Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|894
Gene name
LocationContig_1312:458..2126
Strand-
Gene length (bp)1668
Transcript length (bp)1497
Coding sequence length (bp)1497
Protein length (aa) 499

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.6E-18 85 428
PF05978 UNC-93 Ion channel regulatory protein UNC-93 4.9E-15 75 424

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9URX1|YLX5_SCHPO UNC93-like protein C922.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC922.05c PE=3 SV=1 29 473 9.0E-142
sp|Q8LG53|UN932_ARATH UNC93-like protein 2 OS=Arabidopsis thaliana GN=At1g18010 PE=2 SV=2 38 465 6.0E-101
sp|Q56WD3|UN931_ARATH UNC93-like protein 1 OS=Arabidopsis thaliana GN=At1g18000 PE=2 SV=2 38 465 6.0E-101
sp|O14237|YEL4_SCHPO Uncharacterized membrane protein C6F6.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6F6.04c PE=4 SV=1 43 485 5.0E-51

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.5

Transmembrane Domains

Domain # Start End Length
1 50 72 22
2 85 102 17
3 107 129 22
4 136 158 22
5 173 192 19
6 205 224 19
7 261 278 17
8 299 321 22
9 326 348 22
10 379 401 22
11 440 462 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|894
MDAEKTAPGLAADERSSANGDGSLPRGILYRPVRVLGRKFWYASPKVQLLMVSLVCFLCPGMYNSLTGLGGGGQV
DATAQDHANVALYSTFAVVSFLSGSFANRLGLRLTLSIGGLGYCIYSASFLSYSHTGNVGFVIFAGAFLGLCAGL
LWTAQGAIMMSYPPENSKGRYISWFWIIFNLGAVIGSLIPLAENINKKAGPVTDGTYIAFIVLMFLGACLSLMLC
DADKVVRDDYTKVILMKNPSWSSELKGLWATLFNEPWILLLFPMFFASNFFYTYQNNGMNAAHFNTRTRALNNLL
YWLAQIFGAVVTGYCLDLHTIRRSLRARLAFGFLAILTFVIWGAGWHWQMQQVSRVVAESKDYHGLIDWTDGSRF
GGAMVLYFFYGFYDAIWQTCIYWFMGSLSNSGRKAANLAGFYKSIQSFGASIAYYMDGSKKEYNTIFGVTWGLLA
GSLVFALPVILYKIKDHVSVEEDLKFSDETIDDVIVGPGEKEKTHSGV*
Coding >Ophun1|894
ATGGACGCCGAGAAGACGGCTCCCGGCCTCGCCGCCGACGAGCGGTCGTCGGCCAACGGCGATGGCTCCCTTCCT
CGCGGCATCTTGTACCGTCCGGTTCGCGTTCTCGGCCGCAAGTTCTGGTACGCGTCGCCCAAGGTTCAGCTCTTG
ATGGTCTCGCTCGTCTGCTTCCTCTGCCCTGGCATGTACAATTCCCTCACCGGCCTCGGTGGCGGTGGTCAGGTC
GATGCCACGGCTCAGGATCACGCAAACGTTGCCCTCTACAGCACCTTTGCCGTCGTCAGCTTCCTGTCTGGCTCC
TTTGCCAATCGTCTCGGACTGCGTCTCACTCTATCCATTGGCGGCCTCGGCTACTGCATCTATAGCGCATCGTTC
CTCTCCTACTCTCACACTGGCAACGTTGGCTTCGTCATCTTTGCCGGCGCCTTTCTTGGTCTTTGCGCTGGCTTG
CTCTGGACCGCTCAGGGCGCCATCATGATGTCGTACCCGCCCGAGAACAGCAAGGGCCGCTACATCTCGTGGTTC
TGGATTATATTCAACCTCGGCGCCGTCATCGGCTCTCTGATCCCTCTCGCCGAAAATATCAACAAAAAGGCCGGC
CCCGTCACCGATGGCACCTACATCGCCTTCATCGTTCTCATGTTTCTCGGCGCCTGCCTCTCGCTCATGCTCTGT
GACGCAGACAAGGTCGTCCGCGATGACTACACCAAAGTCATTCTCATGAAGAACCCATCCTGGTCGAGTGAGCTC
AAGGGTCTCTGGGCCACCCTCTTCAACGAGCCCTGGATCCTCCTCCTCTTCCCCATGTTCTTCGCCTCCAACTTC
TTTTACACCTACCAGAACAACGGCATGAACGCGGCTCACTTCAACACCCGCACCCGCGCCCTCAACAATCTTCTC
TACTGGCTCGCCCAGATCTTCGGCGCCGTTGTTACAGGCTACTGCCTCGACCTGCACACCATTCGCCGCAGCCTC
CGCGCCAGGCTCGCCTTTGGCTTCCTCGCGATTCTCACCTTTGTAATCTGGGGCGCCGGTTGGCATTGGCAGATG
CAGCAAGTCTCCCGTGTCGTCGCAGAGAGCAAGGACTATCATGGGCTCATTGATTGGACCGACGGGAGCCGTTTC
GGTGGCGCCATGGTCCTCTACTTTTTCTACGGCTTTTACGACGCCATCTGGCAGACTTGCATCTACTGGTTCATG
GGATCTCTTTCTAATTCGGGCCGTAAGGCCGCCAATCTCGCCGGCTTCTACAAATCGATCCAGTCCTTCGGAGCC
AGCATCGCATACTACATGGACGGGAGCAAAAAGGAGTACAATACCATTTTCGGAGTTACCTGGGGCCTGTTGGCG
GGATCTCTAGTCTTCGCCCTCCCCGTCATTCTGTACAAGATCAAAGATCACGTGTCGGTCGAAGAAGATCTCAAG
TTCAGCGACGAGACCATTGACGATGTCATCGTCGGGCCTGGAGAGAAGGAGAAGACCCACTCGGGCGTCTGA
Transcript >Ophun1|894
ATGGACGCCGAGAAGACGGCTCCCGGCCTCGCCGCCGACGAGCGGTCGTCGGCCAACGGCGATGGCTCCCTTCCT
CGCGGCATCTTGTACCGTCCGGTTCGCGTTCTCGGCCGCAAGTTCTGGTACGCGTCGCCCAAGGTTCAGCTCTTG
ATGGTCTCGCTCGTCTGCTTCCTCTGCCCTGGCATGTACAATTCCCTCACCGGCCTCGGTGGCGGTGGTCAGGTC
GATGCCACGGCTCAGGATCACGCAAACGTTGCCCTCTACAGCACCTTTGCCGTCGTCAGCTTCCTGTCTGGCTCC
TTTGCCAATCGTCTCGGACTGCGTCTCACTCTATCCATTGGCGGCCTCGGCTACTGCATCTATAGCGCATCGTTC
CTCTCCTACTCTCACACTGGCAACGTTGGCTTCGTCATCTTTGCCGGCGCCTTTCTTGGTCTTTGCGCTGGCTTG
CTCTGGACCGCTCAGGGCGCCATCATGATGTCGTACCCGCCCGAGAACAGCAAGGGCCGCTACATCTCGTGGTTC
TGGATTATATTCAACCTCGGCGCCGTCATCGGCTCTCTGATCCCTCTCGCCGAAAATATCAACAAAAAGGCCGGC
CCCGTCACCGATGGCACCTACATCGCCTTCATCGTTCTCATGTTTCTCGGCGCCTGCCTCTCGCTCATGCTCTGT
GACGCAGACAAGGTCGTCCGCGATGACTACACCAAAGTCATTCTCATGAAGAACCCATCCTGGTCGAGTGAGCTC
AAGGGTCTCTGGGCCACCCTCTTCAACGAGCCCTGGATCCTCCTCCTCTTCCCCATGTTCTTCGCCTCCAACTTC
TTTTACACCTACCAGAACAACGGCATGAACGCGGCTCACTTCAACACCCGCACCCGCGCCCTCAACAATCTTCTC
TACTGGCTCGCCCAGATCTTCGGCGCCGTTGTTACAGGCTACTGCCTCGACCTGCACACCATTCGCCGCAGCCTC
CGCGCCAGGCTCGCCTTTGGCTTCCTCGCGATTCTCACCTTTGTAATCTGGGGCGCCGGTTGGCATTGGCAGATG
CAGCAAGTCTCCCGTGTCGTCGCAGAGAGCAAGGACTATCATGGGCTCATTGATTGGACCGACGGGAGCCGTTTC
GGTGGCGCCATGGTCCTCTACTTTTTCTACGGCTTTTACGACGCCATCTGGCAGACTTGCATCTACTGGTTCATG
GGATCTCTTTCTAATTCGGGCCGTAAGGCCGCCAATCTCGCCGGCTTCTACAAATCGATCCAGTCCTTCGGAGCC
AGCATCGCATACTACATGGACGGGAGCAAAAAGGAGTACAATACCATTTTCGGAGTTACCTGGGGCCTGTTGGCG
GGATCTCTAGTCTTCGCCCTCCCCGTCATTCTGTACAAGATCAAAGATCACGTGTCGGTCGAAGAAGATCTCAAG
TTCAGCGACGAGACCATTGACGATGTCATCGTCGGGCCTGGAGAGAAGGAGAAGACCCACTCGGGCGTCTGA
Gene >Ophun1|894
ATGGACGCCGAGAAGACGGCTCCCGGCCTCGCCGCCGACGAGCGGTCGTCGGCCAACGGCGATGGCTCCCTTCCT
CGCGGCATCTTGTACCGTCCGGTTCGCGTTCTCGGCCGCAAGTTCTGGTACGCGTCGCCCAAGGTTCAGCTCTTG
ATGGTCTCGCTCGTCTGCTTCCTCTGCCCTGGCATGTACAATTCCCTCACCGGCCTCGGTGGCGGTGGTCAGGTC
GATGCCACGGCTCAGGATCACGCAAACGTTGCCCTCTACAGCACCTTTGCCGTCGTCAGCTTCCTGTCTGGCTCC
TTTGCCAATCGTCTCGGACTGCGTCTCACTCTATCCATTGGCGGCCTCGGCTACTGCATCTATAGCGCATCGTTC
CTCTCCTACTCTCACACTGGCAACGTTGGCTTCGTCATCTTTGCCGGCGCCTTTCTTGGTCTTTGCGCTGGCTTG
CTCTGGACCGCTCAGGGCGCCATCATGATGTCGTACCCGCCCGAGAACAGCAAGGGCCGCTACATCTCGTGGTTC
TGGATTATATTCAACCTCGGCGCCGTCATCGGCTCTCTGGTTCGTCCTCTTGTCCTCTTCCTCGGTGTTTTTCCT
CTCTAACCCCCTCCAGATCCCTCTCGCCGAAAATATCAACAAAAAGGCCGGCCCCGTCACCGATGGCACCTACAT
CGCCTTCATCGTTCTCATGTTTCTCGGCGCCTGCCTCTCGCTCATGCTCTGTGACGCAGACAAGGTCGTCCGCGA
TGACTACACCAAAGTCATTCTCATGAAGAACCCATCCTGGTCGAGTGAGCTCAAGGGTCTCTGGGCCACCCTCTT
CAACGAGCCCTGGATCCTCCTCCTCTTCCCCATGTTCTTCGCCTCCAACTTCTTTTACACCTACCAGAACAACGG
CATGAACGCGGCTCACTTCAACACCCGCACCCGCGCCCTCAACAATCTTCTCTACTGGCTCGCCCAGATCTTCGG
CGCCGTTGTTACAGGCTACTGCCTCGACCTGCACACCATTCGCCGCAGCCTCCGCGCCAGGCTCGCCTTTGGCTT
CCTCGCGATTCTCACCTTTGTAATCTGGGGCGCCGGTTGGCATTGGCAGATGCAGCAAGTCTCCCGTGTCGTCGC
AGAGAGCAAGGACTATCATGGGCTCATTGATTGGACCGACGGGAGCCGTTTCGGTGGCGCCATGGTCCTCTACTT
TTTCTACGGCTTTTACGACGCCATCTGGCAGACTTGCATCTACTGGTACACCCACTCGTCATCTTTTCTCGTATC
TCGACATCATCTGACAGGAGCATAGGTTCATGGGATCTCTTTCTAATTCGGGCCGTAAGGCCGCCAATCTCGCCG
GTGAGTCGTGTCCGTCGCGATCAGGCTGCTGAAAGACGCTGACATGGTCTCTGTCTGCATGCAGGCTTCTACAAA
TCGATCCAGTCCTTCGGAGCCAGCATCGCATACTACATGGACGGGAGCAAAAAGGAGTACAATACCATTTTCGGA
GTTACCTGGGGCCTGTTGGCGGGATCTCTAGTCTTCGCCCTCCCCGTCATTCTGTACAAGATCAAAGATCACGTG
TCGGTCGAAGAAGATCTCAAGTTCAGCGACGAGACCATTGACGATGTCATCGTCGGGCCTGGAGAGAAGGAGAAG
ACCCACTCGGGCGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail