Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|915
Gene name
LocationContig_1323:1674..2551
Strand-
Gene length (bp)877
Transcript length (bp)822
Coding sequence length (bp)822
Protein length (aa) 274

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10075 CSN8_PSD8_EIF3K CSN8/PSMD8/EIF3K family 5.2E-21 102 240

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P50524|RPN12_SCHPO 26S proteasome regulatory subunit rpn12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn12 PE=1 SV=1 44 273 2.0E-39
sp|P32496|RPN12_YEAST 26S proteasome regulatory subunit RPN12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN12 PE=1 SV=3 21 273 7.0E-38
sp|Q3SYT7|PSMD8_BOVIN 26S proteasome non-ATPase regulatory subunit 8 OS=Bos taurus GN=PSMD8 PE=2 SV=3 14 273 1.0E-33
sp|Q5RE15|PSMD8_PONAB 26S proteasome non-ATPase regulatory subunit 8 (Fragment) OS=Pongo abelii GN=PSMD8 PE=2 SV=2 14 273 2.0E-33
sp|P48556|PSMD8_HUMAN 26S proteasome non-ATPase regulatory subunit 8 OS=Homo sapiens GN=PSMD8 PE=1 SV=2 14 273 5.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P50524|RPN12_SCHPO 26S proteasome regulatory subunit rpn12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn12 PE=1 SV=1 44 273 2.0E-39
sp|P32496|RPN12_YEAST 26S proteasome regulatory subunit RPN12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN12 PE=1 SV=3 21 273 7.0E-38
sp|Q3SYT7|PSMD8_BOVIN 26S proteasome non-ATPase regulatory subunit 8 OS=Bos taurus GN=PSMD8 PE=2 SV=3 14 273 1.0E-33
sp|Q5RE15|PSMD8_PONAB 26S proteasome non-ATPase regulatory subunit 8 (Fragment) OS=Pongo abelii GN=PSMD8 PE=2 SV=2 14 273 2.0E-33
sp|P48556|PSMD8_HUMAN 26S proteasome non-ATPase regulatory subunit 8 OS=Homo sapiens GN=PSMD8 PE=1 SV=2 14 273 5.0E-33
sp|Q9CX56|PSMD8_MOUSE 26S proteasome non-ATPase regulatory subunit 8 OS=Mus musculus GN=Psmd8 PE=1 SV=2 12 273 2.0E-32
sp|Q9SGW3|PSD8A_ARATH 26S proteasome non-ATPase regulatory subunit 8 homolog A OS=Arabidopsis thaliana GN=RPN12A PE=1 SV=1 21 273 2.0E-30
sp|P02889|PSMD8_DICDI Probable 26S proteasome non-ATPase regulatory subunit 8 OS=Dictyostelium discoideum GN=psmD8-1 PE=2 SV=2 27 273 2.0E-28
sp|Q23449|PSMD8_CAEEL 26S proteasome non-ATPase regulatory subunit 8 OS=Caenorhabditis elegans GN=rpn-12 PE=3 SV=1 38 273 3.0E-24
sp|Q9FHY0|PSD8B_ARATH Putative 26S proteasome non-ATPase regulatory subunit 8 homolog B OS=Arabidopsis thaliana GN=RPN12B PE=5 SV=2 85 273 8.0E-23
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5008
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|544
Ophiocordyceps australis map64 (Brazil) OphauB2|4819
Ophiocordyceps camponoti-floridani Ophcf2|01770
Ophiocordyceps camponoti-rufipedis Ophun1|915 (this protein)
Ophiocordyceps kimflemingae Ophio5|4970
Ophiocordyceps subramaniannii Hirsu2|2421

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|915
MAERNLTQILGQLKNSPSMSYPEANRLLSQAKLAILQLKALTPTPSVSSHLLALARETYEQGALFAIRARQPEAF
TRYVQQLQPFYELPSSRLPPNLAERNKITGLSLLLLLTQGRYAEFHSELESLANRDGGGSPGDVEGDVYLGYPIR
LERWLMEGSYDRVWKAMKSSEVPCDEYSVFSEILKNQIRSEIAASSERAYLSIPLSSTKSLLFLDSEGEVIQFAK
HRGWTVRNGHIFFPEAADTDEDGGLSKDLSQMIIENTLGYARELETIV*
Coding >Ophun1|915
ATGGCGGAACGCAACCTCACCCAGATCCTAGGCCAGCTCAAGAACTCGCCGTCAATGAGCTACCCCGAAGCCAAC
AGACTCCTCTCGCAGGCCAAGCTCGCCATCCTCCAGCTCAAAGCCCTCACCCCAACGCCATCTGTATCCTCCCAT
CTCCTCGCTCTCGCTCGCGAGACGTACGAGCAGGGTGCCCTCTTTGCCATCCGCGCTCGTCAACCCGAGGCCTTC
ACCCGCTACGTTCAACAGCTCCAGCCCTTTTACGAACTTCCCTCCTCGAGGCTACCCCCGAATCTTGCCGAGCGC
AACAAGATCACCGGTCTGAGTCTCCTGCTTCTCCTGACTCAGGGACGCTATGCCGAGTTTCACTCCGAGCTCGAG
AGTCTTGCCAACAGGGATGGTGGCGGCAGCCCCGGAGATGTCGAGGGAGACGTCTACCTCGGATATCCCATCAGG
CTGGAGCGCTGGTTGATGGAGGGCAGCTATGATCGAGTCTGGAAGGCAATGAAGAGTAGCGAGGTGCCCTGCGAT
GAGTACAGCGTCTTCTCCGAAATCCTCAAGAACCAAATCCGGTCCGAGATTGCCGCCAGCAGCGAACGAGCCTAT
CTCAGCATCCCCTTGAGCTCTACAAAGTCTCTCCTCTTTCTCGACTCCGAGGGCGAAGTCATACAGTTCGCTAAG
CATCGCGGATGGACTGTCCGGAATGGCCACATCTTCTTCCCCGAAGCCGCCGACACCGACGAAGATGGCGGTCTG
AGCAAGGACTTGAGCCAGATGATTATCGAGAATACTCTGGGCTACGCACGCGAGCTCGAGACCATCGTCTAA
Transcript >Ophun1|915
ATGGCGGAACGCAACCTCACCCAGATCCTAGGCCAGCTCAAGAACTCGCCGTCAATGAGCTACCCCGAAGCCAAC
AGACTCCTCTCGCAGGCCAAGCTCGCCATCCTCCAGCTCAAAGCCCTCACCCCAACGCCATCTGTATCCTCCCAT
CTCCTCGCTCTCGCTCGCGAGACGTACGAGCAGGGTGCCCTCTTTGCCATCCGCGCTCGTCAACCCGAGGCCTTC
ACCCGCTACGTTCAACAGCTCCAGCCCTTTTACGAACTTCCCTCCTCGAGGCTACCCCCGAATCTTGCCGAGCGC
AACAAGATCACCGGTCTGAGTCTCCTGCTTCTCCTGACTCAGGGACGCTATGCCGAGTTTCACTCCGAGCTCGAG
AGTCTTGCCAACAGGGATGGTGGCGGCAGCCCCGGAGATGTCGAGGGAGACGTCTACCTCGGATATCCCATCAGG
CTGGAGCGCTGGTTGATGGAGGGCAGCTATGATCGAGTCTGGAAGGCAATGAAGAGTAGCGAGGTGCCCTGCGAT
GAGTACAGCGTCTTCTCCGAAATCCTCAAGAACCAAATCCGGTCCGAGATTGCCGCCAGCAGCGAACGAGCCTAT
CTCAGCATCCCCTTGAGCTCTACAAAGTCTCTCCTCTTTCTCGACTCCGAGGGCGAAGTCATACAGTTCGCTAAG
CATCGCGGATGGACTGTCCGGAATGGCCACATCTTCTTCCCCGAAGCCGCCGACACCGACGAAGATGGCGGTCTG
AGCAAGGACTTGAGCCAGATGATTATCGAGAATACTCTGGGCTACGCACGCGAGCTCGAGACCATCGTCTAA
Gene >Ophun1|915
ATGGCGGAACGCAACCTCACCCAGATCCTAGGCCAGCTCAAGAACTCGCCGTCAATGAGCTACCCCGAAGCCAAC
AGACTCCTCTCGCAGGCCAAGCTCGCCATCCTCCAGCTCAAAGCCCTCACCCCAACGCCATCTGTATCCTCCCAT
CTCCTCGCTCTCGCTCGCGAGACGTACGAGCAGGGTGCCCTCTTTGCCATCCGCGCTCGTCAACCCGAGGCCTTC
ACCCGCTACGTTCAACAGCTCCAGCCCTTTTACGAACTTCCCTCCTCGAGGCTACCCCCGAATCTTGCCGAGCGC
AACAAGATCACCGGTCTGAGTCTCCTGCTTCTCCTGACTCAGGGACGCTATGCCGAGTTTCACTCCGAGCTCGAG
AGTCTTGCCAACAGGGATGGTGGCGGCAGCCCCGGAGATGTCGAGGGAGACGTCTACCTCGGATATCCCATCAGG
CTGGAGCGCTGGTTGATGGAGGGCAGCTATGATCGAGTCTGGAAGGCAATGAAGAGTAGCGAGGTGCCCTGCGAT
GAGTACAGCGTCTTCTCCGAAGTCAGTCGGCATCCCTTGAGCTCTATATCTGTCCCAGTCTCTAACCCCGTCGCA
GATCCTCAAGAACCAAATCCGGTCCGAGATTGCCGCCAGCAGCGAACGAGCCTATCTCAGCATCCCCTTGAGCTC
TACAAAGTCTCTCCTCTTTCTCGACTCCGAGGGCGAAGTCATACAGTTCGCTAAGCATCGCGGATGGACTGTCCG
GAATGGCCACATCTTCTTCCCCGAAGCCGCCGACACCGACGAAGATGGCGGTCTGAGCAAGGACTTGAGCCAGAT
GATTATCGAGAATACTCTGGGCTACGCACGCGAGCTCGAGACCATCGTCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail