17 314 3.0E-17
sp|B4UHY1|DAPA_ANASK 4-hydroxy-tetrahydrodipicolinate synthase OS=Anaeromyxobacter sp. (strain K) GN=dapA PE=3 SV=1 18 281 3.0E-17
sp|B2G6M9|DAPA_LACRJ 4-hydroxy-tetrahydrodipicolinate synthase OS=Lactobacillus reuteri (strain JCM 1112) GN=dapA PE=3 SV=1 16 246 3.0E-17
sp|A5VJ58|DAPA_LACRD 4-hydroxy-tetrahydrodipicolinate synthase OS=Lactobacillus reuteri (strain DSM 20016) GN=dapA PE=3 SV=1 16 246 3.0E-17
sp|Q21WN2|DAPA_RHOFT 4-hydroxy-tetrahydrodipicolinate synthase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=dapA PE=3 SV=1 18 281 3.0E-17
sp|B4RCW4|DAPA_PHEZH 4-hydroxy-tetrahydrodipicolinate synthase OS=Phenylobacterium zucineum (strain HLK1) GN=dapA PE=3 SV=1 25 246 4.0E-17
sp|A4TCJ3|DAPA_MYCGI 4-hydroxy-tetrahydrodipicolinate synthase OS=Mycobacterium gilvum (strain PYR-GCK) GN=dapA PE=3 SV=1 17 302 4.0E-17
sp|C1CRD6|DAPA_STRZT 4-hydroxy-tetrahydrodipicolinate synthase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dapA PE=3 SV=1 28 316 4.0E-17
sp|Q2IGX5|DAPA_ANADE 4-hydroxy-tetrahydrodipicolinate synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=dapA PE=3 SV=1 44 281 4.0E-17
sp|B1I383|DAPA_DESAP 4-hydroxy-tetrahydrodipicolinate synthase OS=Desulforudis audaxviator (strain MP104C) GN=dapA PE=3 SV=1 16 308 4.0E-17
sp|B9KY71|DAPA_THERP 4-hydroxy-tetrahydrodipicolinate synthase OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=dapA PE=3 SV=1 10 245 5.0E-17
sp|A4WNS1|DAPA_RHOS5 4-hydroxy-tetrahydrodipicolinate synthase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=dapA PE=3 SV=1 44 283 5.0E-17
sp|A1US27|DAPA_BARBK 4-hydroxy-tetrahydrodipicolinate synthase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=dapA PE=3 SV=1 10 246 5.0E-17
sp|Q8DBB0|DAPA_VIBVU 4-hydroxy-tetrahydrodipicolinate synthase OS=Vibrio vulnificus (strain CMCP6) GN=dapA PE=3 SV=1 35 243 6.0E-17
sp|Q8KA24|DAPA_BUCAP 4-hydroxy-tetrahydrodipicolinate synthase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=dapA PE=3 SV=1 35 246 6.0E-17
sp|A8AXI2|DAPA_STRGC 4-hydroxy-tetrahydrodipicolinate synthase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=dapA PE=3 SV=1 37 309 6.0E-17
sp|A8GWS1|DAPA_RICB8 4-hydroxy-tetrahydrodipicolinate synthase OS=Rickettsia bellii (strain OSU 85-389) GN=dapA PE=3 SV=1 16 230 7.0E-17
sp|Q73VZ7|DAPA_MYCPA 4-hydroxy-tetrahydrodipicolinate synthase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=dapA PE=3 SV=1 11 302 7.0E-17
sp|B3EH29|DAPA_CHLL2 4-hydroxy-tetrahydrodipicolinate synthase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=dapA PE=3 SV=1 35 246 7.0E-17
sp|B8JAN5|DAPA_ANAD2 4-hydroxy-tetrahydrodipicolinate synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=dapA PE=3 SV=1 44 281 7.0E-17
sp|B0BPI4|DAPA_ACTPJ 4-hydroxy-tetrahydrodipicolinate synthase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=dapA PE=3 SV=1 35 263 7.0E-17
sp|B0UVZ8|DAPA_HISS2 4-hydroxy-tetrahydrodipicolinate synthase OS=Histophilus somni (strain 2336) GN=dapA PE=3 SV=1 9 251 8.0E-17
sp|Q8CP96|DAPA_STAES 4-hydroxy-tetrahydrodipicolinate synthase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dapA PE=3 SV=1 10 225 8.0E-17
sp|P9WP25|DAPA_MYCTU 4-hydroxy-tetrahydrodipicolinate synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=dapA PE=1 SV=1 17 302 8.0E-17
sp|P9WP24|DAPA_MYCTO 4-hydroxy-tetrahydrodipicolinate synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=dapA PE=3 SV=1 17 302 8.0E-17
sp|A5U6A6|DAPA_MYCTA 4-hydroxy-tetrahydrodipicolinate synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=dapA PE=3 SV=1 17 302 8.0E-17
sp|C1AFL5|DAPA_MYCBT 4-hydroxy-tetrahydrodipicolinate synthase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=dapA PE=3 SV=1 17 302 8.0E-17
sp|A1KM94|DAPA_MYCBP 4-hydroxy-tetrahydrodipicolinate synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=dapA PE=3 SV=1 17 302 8.0E-17
sp|P63946|DAPA_MYCBO 4-hydroxy-tetrahydrodipicolinate synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=dapA PE=3 SV=1 17 302 8.0E-17
sp|A4VU96|DAPA_STRSY 4-hydroxy-tetrahydrodipicolinate synthase OS=Streptococcus suis (strain 05ZYH33) GN=dapA PE=3 SV=1 35 217 1.0E-16
sp|A4W0I7|DAPA_STRS2 4-hydroxy-tetrahydrodipicolinate synthase OS=Streptococcus suis (strain 98HAH33) GN=dapA PE=3 SV=1 35 217 1.0E-16
sp|A8EYZ4|DAPA_RICCK 4-hydroxy-tetrahydrodipicolinate synthase OS=Rickettsia canadensis (strain McKiel) GN=dapA PE=3 SV=1 16 246 1.0E-16
sp|Q9HJ17|DAPAL_THEAC Uncharacterized DapA-like lyase Ta1157 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=dapAL PE=3 SV=1 10 285 1.0E-16
sp|Q6MRM9|DAPA_BDEBA 4-hydroxy-tetrahydrodipicolinate synthase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=dapA PE=3 SV=1 35 243 1.0E-16
sp|Q0BYG4|DAPA_HYPNA 4-hydroxy-tetrahydrodipicolinate synthase OS=Hyphomonas neptunium (strain ATCC 15444) GN=dapA PE=3 SV=1 25 246 1.0E-16
sp|Q03K16|DAPA_STRTD 4-hydroxy-tetrahydrodipicolinate synthase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=dapA PE=3 SV=1 37 217 1.0E-16
sp|C4K288|DAPA_RICPU 4-hydroxy-tetrahydrodipicolinate synthase OS=Rickettsia peacockii (strain Rustic) GN=dapA PE=3 SV=1 16 246 2.0E-16
sp|B4SE03|DAPA_PELPB 4-hydroxy-tetrahydrodipicolinate synthase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=dapA PE=3 SV=1 35 283 2.0E-16
sp|A1W4S3|DAPA_ACISJ 4-hydroxy-tetrahydrodipicolinate synthase OS=Acidovorax sp. (strain JS42) GN=dapA PE=3 SV=1 18 281 2.0E-16
sp|B9MER6|DAPA_ACIET 4-hydroxy-tetrahydrodipicolinate synthase OS=Acidovorax ebreus (strain TPSY) GN=dapA PE=3 SV=1 18 281 2.0E-16
sp|A5UAN5|DAPA_HAEIE 4-hydroxy-tetrahydrodipicolinate synthase OS=Haemophilus influenzae (strain PittEE) GN=dapA PE=3 SV=1 35 247 2.0E-16
sp|A3CN43|DAPA_STRSV 4-hydroxy-tetrahydrodipicolinate synthase OS=Streptococcus sanguinis (strain SK36) GN=dapA PE=3 SV=1 37 309 2.0E-16
sp|B6YQ20|DAPA_AZOPC 4-hydroxy-tetrahydrodipicolinate synthase OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=dapA PE=3 SV=1 10 283 2.0E-16
sp|B1Y7F0|DAPA_LEPCP 4-hydroxy-tetrahydrodipicolinate synthase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=dapA PE=3 SV=1 81 246 2.0E-16
sp|A2SQU8|DAPA_METLZ 4-hydroxy-tetrahydrodipicolinate synthase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=dapA PE=3 SV=1 42 244 2.0E-16
sp|C1F658|DAPA_ACIC5 4-hydroxy-tetrahydrodipicolinate synthase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=dapA PE=3 SV=1 17 245 2.0E-16
sp|A4SG05|DAPA_CHLPM 4-hydroxy-tetrahydrodipicolinate synthase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=dapA PE=3 SV=1 35 245 3.0E-16
sp|B8GN57|DAPA_THISH 4-hydroxy-tetrahydrodipicolinate synthase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=dapA PE=3 SV=1 45 271 3.0E-16
sp|Q9CF61|DAPA_LACLA 4-hydroxy-tetrahydrodipicolinate synthase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dapA PE=3 SV=1 17 246 3.0E-16
sp|Q3APU0|DAPA_CHLCH 4-hydroxy-tetrahydrodipicolinate synthase OS=Chlorobium chlorochromatii (strain CaD3) GN=dapA PE=3 SV=1 1 294 3.0E-16
sp|O67216|DAPA_AQUAE 4-hydroxy-tetrahydrodipicolinate synthase OS=Aquifex aeolicus (strain VF5) GN=dapA PE=1 SV=1 44 246 4.0E-16
sp|B5ELM5|DAPA_ACIF5 4-hydroxy-tetrahydrodipicolinate synthase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=dapA PE=3 SV=1 35 235 4.0E-16
sp|B7J6C4|DAPA_ACIF2 4-hydroxy-tetrahydrodipicolinate synthase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=dapA PE=3 SV=1 35 235 4.0E-16
sp|A8GS25|DAPA_RICRS 4-hydroxy-tetrahydrodipicolinate synthase OS=Rickettsia rickettsii (strain Sheila Smith) GN=dapA PE=3 SV=1 16 246 4.0E-16
sp|B0BXJ1|DAPA_RICRO 4-hydroxy-tetrahydrodipicolinate synthase OS=Rickettsia rickettsii (strain Iowa) GN=dapA PE=3 SV=1 16 246 4.0E-16
sp|Q9AKJ9|DAPA_RICRI 4-hydroxy-tetrahydrodipicolinate synthase OS=Rickettsia rickettsii GN=dapA PE=3 SV=1 16 246 4.0E-16
sp|Q04796|DAPA_BACSU 4-hydroxy-tetrahydrodipicolinate synthase OS=Bacillus subtilis (strain 168) GN=dapA PE=1 SV=1 15 242 4.0E-16
sp|Q6G091|DAPA_BARQU 4-hydroxy-tetrahydrodipicolinate synthase OS=Bartonella quintana (strain Toulouse) GN=dapA PE=3 SV=1 16 283 4.0E-16
sp|A8F1K3|DAPA_RICM5 4-hydroxy-tetrahydrodipicolinate synthase OS=Rickettsia massiliae (strain Mtu5) GN=dapA PE=3 SV=1 16 246 4.0E-16
sp|Q4FLS1|DAPA_PELUB 4-hydroxy-tetrahydrodipicolinate synthase OS=Pelagibacter ubique (strain HTCC1062) GN=dapA PE=3 SV=1 36 249 5.0E-16
sp|Q92I25|DAPA_RICCN 4-hydroxy-tetrahydrodipicolinate synthase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=dapA PE=3 SV=1 16 246 5.0E-16
sp|A9KHY6|DAPA_CLOPH 4-hydroxy-tetrahydrodipicolinate synthase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=dapA PE=3 SV=1 45 246 5.0E-16
sp|A1AVV3|DAPA_RUTMC 4-hydroxy-tetrahydrodipicolinate synthase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=dapA PE=3 SV=1 44 293 5.0E-16
sp|Q7VM87|DAPA_HAEDU 4-hydroxy-tetrahydrodipicolinate synthase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=dapA PE=3 SV=1 35 263 5.0E-16
sp|Q5FKQ9|DAPA_LACAC 4-hydroxy-tetrahydrodipicolinate synthase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=dapA PE=3 SV=1 16 246 5.0E-16
sp|Q82SD7|DAPA_NITEU 4-hydroxy-tetrahydrodipicolinate synthase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=dapA PE=3 SV=1 44 246 6.0E-16
sp|A5FE82|DAPA_FLAJ1 4-hydroxy-tetrahydrodipicolinate synthase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=dapA PE=3 SV=1 35 299 6.0E-16
sp|Q0VRH4|DAPA_ALCBS 4-hydroxy-tetrahydrodipicolinate synthase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=dapA PE=3 SV=1 33 247 6.0E-16
sp|Q4QNT3|DAPA_HAEI8 4-hydroxy-tetrahydrodipicolinate synthase OS=Haemophilus influenzae (strain 86-028NP) GN=dapA PE=3 SV=1 35 247 6.0E-16
sp|A5UG62|DAPA_HAEIG 4-hydroxy-tetrahydrodipicolinate synthase OS=Haemophilus influenzae (strain PittGG) GN=dapA PE=3 SV=1 35 247 7.0E-16
sp|C3PNF5|DAPA_RICAE 4-hydroxy-tetrahydrodipicolinate synthase OS=Rickettsia africae (strain ESF-5) GN=dapA PE=3 SV=1 16 246 7.0E-16
sp|A7HJ56|DAPA_FERNB 4-hydroxy-tetrahydrodipicolinate synthase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=dapA PE=3 SV=2 16 303 8.0E-16
sp|A5VPI5|DAPA_BRUO2 4-hydroxy-tetrahydrodipicolinate synthase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=dapA PE=3 SV=1 16 246 8.0E-16
sp|Q8YG60|DAPA_BRUME 4-hydroxy-tetrahydrodipicolinate synthase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=dapA PE=3 SV=2 16 246 8.0E-16
sp|Q57E96|DAPA_BRUAB 4-hydroxy-tetrahydrodipicolinate synthase OS=Brucella abortus biovar 1 (strain 9-941) GN=dapA PE=3 SV=1 16 246 8.0E-16
sp|Q9AKQ3|DAPA_RICMO 4-hydroxy-tetrahydrodipicolinate synthase OS=Rickettsia montanensis GN=dapA PE=3 SV=1 16 246 1.0E-15
sp|B8CMS5|DAPA_SHEPW 4-hydroxy-tetrahydrodipicolinate synthase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=dapA PE=3 SV=1 18 263 1.0E-15
sp|Q11VI2|DAPA_CYTH3 4-hydroxy-tetrahydrodipicolinate synthase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=dapA PE=3 SV=1 45 302 1.0E-15
sp|Q3J869|DAPA_NITOC 4-hydroxy-tetrahydrodipicolinate synthase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=dapA PE=3 SV=1 35 246 1.0E-15
sp|A6H0M8|DAPA_FLAPJ 4-hydroxy-tetrahydrodipicolinate synthase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=dapA PE=3 SV=1 10 283 2.0E-15
sp|Q0A5S1|DAPA_ALKEH 4-hydroxy-tetrahydrodipicolinate synthase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=dapA PE=3 SV=1 10 307 2.0E-15
sp|A1K4F8|DAPA_AZOSB 4-hydroxy-tetrahydrodipicolinate synthase OS=Azoarcus sp. (strain BH72) GN=dapA PE=3 SV=1 44 281 2.0E-15
sp|Q9PER5|DAPA_XYLFA 4-hydroxy-tetrahydrodipicolinate synthase OS=Xylella fastidiosa (strain 9a5c) GN=dapA PE=3 SV=2 42 277 2.0E-15
sp|B6EJT2|DAPA_ALISL 4-hydroxy-tetrahydrodipicolinate synthase OS=Aliivibrio salmonicida (strain LFI1238) GN=dapA PE=3 SV=1 24 243 2.0E-15
sp|A5D2Q5|DAPA_PELTS 4-hydroxy-tetrahydrodipicolinate synthase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=dapA PE=3 SV=1 17 282 2.0E-15
sp|Q8G1R0|DAPA_BRUSU 4-hydroxy-tetrahydrodipicolinate synthase OS=Brucella suis biovar 1 (strain 1330) GN=dapA PE=3 SV=1 16 246 3.0E-15
sp|B6IN13|DAPA_RHOCS 4-hydroxy-tetrahydrodipicolinate synthase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=dapA PE=3 SV=1 44 230 3.0E-15
sp|P19808|DAPA_CORGL 4-hydroxy-tetrahydrodipicolinate synthase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=dapA PE=1 SV=2 11 307 3.0E-15
sp|A8LKQ5|DAPA_DINSH 4-hydroxy-tetrahydrodipicolinate synthase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=dapA PE=3 SV=1 44 269 4.0E-15
sp|Q0I260|DAPA_HAES1 4-hydroxy-tetrahydrodipicolinate synthase OS=Haemophilus somnus (strain 129Pt) GN=dapA PE=3 SV=1 9 243 4.0E-15
sp|Q5SJQ1|DAPA_THET8 4-hydroxy-tetrahydrodipicolinate synthase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=dapA PE=3 SV=1 80 299 4.0E-15
sp|B9KFX0|DAPA_CAMLR 4-hydroxy-tetrahydrodipicolinate synthase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=dapA PE=3 SV=1 16 246 4.0E-15
sp|Q72K27|DAPA_THET2 4-hydroxy-tetrahydrodipicolinate synthase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=dapA PE=3 SV=1 80 253 4.0E-15
sp|Q5MZT3|DAPA_SYNP6 4-hydroxy-tetrahydrodipicolinate synthase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=dapA PE=3 SV=1 44 283 4.0E-15
sp|Q31M42|DAPA_SYNE7 4-hydroxy-tetrahydrodipicolinate synthase OS=Synechococcus elongatus (strain PCC 7942) GN=dapA PE=3 SV=1 44 283 4.0E-15
sp|Q5E3I3|DAPA_VIBF1 4-hydroxy-tetrahydrodipicolinate synthase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=dapA PE=3 SV=1 24 243 5.0E-15
sp|Q9CLZ7|DAPA_PASMU 4-hydroxy-tetrahydrodipicolinate synthase OS=Pasteurella multocida (strain Pm70) GN=dapA PE=3 SV=1 18 271 5.0E-15
sp|A5V3L9|DAPA_SPHWW 4-hydroxy-tetrahydrodipicolinate synthase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=dapA PE=3 SV=2 43 246 5.0E-15
sp|C5B7A2|DAPA_EDWI9 4-hydroxy-tetrahydrodipicolinate synthase OS=Edwardsiella ictaluri (strain 93-146) GN=dapA PE=3 SV=1 18 246 5.0E-15
sp|Q8NYC7|NANA_STAAW N-acetylneuraminate lyase OS=Staphylococcus aureus (strain MW2) GN=nanA PE=3 SV=1 10 246 6.0E-15
sp|A8YZD9|NANA_STAAT N-acetylneuraminate lyase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=nanA PE=3 SV=1 10 246 6.0E-15
sp|Q6GCF6|NANA_STAAS N-acetylneuraminate lyase OS=Staphylococcus aureus (strain MSSA476) GN=nanA PE=3 SV=1 10 246 6.0E-15
sp|Q6GK01|NANA_STAAR N-acetylneuraminate lyase OS=Staphylococcus aureus (strain MRSA252) GN=nanA PE=1 SV=1 10 246 6.0E-15
sp|A6QDU7|NANA_STAAE N-acetylneuraminate lyase OS=Staphylococcus aureus (strain Newman) GN=nanA PE=3 SV=1 10 246 6.0E-15
sp|Q5HJ53|NANA_STAAC N-acetylneuraminate lyase OS=Staphylococcus aureus (strain COL) GN=nanA PE=3 SV=1 10 246 6.0E-15
sp|Q2G160|NANA_STAA8 N-acetylneuraminate lyase OS=Staphylococcus aureus (strain NCTC 8325) GN=nanA PE=1 SV=1 10 246 6.0E-15
sp|Q2FJU9|NANA_STAA3 N-acetylneuraminate lyase OS=Staphylococcus aureus (strain USA300) GN=nanA PE=3 SV=1 10 246 6.0E-15
sp|A8FLL9|DAPA_CAMJ8 4-hydroxy-tetrahydrodipicolinate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=dapA PE=3 SV=1 16 246 6.0E-15
sp|B5FGX4|DAPA_VIBFM 4-hydroxy-tetrahydrodipicolinate synthase OS=Vibrio fischeri (strain MJ11) GN=dapA PE=3 SV=1 24 243 6.0E-15
sp|A5F699|DAPA_VIBC3 4-hydroxy-tetrahydrodipicolinate synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=dapA PE=3 SV=1 10 246 6.0E-15
sp|P99123|NANA_STAAN N-acetylneuraminate lyase OS=Staphylococcus aureus (strain N315) GN=nanA PE=1 SV=1 10 246 6.0E-15
sp|P63949|NANA_STAAM N-acetylneuraminate lyase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=nanA PE=3 SV=1 10 246 6.0E-15
sp|A5IPI2|NANA_STAA9 N-acetylneuraminate lyase OS=Staphylococcus aureus (strain JH9) GN=nanA PE=3 SV=1 10 246 6.0E-15
sp|A6TY99|NANA_STAA2 N-acetylneuraminate lyase OS=Staphylococcus aureus (strain JH1) GN=nanA PE=3 SV=1 10 246 6.0E-15
sp|A7WXZ2|NANA_STAA1 N-acetylneuraminate lyase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=nanA PE=3 SV=1 10 246 6.0E-15
sp|Q2YVB1|NANA_STAAB N-acetylneuraminate lyase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=nanA PE=3 SV=1 10 246 7.0E-15
sp|Q6AR63|DAPA_DESPS 4-hydroxy-tetrahydrodipicolinate synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=dapA PE=3 SV=1 44 245 7.0E-15
sp|Q9PPB4|DAPA_CAMJE 4-hydroxy-tetrahydrodipicolinate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=dapA PE=1 SV=1 16 246 7.0E-15
sp|C3LPG2|DAPA_VIBCM 4-hydroxy-tetrahydrodipicolinate synthase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=dapA PE=3 SV=1 10 242 8.0E-15
sp|Q9KQ47|DAPA_VIBCH 4-hydroxy-tetrahydrodipicolinate synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=dapA PE=3 SV=1 10 242 8.0E-15
sp|Q87AT3|DAPA_XYLFT 4-hydroxy-tetrahydrodipicolinate synthase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=dapA PE=3 SV=1 42 277 8.0E-15
sp|Q9X9W0|DAPA1_STRCO 4-hydroxy-tetrahydrodipicolinate synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=dapA1 PE=3 SV=2 17 312 9.0E-15
sp|Q2JQ67|DAPA_SYNJB 4-hydroxy-tetrahydrodipicolinate synthase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=dapA PE=3 SV=1 11 282 9.0E-15
sp|Q6LN85|DAPA_PHOPR 4-hydroxy-tetrahydrodipicolinate synthase OS=Photobacterium profundum GN=dapA PE=3 SV=2 36 247 1.0E-14
sp|Q836D1|DAPA_ENTFA 4-hydroxy-tetrahydrodipicolinate synthase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=dapA PE=3 SV=1 17 246 1.0E-14
sp|O05969|DAPA_RICPR 4-hydroxy-tetrahydrodipicolinate synthase OS=Rickettsia prowazekii (strain Madrid E) GN=dapA PE=3 SV=1 16 246 1.0E-14
sp|A4XSW1|DAPA_PSEMY 4-hydroxy-tetrahydrodipicolinate synthase OS=Pseudomonas mendocina (strain ymp) GN=dapA PE=3 SV=1 45 246 1.0E-14
sp|Q5HUY6|DAPA_CAMJR 4-hydroxy-tetrahydrodipicolinate synthase OS=Campylobacter jejuni (strain RM1221) GN=dapA PE=3 SV=1 16 246 1.0E-14
sp|A1VZF4|DAPA_CAMJJ 4-hydroxy-tetrahydrodipicolinate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=dapA PE=3 SV=1 16 246 1.0E-14
sp|Q9KA91|DAPA2_BACHD 4-hydroxy-tetrahydrodipicolinate synthase 2 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=dapA2 PE=3 SV=1 16 285 1.0E-14
sp|Q6AA18|DAPA_PROAC 4-hydroxy-tetrahydrodipicolinate synthase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=dapA PE=3 SV=1 44 297 1.0E-14
sp|B9DIJ2|NANA_STACT N-acetylneuraminate lyase OS=Staphylococcus carnosus (strain TM300) GN=nanA PE=3 SV=1 29 246 2.0E-14
sp|A4SX51|DAPA_POLSQ 4-hydroxy-tetrahydrodipicolinate synthase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=dapA PE=3 SV=1 44 295 2.0E-14
sp|P43797|DAPA_HAEIN 4-hydroxy-tetrahydrodipicolinate synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=dapA PE=3 SV=1 35 247 2.0E-14
sp|A8YUT3|DAPA_LACH4 4-hydroxy-tetrahydrodipicolinate synthase OS=Lactobacillus helveticus (strain DPC 4571) GN=dapA PE=3 SV=1 16 258 2.0E-14
sp|A6W828|DAPA_KINRD 4-hydroxy-tetrahydrodipicolinate synthase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=dapA PE=3 SV=1 39 285 2.0E-14
sp|Q3Z7V3|DAPA_DEHM1 4-hydroxy-tetrahydrodipicolinate synthase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=dapA PE=3 SV=1 16 242 2.0E-14
sp|A5WHC3|DAPA_PSYWF 4-hydroxy-tetrahydrodipicolinate synthase OS=Psychrobacter sp. (strain PRwf-1) GN=dapA PE=3 SV=1 5 283 3.0E-14
sp|A7H443|DAPA_CAMJD 4-hydroxy-tetrahydrodipicolinate synthase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=dapA PE=3 SV=1 16 246 3.0E-14
sp|Q9AKE4|DAPA_RICTY 4-hydroxy-tetrahydrodipicolinate synthase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=dapA PE=3 SV=1 35 246 3.0E-14
sp|Q4L6A0|DAPA_STAHJ 4-hydroxy-tetrahydrodipicolinate synthase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dapA PE=3 SV=1 7 225 4.0E-14
sp|B8HYL7|DAPA_CYAP4 4-hydroxy-tetrahydrodipicolinate synthase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=dapA PE=3 SV=1 17 283 4.0E-14
sp|A9IRK3|DAPA_BART1 4-hydroxy-tetrahydrodipicolinate synthase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=dapA PE=3 SV=1 16 246 5.0E-14
sp|A5FQT5|DAPA_DEHMB 4-hydroxy-tetrahydrodipicolinate synthase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=dapA PE=3 SV=1 16 242 5.0E-14
sp|Q3ZXV3|DAPA_DEHMC 4-hydroxy-tetrahydrodipicolinate synthase OS=Dehalococcoides mccartyi (strain CBDB1) GN=dapA PE=3 SV=1 33 242 6.0E-14
sp|Q03HT2|DAPA_PEDPA 4-hydroxy-tetrahydrodipicolinate synthase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=dapA PE=3 SV=1 16 285 6.0E-14
sp|Q492F5|DAPA_BLOPB 4-hydroxy-tetrahydrodipicolinate synthase OS=Blochmannia pennsylvanicus (strain BPEN) GN=dapA PE=3 SV=1 35 246 6.0E-14
sp|O54288|KDGA_SULSF 2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate aldolase OS=Sulfolobus solfataricus PE=1 SV=1 9 296 6.0E-14
sp|Q97U28|KDGA_SULSO 2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate aldolase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=eda PE=1 SV=1 9 296 7.0E-14
sp|A4G724|DAPA_HERAR 4-hydroxy-tetrahydrodipicolinate synthase OS=Herminiimonas arsenicoxydans GN=dapA PE=3 SV=1 35 242 9.0E-14
sp|A6L5G7|DAPA_BACV8 4-hydroxy-tetrahydrodipicolinate synthase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=dapA PE=3 SV=1 10 304 1.0E-13
sp|Q8YQY1|DAPA_NOSS1 4-hydroxy-tetrahydrodipicolinate synthase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=dapA PE=3 SV=1 17 238 1.0E-13
sp|Q8KC06|DAPA_CHLTE 4-hydroxy-tetrahydrodipicolinate synthase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=dapA PE=3 SV=1 86 246 1.0E-13
sp|A8GNF1|DAPA_RICAH 4-hydroxy-tetrahydrodipicolinate synthase OS=Rickettsia akari (strain Hartford) GN=dapA PE=3 SV=1 16 232 1.0E-13
sp|B7IF13|DAPA_THEAB 4-hydroxy-tetrahydrodipicolinate synthase OS=Thermosipho africanus (strain TCF52B) GN=dapA PE=3 SV=1 16 283 1.0E-13
sp|Q7VRT1|DAPA_BLOFL 4-hydroxy-tetrahydrodipicolinate synthase OS=Blochmannia floridanus GN=dapA PE=3 SV=1 35 246 1.0E-13
sp|Q28WG2|DAPA_JANSC 4-hydroxy-tetrahydrodipicolinate synthase OS=Jannaschia sp. (strain CCS1) GN=dapA PE=3 SV=2 35 246 1.0E-13
sp|A1BE04|DAPA_CHLPD 4-hydroxy-tetrahydrodipicolinate synthase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=dapA PE=3 SV=1 10 246 2.0E-13
sp|A8G7F8|DAPA_PROM2 4-hydroxy-tetrahydrodipicolinate synthase OS=Prochlorococcus marinus (strain MIT 9215) GN=dapA PE=3 SV=1 17 302 2.0E-13
sp|Q0IE16|DAPA_SYNS3 4-hydroxy-tetrahydrodipicolinate synthase OS=Synechococcus sp. (strain CC9311) GN=dapA PE=3 SV=1 16 302 2.0E-13
sp|B3QM33|DAPA_CHLP8 4-hydroxy-tetrahydrodipicolinate synthase OS=Chlorobaculum parvum (strain NCIB 8327) GN=dapA PE=3 SV=1 49 246 2.0E-13
sp|A8H415|DAPA_SHEPA 4-hydroxy-tetrahydrodipicolinate synthase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=dapA PE=3 SV=1 11 225 2.0E-13
sp|A6LA57|DAPA_PARD8 4-hydroxy-tetrahydrodipicolinate synthase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=dapA PE=3 SV=1 10 283 2.0E-13
sp|Q16BK4|DAPA_ROSDO 4-hydroxy-tetrahydrodipicolinate synthase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=dapA PE=3 SV=1 35 271 2.0E-13
sp|Q1GSC8|DAPA_SPHAL 4-hydroxy-tetrahydrodipicolinate synthase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=dapA PE=3 SV=1 18 225 2.0E-13
sp|Q4ULR2|DAPA_RICFE 4-hydroxy-tetrahydrodipicolinate synthase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=dapA PE=3 SV=1 16 245 2.0E-13
sp|Q082V3|DAPA_SHEFN 4-hydroxy-tetrahydrodipicolinate synthase OS=Shewanella frigidimarina (strain NCIMB 400) GN=dapA PE=3 SV=1 35 248 2.0E-13
sp|A1RKF2|DAPA_SHESW 4-hydroxy-tetrahydrodipicolinate synthase OS=Shewanella sp. (strain W3-18-1) GN=dapA PE=3 SV=1 35 246 2.0E-13
sp|A4Y644|DAPA_SHEPC 4-hydroxy-tetrahydrodipicolinate synthase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=dapA PE=3 SV=1 35 246 2.0E-13
sp|A7I0Y0|DAPA_CAMHC 4-hydroxy-tetrahydrodipicolinate synthase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=dapA PE=3 SV=1 18 268 3.0E-13
sp|A2BTN4|DAPA_PROMS 4-hydroxy-tetrahydrodipicolinate synthase OS=Prochlorococcus marinus (strain AS9601) GN=dapA PE=3 SV=1 17 294 4.0E-13
sp|C0R176|DAPA_BRAHW 4-hydroxy-tetrahydrodipicolinate synthase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=dapA PE=3 SV=1 6 305 4.0E-13
sp|Q8EFT7|DAPA_SHEON 4-hydroxy-tetrahydrodipicolinate synthase OS=Shewanella oneidensis (strain MR-1) GN=dapA PE=3 SV=1 18 225 4.0E-13
sp|Q317Y9|DAPA_PROM9 4-hydroxy-tetrahydrodipicolinate synthase OS=Prochlorococcus marinus (strain MIT 9312) GN=dapA PE=3 SV=1 17 294 5.0E-13
sp|Q12NF7|DAPA_SHEDO 4-hydroxy-tetrahydrodipicolinate synthase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=dapA PE=3 SV=1 35 243 5.0E-13
sp|B1VDC4|DAPA_CORU7 4-hydroxy-tetrahydrodipicolinate synthase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=dapA PE=3 SV=1 11 283 5.0E-13
sp|Q11JT7|DAPA_CHESB 4-hydroxy-tetrahydrodipicolinate synthase OS=Chelativorans sp. (strain BNC1) GN=dapA PE=3 SV=1 17 246 5.0E-13
sp|A3PFE1|DAPA_PROM0 4-hydroxy-tetrahydrodipicolinate synthase OS=Prochlorococcus marinus (strain MIT 9301) GN=dapA PE=3 SV=1 17 281 5.0E-13
sp|A0KVS0|DAPA_SHESA 4-hydroxy-tetrahydrodipicolinate synthase OS=Shewanella sp. (strain ANA-3) GN=dapA PE=3 SV=1 18 225 6.0E-13
sp|Q03YE2|DAPA_LEUMM 4-hydroxy-tetrahydrodipicolinate synthase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=dapA PE=3 SV=1 17 246 6.0E-13
sp|Q2N9J7|DAPA_ERYLH 4-hydroxy-tetrahydrodipicolinate synthase OS=Erythrobacter litoralis (strain HTCC2594) GN=dapA PE=3 SV=1 43 246 7.0E-13
sp|Q0HHQ6|DAPA_SHESM 4-hydroxy-tetrahydrodipicolinate synthase OS=Shewanella sp. (strain MR-4) GN=dapA PE=3 SV=1 18 225 7.0E-13
sp|Q0HU08|DAPA_SHESR 4-hydroxy-tetrahydrodipicolinate synthase OS=Shewanella sp. (strain MR-7) GN=dapA PE=3 SV=1 18 225 7.0E-13
sp|Q46ID7|DAPA_PROMT 4-hydroxy-tetrahydrodipicolinate synthase OS=Prochlorococcus marinus (strain NATL2A) GN=dapA PE=3 SV=1 16 307 9.0E-13
sp|Q4L9T4|NANA_STAHJ N-acetylneuraminate lyase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=nanA PE=3 SV=1 42 282 1.0E-12
sp|Q6NGP4|DAPA_CORDI 4-hydroxy-tetrahydrodipicolinate synthase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=dapA PE=3 SV=1 11 292 1.0E-12
sp|A7GYB0|DAPA_CAMC5 4-hydroxy-tetrahydrodipicolinate synthase OS=Campylobacter curvus (strain 525.92) GN=dapA PE=3 SV=1 16 246 1.0E-12
sp|B2IT87|DAPA_NOSP7 4-hydroxy-tetrahydrodipicolinate synthase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=dapA PE=3 SV=1 17 245 1.0E-12
sp|Q1QTP6|DAPA_CHRSD 4-hydroxy-tetrahydrodipicolinate synthase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=dapA PE=3 SV=1 45 271 2.0E-12
sp|B1MZM8|DAPA_LEUCK 4-hydroxy-tetrahydrodipicolinate synthase OS=Leuconostoc citreum (strain KM20) GN=dapA PE=3 SV=1 17 295 3.0E-12
sp|P58207|DAPA_RHILO 4-hydroxy-tetrahydrodipicolinate synthase OS=Rhizobium loti (strain MAFF303099) GN=dapA PE=3 SV=1 17 286 3.0E-12
sp|A9L573|DAPA_SHEB9 4-hydroxy-tetrahydrodipicolinate synthase OS=Shewanella baltica (strain OS195) GN=dapA PE=3 SV=1 18 225 3.0E-12
sp|A6WPI6|DAPA_SHEB8 4-hydroxy-tetrahydrodipicolinate synthase OS=Shewanella baltica (strain OS185) GN=dapA PE=3 SV=1 18 225 3.0E-12
sp|A3D5N2|DAPA_SHEB5 4-hydroxy-tetrahydrodipicolinate synthase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=dapA PE=3 SV=1 18 225 3.0E-12
sp|B8E724|DAPA_SHEB2 4-hydroxy-tetrahydrodipicolinate synthase OS=Shewanella baltica (strain OS223) GN=dapA PE=3 SV=1 18 225 3.0E-12
sp|A7ZDQ5|DAPA_CAMC1 4-hydroxy-tetrahydrodipicolinate synthase OS=Campylobacter concisus (strain 13826) GN=dapA PE=3 SV=1 16 243 3.0E-12
sp|A0RP26|DAPA_CAMFF 4-hydroxy-tetrahydrodipicolinate synthase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=dapA PE=3 SV=1 7 246 3.0E-12
sp|O69782|DAPAL_RHIML Uncharacterized DapA-like lyase OS=Rhizobium meliloti GN=dapAL PE=2 SV=1 10 290 3.0E-12
sp|B1GYN1|DAPA_UNCTG 4-hydroxy-tetrahydrodipicolinate synthase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=dapA PE=3 SV=1 10 246 4.0E-12
sp|A4J5V5|DAPA_DESRM 4-hydroxy-tetrahydrodipicolinate synthase OS=Desulfotomaculum reducens (strain MI-1) GN=dapA PE=3 SV=1 26 291 4.0E-12
sp|B3W7E5|DAPA_LACCB 4-hydroxy-tetrahydrodipicolinate synthase OS=Lactobacillus casei (strain BL23) GN=dapA PE=3 SV=1 16 309 4.0E-12
sp|Q03CW3|DAPA_LACC3 4-hydroxy-tetrahydrodipicolinate synthase OS=Lactobacillus casei (strain ATCC 334) GN=dapA PE=3 SV=1 16 309 4.0E-12
sp|Q6KZI8|KDGA_PICTO 2-dehydro-3-deoxy-D-gluconate/2-dehydro-3-deoxy-phosphogluconate aldolase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=PTO1279 PE=1 SV=1 18 222 5.0E-12
sp|Q2G8D6|DAPA_NOVAD 4-hydroxy-tetrahydrodipicolinate synthase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=dapA PE=3 SV=1 43 246 8.0E-12
sp|A4WJK5|DAPAL_PYRAR Uncharacterized DapA-like lyase Pars_0992 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=dapAL PE=3 SV=1 10 282 1.0E-11
sp|Q4JV64|DAPA_CORJK 4-hydroxy-tetrahydrodipicolinate synthase OS=Corynebacterium jeikeium (strain K411) GN=dapA PE=3 SV=1 45 292 1.0E-11
sp|Q5M905|NPL_XENTR N-acetylneuraminate lyase OS=Xenopus tropicalis GN=npl PE=2 SV=1 10 246 1.0E-11
sp|A7H773|DAPA_ANADF 4-hydroxy-tetrahydrodipicolinate synthase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=dapA PE=3 SV=1 44 250 2.0E-11
sp|Q4JC35|KDGA_SULAC 2-dehydro-3-deoxy-phosphogluconate/2-dehydro-3-deoxy-6-phosphogalactonate aldolase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=Saci_0225 PE=1 SV=1 14 295 2.0E-11
sp|Q73H02|DAPA_WOLPM 4-hydroxy-tetrahydrodipicolinate synthase OS=Wolbachia pipientis wMel GN=dapA PE=3 SV=1 23 251 2.0E-11
sp|Q1QL43|DAPA_NITHX 4-hydroxy-tetrahydrodipicolinate synthase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=dapA PE=3 SV=1 5 231 2.0E-11
sp|Q3B0T8|DAPA_SYNS9 4-hydroxy-tetrahydrodipicolinate synthase OS=Synechococcus sp. (strain CC9902) GN=dapA PE=3 SV=1 16 199 2.0E-11
sp|Q8D2M3|DAPA_WIGBR 4-hydroxy-tetrahydrodipicolinate synthase OS=Wigglesworthia glossinidia brevipalpis GN=dapA PE=3 SV=1 37 245 3.0E-11
sp|O25657|DAPA_HELPY 4-hydroxy-tetrahydrodipicolinate synthase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=dapA PE=3 SV=1 17 246 3.0E-11
sp|Q3YSK1|DAPA_EHRCJ 4-hydroxy-tetrahydrodipicolinate synthase OS=Ehrlichia canis (strain Jake) GN=dapA PE=3 SV=1 10 225 4.0E-11
sp|Q2S3M1|DAPA_SALRD 4-hydroxy-tetrahydrodipicolinate synthase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=dapA PE=3 SV=1 10 247 4.0E-11
sp|Q9ZM13|DAPA_HELPJ 4-hydroxy-tetrahydrodipicolinate synthase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=dapA PE=3 SV=1 17 246 4.0E-11
sp|Q17WU7|DAPA_HELAH 4-hydroxy-tetrahydrodipicolinate synthase OS=Helicobacter acinonychis (strain Sheeba) GN=dapA PE=3 SV=1 49 246 4.0E-11
sp|Q07M65|DAPA_RHOP5 4-hydroxy-tetrahydrodipicolinate synthase OS=Rhodopseudomonas palustris (strain BisA53) GN=dapA PE=3 SV=1 35 294 5.0E-11
sp|B6JGA4|DAPA_OLICO 4-hydroxy-tetrahydrodipicolinate synthase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=dapA PE=3 SV=1 44 246 7.0E-11
sp|B1LGJ0|NANA_ECOSM N-acetylneuraminate lyase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=nanA PE=3 SV=1 10 294 8.0E-11
sp|B7NKT6|NANA_ECO7I N-acetylneuraminate lyase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=nanA PE=3 SV=1 10 294 8.0E-11
sp|B6I1U3|NANA_ECOSE N-acetylneuraminate lyase OS=Escherichia coli (strain SE11) GN=nanA PE=3 SV=1 10 294 8.0E-11
sp|Q31W94|NANA_SHIBS N-acetylneuraminate lyase OS=Shigella boydii serotype 4 (strain Sb227) GN=nanA PE=3 SV=1 10 294 8.0E-11
sp|Q9RH76|DAPA_BRADU 4-hydroxy-tetrahydrodipicolinate synthase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=dapA PE=3 SV=2 44 246 8.0E-11
sp|Q3YX23|NANA_SHISS N-acetylneuraminate lyase OS=Shigella sonnei (strain Ss046) GN=nanA PE=3 SV=1 10 294 1.0E-10
sp|P0A6L6|NANA_SHIFL N-acetylneuraminate lyase OS=Shigella flexneri GN=nanA PE=3 SV=2 10 294 1.0E-10
sp|Q0T065|NANA_SHIF8 N-acetylneuraminate lyase OS=Shigella flexneri serotype 5b (strain 8401) GN=nanA PE=3 SV=1 10 294 1.0E-10
sp|Q32BB4|NANA_SHIDS N-acetylneuraminate lyase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=nanA PE=3 SV=1 10 294 1.0E-10
sp|B2U1V9|NANA_SHIB3 N-acetylneuraminate lyase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=nanA PE=3 SV=1 10 294 1.0E-10
sp|Q1R6B5|NANA_ECOUT N-acetylneuraminate lyase OS=Escherichia coli (strain UTI89 / UPEC) GN=nanA PE=3 SV=1 10 294 1.0E-10
sp|P0A6L4|NANA_ECOLI N-acetylneuraminate lyase OS=Escherichia coli (strain K12) GN=nanA PE=1 SV=2 10 294 1.0E-10
sp|B1IQQ4|NANA_ECOLC N-acetylneuraminate lyase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=nanA PE=3 SV=1 10 294 1.0E-10
sp|Q0TCP1|NANA_ECOL5 N-acetylneuraminate lyase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=nanA PE=3 SV=1 10 294 1.0E-10
sp|A1AGB9|NANA_ECOK1 N-acetylneuraminate lyase OS=Escherichia coli O1:K1 / APEC GN=nanA PE=3 SV=1 10 294 1.0E-10
sp|A8A535|NANA_ECOHS N-acetylneuraminate lyase OS=Escherichia coli O9:H4 (strain HS) GN=nanA PE=3 SV=1 10 294 1.0E-10
sp|B1XHJ8|NANA_ECODH N-acetylneuraminate lyase OS=Escherichia coli (strain K12 / DH10B) GN=nanA PE=3 SV=1 10 294 1.0E-10
sp|C4ZSW3|NANA_ECOBW N-acetylneuraminate lyase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=nanA PE=3 SV=1 10 294 1.0E-10
sp|B7M0T7|NANA_ECO8A N-acetylneuraminate lyase OS=Escherichia coli O8 (strain IAI1) GN=nanA PE=3 SV=1 10 294 1.0E-10
sp|B5YSV2|NANA_ECO5E N-acetylneuraminate lyase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=nanA PE=3 SV=1 10 294 1.0E-10
sp|P0A6L5|NANA_ECO57 N-acetylneuraminate lyase OS=Escherichia coli O157:H7 GN=nanA PE=3 SV=2 10 294 1.0E-10
sp|B7LHT3|NANA_ECO55 N-acetylneuraminate lyase OS=Escherichia coli (strain 55989 / EAEC) GN=nanA PE=3 SV=1 10 294 1.0E-10
sp|B7MBY7|NANA_ECO45 N-acetylneuraminate lyase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=nanA PE=3 SV=1 10 294 1.0E-10
sp|B7UJV8|NANA_ECO27 N-acetylneuraminate lyase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=nanA PE=3 SV=1 10 294 1.0E-10
sp|A7ZSB8|NANA_ECO24 N-acetylneuraminate lyase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=nanA PE=3 SV=1 10 294 1.0E-10
sp|Q8FD58|NANA1_ECOL6 N-acetylneuraminate lyase 1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nanA1 PE=3 SV=3 10 294 1.0E-10
sp|B8DWI2|DAPA_BIFA0 4-hydroxy-tetrahydrodipicolinate synthase OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=dapA PE=3 SV=1 17 269 1.0E-10
sp|A9FHA5|DAPA_SORC5 4-hydroxy-tetrahydrodipicolinate synthase OS=Sorangium cellulosum (strain So ce56) GN=dapA PE=3 SV=1 10 232 1.0E-10
sp|Q4FVD6|DAPA_PSYA2 4-hydroxy-tetrahydrodipicolinate synthase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=dapA PE=3 SV=1 45 249 1.0E-10
sp|Q8G527|DAPA_BIFLO 4-hydroxy-tetrahydrodipicolinate synthase OS=Bifidobacterium longum (strain NCC 2705) GN=dapA PE=3 SV=1 34 297 1.0E-10
sp|B3DTC8|DAPA_BIFLD 4-hydroxy-tetrahydrodipicolinate synthase OS=Bifidobacterium longum (strain DJO10A) GN=dapA PE=3 SV=1 34 297 1.0E-10
sp|B5Z6I0|DAPA_HELPG 4-hydroxy-tetrahydrodipicolinate synthase OS=Helicobacter pylori (strain G27) GN=dapA PE=3 SV=1 17 246 1.0E-10
sp|Q7UA33|DAPA_SYNPX 4-hydroxy-tetrahydrodipicolinate synthase OS=Synechococcus sp. (strain WH8102) GN=dapA PE=3 SV=1 16 281 2.0E-10
sp|P59407|NANA_LACPL N-acetylneuraminate lyase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=nanA PE=1 SV=1 41 248 2.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0016829 lyase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup533
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2456
Ophiocordyceps australis map64 (Brazil) OphauB2|4456
Ophiocordyceps camponoti-floridani Ophcf2|03348
Ophiocordyceps camponoti-rufipedis Ophun1|916 (this protein)
Ophiocordyceps kimflemingae Ophio5|60
Ophiocordyceps subramaniannii Hirsu2|3313
Ophiocordyceps subramaniannii Hirsu2|5184

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|916
MPPPKTLPPGVYVPTTTIFTPTDDIDKPATATHAQRLAHAHIAGLVVQGSNGEAIHLDRQDRLLVTHTTREALDA
LHLQHVPLIVGCGAQSTRETLSLCCDAAAHGGSHALVLPPSYYRSLLTMESIIRFYTDVADNSPIPLVVYNFPSV
CGGLDLDSDTILTLARHPNIVGVKLTCGNTGKLARIVAGCDAEFRVLAGSADFIVQALSVGGHGVVAGLANLVPR
TCVELIRLCNDGRAQEARKLQAVVAAADWVAIRGGFVSVKAALQRFHGYGGRPRAPCVLPEGRALEEQMEGFAEV
VRVEGELMAAGGGETG*
Coding >Ophun1|916
ATGCCCCCCCCCAAGACTCTCCCCCCAGGCGTCTACGTCCCAACAACCACCATCTTCACCCCAACCGACGACATC
GACAAACCCGCAACAGCAACCCACGCCCAGCGCCTCGCCCACGCCCATATCGCAGGCCTCGTCGTCCAGGGCTCC
AACGGCGAAGCCATCCACCTCGACCGCCAAGACCGCCTCCTCGTCACCCACACCACCCGCGAAGCCCTCGACGCC
CTCCATCTCCAGCACGTGCCCCTCATCGTCGGCTGCGGCGCTCAGTCCACCCGCGAGACGCTGAGTCTGTGTTGC
GATGCCGCCGCTCATGGGGGGAGCCATGCGCTCGTCCTTCCGCCCTCGTACTATCGCTCGCTGTTGACCATGGAG
AGCATCATCAGATTTTACACGGATGTTGCCGACAACAGTCCTATCCCGCTCGTCGTGTACAACTTCCCGTCCGTC
TGTGGCGGTCTGGACCTCGACTCCGATACCATCCTCACCCTCGCCCGTCATCCCAACATCGTCGGCGTCAAGTTA
ACATGCGGCAACACGGGCAAGCTCGCTCGCATCGTCGCCGGCTGCGATGCCGAATTCCGCGTCCTCGCCGGCAGC
GCAGACTTCATCGTCCAAGCCCTCTCCGTCGGAGGCCACGGCGTCGTCGCCGGCCTGGCCAACCTCGTGCCCCGT
ACCTGCGTCGAGCTCATCCGCCTCTGCAACGACGGCCGCGCCCAGGAGGCCAGGAAGCTGCAGGCCGTCGTCGCT
GCCGCAGACTGGGTCGCCATCCGAGGGGGGTTCGTCTCCGTCAAGGCTGCGTTGCAGAGGTTTCATGGCTACGGG
GGCCGGCCGAGAGCGCCTTGCGTGTTGCCTGAGGGGAGGGCTTTGGAGGAGCAGATGGAGGGGTTTGCTGAGGTT
GTGCGTGTCGAGGGCGAGTTGATGGCGGCGGGCGGTGGTGAGACTGGGTAG
Transcript >Ophun1|916
ATGCCCCCCCCCAAGACTCTCCCCCCAGGCGTCTACGTCCCAACAACCACCATCTTCACCCCAACCGACGACATC
GACAAACCCGCAACAGCAACCCACGCCCAGCGCCTCGCCCACGCCCATATCGCAGGCCTCGTCGTCCAGGGCTCC
AACGGCGAAGCCATCCACCTCGACCGCCAAGACCGCCTCCTCGTCACCCACACCACCCGCGAAGCCCTCGACGCC
CTCCATCTCCAGCACGTGCCCCTCATCGTCGGCTGCGGCGCTCAGTCCACCCGCGAGACGCTGAGTCTGTGTTGC
GATGCCGCCGCTCATGGGGGGAGCCATGCGCTCGTCCTTCCGCCCTCGTACTATCGCTCGCTGTTGACCATGGAG
AGCATCATCAGATTTTACACGGATGTTGCCGACAACAGTCCTATCCCGCTCGTCGTGTACAACTTCCCGTCCGTC
TGTGGCGGTCTGGACCTCGACTCCGATACCATCCTCACCCTCGCCCGTCATCCCAACATCGTCGGCGTCAAGTTA
ACATGCGGCAACACGGGCAAGCTCGCTCGCATCGTCGCCGGCTGCGATGCCGAATTCCGCGTCCTCGCCGGCAGC
GCAGACTTCATCGTCCAAGCCCTCTCCGTCGGAGGCCACGGCGTCGTCGCCGGCCTGGCCAACCTCGTGCCCCGT
ACCTGCGTCGAGCTCATCCGCCTCTGCAACGACGGCCGCGCCCAGGAGGCCAGGAAGCTGCAGGCCGTCGTCGCT
GCCGCAGACTGGGTCGCCATCCGAGGGGGGTTCGTCTCCGTCAAGGCTGCGTTGCAGAGGTTTCATGGCTACGGG
GGCCGGCCGAGAGCGCCTTGCGTGTTGCCTGAGGGGAGGGCTTTGGAGGAGCAGATGGAGGGGTTTGCTGAGGTT
GTGCGTGTCGAGGGCGAGTTGATGGCGGCGGGCGGTGGTGAGACTGGGTAG
Gene >Ophun1|916
ATGCCCCCCCCCAAGACTCTCCCCCCAGGCGTCTACGTCCCAACAACCACCATCTTCACCCCAACCGACGACATC
GACAAACCCGCAACAGCAACCCACGCCCAGCGCCTCGCCCACGCCCATATCGCAGGCCTCGTCGTCCAGGGCTCC
AACGGCGAAGCCATCCACCTCGACCGCCAAGACCGCCTCCTCGTCACCCACACCACCCGCGAAGCCCTCGACGCC
CTCCATCTCCAGCACGTGCCCCTCATCGTCGGCTGCGGCGCTCAGTCCACCCGCGAGACGCTGAGTCTGTGTTGC
GATGCCGCCGCTCATGGGGGGAGCCATGCGCTCGTCCTTCCGCCCTCGTACTATCGCTCGCTGTTGACCATGGAG
AGCATCATCAGATTTTACACGGATGTTGCCGACAACAGTCCTATCCCGCTCGTCGTGTACAACTTCCCGTCCGTC
TGTGGCGGTCTGGACCTCGACTCCGATACCATCCTCACCCTCGCCCGTCATCCCAACATCGTCGGCGTCAAGTTA
ACATGCGGCAACACGGGCAAGCTCGCTCGCATCGTCGCCGGCTGCGATGCCGAATTCCGCGTCCTCGCCGGCAGC
GCAGACTTCATCGTCCAAGCCCTCTCCGTCGGAGGCCACGGCGTCGTCGCCGGCCTGGCCAACCTCGTGCCCCGT
ACCTGCGTCGAGCTCATCCGCCTCTGCAACGACGGCCGCGCCCAGGAGGCCAGGAAGCTGCAGGCCGTCGTCGCT
GCCGCAGACTGGGTCGCCATCCGAGGGGGGTTCGTCTCCGTCAAGGCTGCGTTGCAGAGGTTTCATGGCTACGGG
GGCCGGCCGAGAGCGCCTTGCGTGTTGCCTGAGGGGAGGGCTTTGGAGGAGCAGATGGAGGGGTTTGCTGAGGTT
GTGCGTGTCGAGGGCGAGTTGATGGCGGCGGGCGGTGGTGAGACTGGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail