Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|904
Gene name
LocationContig_132:19719..21671
Strand-
Gene length (bp)1952
Transcript length (bp)1722
Coding sequence length (bp)1722
Protein length (aa) 574

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00494 SQS_PSY Squalene/phytoene synthase 1.7E-50 260 557

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|E4UPP6|LCPS_ARTGP Bifunctional lycopene cyclase/phytoene synthase OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_02096 PE=3 SV=1 3 567 4.0E-156
sp|Q2U4X9|LCPS_ASPOR Bifunctional lycopene cyclase/phytoene synthase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090020000159 PE=3 SV=1 3 571 8.0E-155
sp|D4D802|LCPS_TRIVH Bifunctional lycopene cyclase/phytoene synthase OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_03236 PE=3 SV=1 3 568 9.0E-155
sp|E4ZUB5|LCPS_LEPMJ Bifunctional lycopene cyclase/phytoene synthase OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=Lema_P114090.1 PE=3 SV=1 3 568 1.0E-136
sp|B2WAQ3|LCPS_PYRTR Bifunctional lycopene cyclase/phytoene synthase OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=PTRG_07366 PE=3 SV=1 3 568 2.0E-131
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|E4UPP6|LCPS_ARTGP Bifunctional lycopene cyclase/phytoene synthase OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_02096 PE=3 SV=1 3 567 4.0E-156
sp|Q2U4X9|LCPS_ASPOR Bifunctional lycopene cyclase/phytoene synthase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090020000159 PE=3 SV=1 3 571 8.0E-155
sp|D4D802|LCPS_TRIVH Bifunctional lycopene cyclase/phytoene synthase OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_03236 PE=3 SV=1 3 568 9.0E-155
sp|E4ZUB5|LCPS_LEPMJ Bifunctional lycopene cyclase/phytoene synthase OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=Lema_P114090.1 PE=3 SV=1 3 568 1.0E-136
sp|B2WAQ3|LCPS_PYRTR Bifunctional lycopene cyclase/phytoene synthase OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=PTRG_07366 PE=3 SV=1 3 568 2.0E-131
sp|Q0V6M5|LCPS_PHANO Bifunctional lycopene cyclase/phytoene synthase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_00339 PE=3 SV=1 3 570 9.0E-128
sp|Q8X0Z1|LCPS_GIBFU Bifunctional lycopene cyclase/phytoene synthase OS=Gibberella fujikuroi GN=carRA PE=2 SV=1 17 569 1.0E-126
sp|B2ATB0|LCPS_PODAN Bifunctional lycopene cyclase/phytoene synthase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_1_15240 PE=3 SV=1 3 570 2.0E-120
sp|E3Q717|LCPS_COLGM Bifunctional lycopene cyclase/phytoene synthase OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=GLRG_02475 PE=3 SV=1 7 563 2.0E-115
sp|D1Z4K7|LCPS_SORMK Bifunctional lycopene cyclase/phytoene synthase OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=putative al2 PE=3 SV=1 3 555 3.0E-113
sp|P37295|LCPS_NEUCR Bifunctional lycopene cyclase/phytoene synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=al-2 PE=1 SV=1 7 567 5.0E-112
sp|A2QM49|LCPS_ASPNC Bifunctional lycopene cyclase/phytoene synthase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An07g00800 PE=3 SV=1 2 409 3.0E-90
sp|Q7Z859|LCPS_PHARH Bifunctional lycopene cyclase/phytoene synthase OS=Phaffia rhodozyma GN=crtYB PE=2 SV=1 3 537 6.0E-47
sp|Q67GH9|LCPS_BLATR Bifunctional lycopene cyclase/phytoene synthase OS=Blakeslea trispora GN=carRA PE=1 SV=1 3 542 2.0E-45
sp|Q9UUQ6|LCPS_MUCCL Bifunctional lycopene cyclase/phytoene synthase OS=Mucor circinelloides f. lusitanicus GN=CARRP PE=2 SV=1 3 537 2.0E-38
sp|Q4P0S6|LCPS_USTMA Bifunctional lycopene cyclase/phytoene synthase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_06287 PE=3 SV=1 2 543 4.0E-38
sp|E6ZZ11|LCPS_SPORE Bifunctional lycopene cyclase/phytoene synthase OS=Sporisorium reilianum (strain SRZ2) GN=sr13176 PE=3 SV=1 2 471 4.0E-34
sp|Q9P854|LCPS_PHYB8 Bifunctional lycopene cyclase/phytoene synthase OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=carRA PE=1 SV=1 7 572 2.0E-32
sp|Q9HNE5|CRTY_HALSA Lycopene beta-cyclase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=crtY PE=3 SV=2 2 208 1.0E-20
sp|B0R753|CRTY_HALS3 Lycopene beta-cyclase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=crtY PE=1 SV=1 2 208 1.0E-20
sp|P54905|CRTB_RHOS4 Phytoene synthase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=crtB PE=3 SV=2 256 545 3.0E-15
sp|P17056|CRTB_RHOCB Phytoene synthase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=crtB PE=3 SV=1 256 541 8.0E-15
sp|P22872|CRTB_ESCVU Phytoene synthase OS=Escherichia vulneris GN=crtB PE=3 SV=1 251 545 1.0E-13
sp|P21683|CRTB_PANAN All-trans-phytoene synthase/15-cis-phytoene synthase OS=Pantoea ananas GN=crtB PE=1 SV=2 251 545 2.0E-13
sp|P37273|PSY2_SOLLC Phytoene synthase 2, chloroplastic (Fragment) OS=Solanum lycopersicum GN=PSY2 PE=2 SV=1 256 544 6.0E-12
sp|D5KXJ0|CRTB_ENTAG All-trans-phytoene synthase OS=Enterobacter agglomerans GN=crtB PE=1 SV=1 262 545 1.0E-11
sp|P49085|PSY_MAIZE Phytoene synthase, chloroplastic OS=Zea mays GN=Y1 PE=3 SV=1 241 544 2.0E-11
sp|P37272|PSY_CAPAN Bifunctional 15-cis-phytoene synthase, chromoplastic OS=Capsicum annuum GN=PSY1 PE=1 SV=1 256 527 4.0E-11
sp|P37271|PSY_ARATH Phytoene synthase, chloroplastic OS=Arabidopsis thaliana GN=PSY1 PE=2 SV=2 256 527 6.0E-11
sp|P37269|CRTB_SYNE7 All-trans-phytoene synthase OS=Synechococcus elongatus (strain PCC 7942) GN=crtB PE=1 SV=2 257 570 2.0E-10
sp|P08196|PSY1_SOLLC Phytoene synthase 1, chloroplastic OS=Solanum lycopersicum GN=PSY1 PE=1 SV=2 256 544 9.0E-10
sp|Q52QW5|PSY_ONCHC Phytoene synthase, chloroplastic OS=Oncidium hybrid cultivar GN=PSY PE=2 SV=1 257 544 4.0E-09
sp|P54975|CRTB_PARSN 15-cis-phytoene synthase OS=Paracoccus sp. (strain N81106 / MBIC 01143) GN=crtB PE=1 SV=2 254 537 7.0E-09
sp|Q9SSU8|PSY_DAUCA Phytoene synthase, chloroplastic OS=Daucus carota GN=PSY PE=2 SV=1 256 544 2.0E-08
sp|P37294|CRTB_SYNY3 All-trans-phytoene synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=crtB PE=1 SV=1 257 545 2.0E-08
sp|P49293|PSY_CUCME Phytoene synthase, chloroplastic OS=Cucumis melo GN=PSY PE=2 SV=1 256 544 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0008150 biological_process No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 43 65 22
2 85 103 18
3 113 135 22
4 186 208 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|904
MAKVSALVSMAVVCTLPWDSFLVRNRIWSYPTDAVVGISLFSVPIEEIFFFVIQTYNTGLVYVVLTKQLVLPVYL
GNRASARRRLAGFLGLGCVFLLALIGVVRRGRQTYMSLILAWVTPFLTLQWALCSHFLLALPRARLLLAVVLPSL
YLCMVDTLALRRGTWVIEDGTKMGYEVLGFLEMEEVVFFFVTNLMIVMGLVTVDYHIAMEEYQMARSPGPGKRFP
SLTRLLRRCLFRESCREPDADFIRGLADAVDVVSTKSQTMYMGSAMFEAALRIDLILLYNFCRVLDDVVDEAGDL
EAARSAVQTCRRALRVRFQQSTEKTADDYQFVSVSPALSSSIALLPVSRLSIEPLDSLLLGFETDLEFSQAGSGN
GDGWPIATERDLETYAYRVAGTVAASLLSLVLYHYPLDDDDGQQRQGTTGDNDDDDDDDGRRGIVTAGAKMGQAL
QYVNIARDVGRDAAIGRVYLPQTWLRQEGLDAASVVARPRDGPMAKLQGRMLDKAKRAYRATEAVMDELPVEVRG
PIRTVVESYMAIAGSVLADGLREKGKLKLPWWRRLIVARRAMGRAKGW*
Coding >Ophun1|904
ATGGCCAAGGTATCGGCTTTGGTGTCGATGGCCGTCGTCTGCACCCTGCCGTGGGACTCGTTTCTAGTCCGTAAC
CGCATCTGGTCGTATCCAACGGACGCTGTCGTTGGCATCAGTCTCTTCTCCGTTCCCATCGAAGAGATCTTCTTC
TTCGTCATCCAGACCTACAACACGGGGCTCGTGTACGTCGTCTTAACCAAGCAGCTGGTGCTTCCCGTCTATCTC
GGCAACCGGGCCAGTGCACGCCGCCGCCTGGCCGGTTTTCTGGGCCTCGGGTGTGTCTTTCTGCTCGCACTTATT
GGAGTCGTCCGCAGAGGCAGACAGACATACATGAGCCTCATCCTGGCATGGGTTACACCCTTTTTGACGCTCCAG
TGGGCTTTGTGCTCTCACTTCTTGCTGGCGTTGCCTCGGGCCCGGTTGCTGCTCGCTGTCGTACTGCCTTCCCTC
TATTTATGCATGGTGGACACTTTGGCCCTGCGACGCGGCACCTGGGTCATCGAGGACGGCACCAAGATGGGCTAC
GAGGTTCTTGGCTTTCTCGAGATGGAGGAGGTCGTCTTCTTCTTCGTCACCAATCTCATGATCGTCATGGGCCTC
GTCACCGTCGACTATCACATCGCCATGGAAGAGTACCAAATGGCTAGATCGCCCGGTCCGGGGAAGCGATTCCCG
TCATTGACTAGGCTTCTGCGCCGCTGCCTTTTCCGTGAGAGCTGCAGGGAGCCTGACGCGGACTTTATTCGAGGC
TTGGCCGATGCCGTCGACGTCGTCTCTACCAAGAGTCAGACCATGTACATGGGCAGTGCCATGTTTGAGGCGGCT
CTGCGGATCGATCTAATTCTTCTATATAATTTCTGCCGTGTTCTCGATGACGTTGTCGACGAAGCTGGCGATTTG
GAGGCCGCGCGGAGCGCCGTTCAGACCTGCCGTCGAGCTCTGCGAGTCCGCTTCCAGCAGTCGACTGAAAAGACG
GCGGACGATTATCAGTTCGTCTCCGTGTCTCCAGCCCTTAGCTCCTCCATTGCGCTACTGCCGGTGTCACGGCTA
TCAATAGAGCCTCTCGACAGCCTACTGCTGGGTTTCGAGACGGACCTCGAATTCTCGCAGGCTGGTTCGGGCAAC
GGAGATGGCTGGCCGATCGCCACGGAGAGGGATCTGGAGACGTACGCGTATCGTGTGGCTGGCACGGTGGCGGCG
TCGCTGCTCAGCTTGGTGCTGTATCACTACCCGCTCGACGACGATGATGGCCAGCAGCGACAGGGGACGACCGGC
GATAATGATGATGATGATGATGATGATGGCAGGAGAGGAATCGTGACGGCCGGCGCCAAGATGGGTCAGGCCCTT
CAGTACGTCAATATCGCGCGCGACGTGGGCCGCGATGCAGCCATTGGACGCGTCTACCTGCCGCAGACATGGCTA
CGACAGGAAGGCCTGGACGCAGCCTCAGTGGTAGCGAGGCCGCGGGACGGACCGATGGCGAAGCTCCAGGGCCGG
ATGCTCGACAAGGCCAAGCGGGCGTACCGGGCCACCGAGGCTGTCATGGACGAACTCCCCGTCGAGGTCAGGGGC
CCGATCCGCACGGTGGTTGAGAGCTACATGGCCATTGCGGGCTCGGTTCTGGCCGACGGGCTGCGGGAGAAGGGG
AAGCTGAAGCTGCCGTGGTGGCGGCGCCTGATTGTTGCCAGGAGAGCGATGGGCAGGGCAAAGGGGTGGTAG
Transcript >Ophun1|904
ATGGCCAAGGTATCGGCTTTGGTGTCGATGGCCGTCGTCTGCACCCTGCCGTGGGACTCGTTTCTAGTCCGTAAC
CGCATCTGGTCGTATCCAACGGACGCTGTCGTTGGCATCAGTCTCTTCTCCGTTCCCATCGAAGAGATCTTCTTC
TTCGTCATCCAGACCTACAACACGGGGCTCGTGTACGTCGTCTTAACCAAGCAGCTGGTGCTTCCCGTCTATCTC
GGCAACCGGGCCAGTGCACGCCGCCGCCTGGCCGGTTTTCTGGGCCTCGGGTGTGTCTTTCTGCTCGCACTTATT
GGAGTCGTCCGCAGAGGCAGACAGACATACATGAGCCTCATCCTGGCATGGGTTACACCCTTTTTGACGCTCCAG
TGGGCTTTGTGCTCTCACTTCTTGCTGGCGTTGCCTCGGGCCCGGTTGCTGCTCGCTGTCGTACTGCCTTCCCTC
TATTTATGCATGGTGGACACTTTGGCCCTGCGACGCGGCACCTGGGTCATCGAGGACGGCACCAAGATGGGCTAC
GAGGTTCTTGGCTTTCTCGAGATGGAGGAGGTCGTCTTCTTCTTCGTCACCAATCTCATGATCGTCATGGGCCTC
GTCACCGTCGACTATCACATCGCCATGGAAGAGTACCAAATGGCTAGATCGCCCGGTCCGGGGAAGCGATTCCCG
TCATTGACTAGGCTTCTGCGCCGCTGCCTTTTCCGTGAGAGCTGCAGGGAGCCTGACGCGGACTTTATTCGAGGC
TTGGCCGATGCCGTCGACGTCGTCTCTACCAAGAGTCAGACCATGTACATGGGCAGTGCCATGTTTGAGGCGGCT
CTGCGGATCGATCTAATTCTTCTATATAATTTCTGCCGTGTTCTCGATGACGTTGTCGACGAAGCTGGCGATTTG
GAGGCCGCGCGGAGCGCCGTTCAGACCTGCCGTCGAGCTCTGCGAGTCCGCTTCCAGCAGTCGACTGAAAAGACG
GCGGACGATTATCAGTTCGTCTCCGTGTCTCCAGCCCTTAGCTCCTCCATTGCGCTACTGCCGGTGTCACGGCTA
TCAATAGAGCCTCTCGACAGCCTACTGCTGGGTTTCGAGACGGACCTCGAATTCTCGCAGGCTGGTTCGGGCAAC
GGAGATGGCTGGCCGATCGCCACGGAGAGGGATCTGGAGACGTACGCGTATCGTGTGGCTGGCACGGTGGCGGCG
TCGCTGCTCAGCTTGGTGCTGTATCACTACCCGCTCGACGACGATGATGGCCAGCAGCGACAGGGGACGACCGGC
GATAATGATGATGATGATGATGATGATGGCAGGAGAGGAATCGTGACGGCCGGCGCCAAGATGGGTCAGGCCCTT
CAGTACGTCAATATCGCGCGCGACGTGGGCCGCGATGCAGCCATTGGACGCGTCTACCTGCCGCAGACATGGCTA
CGACAGGAAGGCCTGGACGCAGCCTCAGTGGTAGCGAGGCCGCGGGACGGACCGATGGCGAAGCTCCAGGGCCGG
ATGCTCGACAAGGCCAAGCGGGCGTACCGGGCCACCGAGGCTGTCATGGACGAACTCCCCGTCGAGGTCAGGGGC
CCGATCCGCACGGTGGTTGAGAGCTACATGGCCATTGCGGGCTCGGTTCTGGCCGACGGGCTGCGGGAGAAGGGG
AAGCTGAAGCTGCCGTGGTGGCGGCGCCTGATTGTTGCCAGGAGAGCGATGGGCAGGGCAAAGGGGTGGTAG
Gene >Ophun1|904
ATGGCCAAGGTATCGGCTTTGGTGTCGGTACGCATCGAGCTCAAGTCTCCCGGATGCCTCGTCAACTCATATTCG
ATGGCAGATGGCCGTCGTCTGCACCCTGCCGTGGGACTCGTTTCTAGTCCGTAACCGCATCTGGTCGTATCCAAC
GGACGCTGTCGTTGGCATCAGTCTCTTCTCCGTTCCCATCGAAGAGATCTTCTTCTTCGTCATCCAGACCTACAA
CACGGGGCTCGTGTACGTCGTCTTAACCAAGCAGCTGGTGCTTCCCGTCTATCTCGGCAACCGGGCCAGTGCACG
CCGCCGCCTGGCCGGTTTTCTGGGCCTCGGGTGTGTCTTTCTGCTCGCACTTATTGGAGTCGTCCGCAGAGGCAG
ACAGACATACATGAGCCTCATCCTGGCATGGGTTACACCCTTTTTGACGCTCCAGTGGTGAGTCTCGATGCTACA
TGGCAAGTTTGAGAGAAGAAAAGCGACCGAGGCTGATGCATATCTCAGGGCTTTGTGCTCTCACTTCTTGCTGGC
GTTGCCTCGGGCCCGGTTGCTGCTCGCTGTCGTACTGCCTTCCCTCTATTTATGCATGGTGGACACTTTGGCCCT
GCGACGCGGCACCTGGGTCATCGAGGACGGCACCAAGATGGGCTACGAGGTTCTTGGCTTTCTCGAGATGGAGTA
TGTTGTCTACGCTTCTCCCGTATGACGCCACGAAAACCAACGCGATCTGTTTCACAGGGAGGTCGTCTTCTTCTT
CGTCACCAATCTCATGATCGTCATGGGCCTCGTCACCGTCGACTATCACATCGCCATGGAAGAGTACCAAATGGC
TAGATCGCCCGGTCCGGGGAAGCGATTCCCGTCATTGACTAGGCTTCTGCGCCGCTGCCTTTTCCGTGAGAGCTG
CAGGGAGCCTGACGCGGACTTTATTCGAGGCTTGGCCGATGCCGTCGACGTCGTCTCTACCAAGAGTCAGACCAT
GTACATGGGCAGTGCCATGTTTGAGGCGGCTCTGCGGATCGATCTAATTCTTCTGTGAGTGTTTCTTTAAGTATA
CAAGCCCAAGGGTTGACGATCCGTGAAGATATAATTTCTGCCGTGTTCTCGATGACGTTGTCGACGAAGCTGGCG
ATTTGGAGGCCGCGCGGAGCGCCGTTCAGACCTGCCGTCGAGCTCTGCGAGTCCGCTTCCAGCAGTCGACTGAAA
AGACGGCGGACGATTATCAGTTCGTCTCCGTGTCTCCAGCCCTTAGCTCCTCCATTGCGCTACTGCCGGTGTCAC
GGCTATCAATAGAGCCTCTCGACAGCCTACTGCTGGGTTTCGAGACGGACCTCGAATTCTCGCAGGCTGGTTCGG
GCAACGGAGATGGCTGGCCGATCGCCACGGAGAGGGATCTGGAGACGTACGCGTATCGTGTGGCTGGCACGGTGG
CGGCGTCGCTGCTCAGCTTGGTGCTGTATCACTACCCGCTCGACGACGATGATGGCCAGCAGCGACAGGGGACGA
CCGGCGATAATGATGATGATGATGATGATGATGGCAGGAGAGGAATCGTGACGGCCGGCGCCAAGATGGGTCAGG
CCCTTCAGTACGTCAATATCGCGCGCGACGTGGGCCGCGATGCAGCCATTGGACGCGTCTACCTGCCGCAGACAT
GGCTACGACAGGAAGGCCTGGACGCAGCCTCAGTGGTAGCGAGGCCGCGGGACGGACCGATGGCGAAGCTCCAGG
GCCGGATGCTCGACAAGGCCAAGCGGGCGTACCGGGCCACCGAGGCTGTCATGGACGAACTCCCCGTCGAGGTCA
GGGGCCCGATCCGCACGGTGGTTGAGAGCTACATGGCCATTGCGGGCTCGGTTCTGGCCGACGGGCTGCGGGAGA
AGGGGAAGCTGAAGCTGCCGTGGTGGCGGCGCCTGATTGTTGCCAGGAGAGCGATGGGCAGGGCAAAGGGGTGGT
AG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail