Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|912
Gene name
LocationContig_1320:166..778
Strand+
Gene length (bp)612
Transcript length (bp)387
Coding sequence length (bp)387
Protein length (aa) 129

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11969 DcpS_C Scavenger mRNA decapping enzyme C-term binding 5.0E-09 44 118

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7C9|DCPS_SCHPO m7GpppX diphosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nhm1 PE=1 SV=1 6 116 5.0E-22
sp|Q06151|DCPS_YEAST m7GpppX diphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCS1 PE=1 SV=1 7 119 2.0E-21
sp|Q12123|DCS2_YEAST Inactive diphosphatase DCS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCS2 PE=1 SV=3 7 119 6.0E-20
sp|Q9DAR7|DCPS_MOUSE m7GpppX diphosphatase OS=Mus musculus GN=Dcps PE=1 SV=1 7 116 1.0E-18
sp|Q96C86|DCPS_HUMAN m7GpppX diphosphatase OS=Homo sapiens GN=DCPS PE=1 SV=2 7 116 2.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7C9|DCPS_SCHPO m7GpppX diphosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nhm1 PE=1 SV=1 6 116 5.0E-22
sp|Q06151|DCPS_YEAST m7GpppX diphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCS1 PE=1 SV=1 7 119 2.0E-21
sp|Q12123|DCS2_YEAST Inactive diphosphatase DCS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCS2 PE=1 SV=3 7 119 6.0E-20
sp|Q9DAR7|DCPS_MOUSE m7GpppX diphosphatase OS=Mus musculus GN=Dcps PE=1 SV=1 7 116 1.0E-18
sp|Q96C86|DCPS_HUMAN m7GpppX diphosphatase OS=Homo sapiens GN=DCPS PE=1 SV=2 7 116 2.0E-18
sp|Q8K4F7|DCPS_RAT m7GpppX diphosphatase OS=Rattus norvegicus GN=Dcps PE=2 SV=1 7 116 2.0E-18
sp|Q8MJJ7|DCPS_BOVIN m7GpppX diphosphatase OS=Bos taurus GN=DCPS PE=2 SV=1 7 116 4.0E-18
sp|G5EFS4|DCPS_CAEEL m7GpppX diphosphatase OS=Caenorhabditis elegans GN=dcs-1 PE=1 SV=1 8 108 7.0E-18
sp|D3K0N9|DCPS_ASCSU m7GpppX diphosphatase OS=Ascaris suum PE=1 SV=1 7 116 1.0E-17
sp|Q8MIZ3|DCPS_PIG m7GpppX diphosphatase OS=Sus scrofa GN=DCPS PE=2 SV=1 7 116 9.0E-17
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5460
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5414
Ophiocordyceps australis map64 (Brazil) OphauB2|3875
Ophiocordyceps camponoti-floridani Ophcf2|04130
Ophiocordyceps camponoti-rufipedis Ophun1|912 (this protein)
Ophiocordyceps kimflemingae Ophio5|7030
Ophiocordyceps subramaniannii Hirsu2|6234

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|912
MGMGMSHVDKYSKQPIRSVTETPELYRQVIRPLMQRAREAGRLNWVYNILDGVSEVQDVIYRTPPPSDDTNDGGF
VLLPDLNWDRATVEALHLLALVERRDLWSLRDLRKRHARLLVRLWGWTPSSRR*
Coding >Ophun1|912
ATGGGGATGGGGATGTCGCACGTGGATAAATACAGCAAGCAACCCATCCGCTCCGTCACGGAAACGCCAGAGCTC
TACCGCCAAGTCATCCGCCCGCTCATGCAACGCGCCCGCGAGGCAGGGCGTCTGAACTGGGTGTACAACATTCTC
GACGGCGTTTCCGAAGTGCAAGACGTTATATACAGGACGCCCCCTCCCTCGGATGATACCAACGATGGGGGCTTC
GTTCTCCTGCCGGACCTCAACTGGGATCGCGCTACCGTCGAGGCGCTGCATTTACTGGCGCTGGTGGAGAGGCGG
GATCTTTGGTCTTTGCGGGATCTTCGGAAGCGTCATGCCAGGCTGTTGGTAAGGCTATGGGGTTGGACGCCATCA
TCGAGACGCTGA
Transcript >Ophun1|912
ATGGGGATGGGGATGTCGCACGTGGATAAATACAGCAAGCAACCCATCCGCTCCGTCACGGAAACGCCAGAGCTC
TACCGCCAAGTCATCCGCCCGCTCATGCAACGCGCCCGCGAGGCAGGGCGTCTGAACTGGGTGTACAACATTCTC
GACGGCGTTTCCGAAGTGCAAGACGTTATATACAGGACGCCCCCTCCCTCGGATGATACCAACGATGGGGGCTTC
GTTCTCCTGCCGGACCTCAACTGGGATCGCGCTACCGTCGAGGCGCTGCATTTACTGGCGCTGGTGGAGAGGCGG
GATCTTTGGTCTTTGCGGGATCTTCGGAAGCGTCATGCCAGGCTGTTGGTAAGGCTATGGGGTTGGACGCCATCA
TCGAGACGCTGA
Gene >Ophun1|912
ATGGGGATGGGGATGGTGAGAGGGAGGGGAGGGAGGAGCCTCCGGATGTGAAAATCAGCCTCATCACCCCCTGCA
CAAAGTCGCACGTGGATAAATACAGCAAGCAACCCATCCGCTCCGTCACGGAAACGCCAGAGCTCTACCGCCAAG
TCATCCGCCCGCTCATGCAACGCGCCCGCGAGGCAGGGCGTCTGAACTGGGTGTACAACATTCTCGACGGCGTTT
CCGAAGTGCAAGACGTTATATACAGGACGCCCCCTCCCTCGGATGATACCAACGATGGGGGCTTCGTTCTCCTGC
CGGACCTCAACTGGGATCGCGCTACCGTCGAGGCGCTGCATTTACTGGCGCTGGTGGAGAGGCGGGATCTTTGGT
CTTTGCGGGATCTTCGGAAGCGTCATGTTGGTTGGTTGGAGGATATGCGCGCCGGTCTCGTGGATGCTACCGTTT
CGAAATACCCGGCTCTCGCGGCGGATCAACTAAAGCTGTACCTTCATTACCAGCCGACATACTACCACCTGCACA
TCCACATCGTCCACGTCGCTCTCGAGGCCGGGGCAGGCCAGGCTGTTGGTAAGGCTATGGGGTTGGACGCCATCA
TCGAGACGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail