Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|885
Gene name
LocationContig_131:17814..19433
Strand-
Gene length (bp)1619
Transcript length (bp)1491
Coding sequence length (bp)1491
Protein length (aa) 497

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09431 SPIN90_LRD SPIN90/Ldb17, leucine-rich domain 1.4E-50 188 333

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74771|DIP1_SCHPO Protein dip1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dip1 PE=3 SV=2 63 371 7.0E-30
sp|Q12342|LDB17_YEAST Protein LDB17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LDB17 PE=1 SV=1 30 345 1.0E-28
sp|Q75A44|LDB17_ASHGO Protein LDB17 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LDB17 PE=3 SV=2 17 329 2.0E-22

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|885
MGDVDEPVLSPALAGSLWTELGVLLSSTCETHESIDDALRGWLDVATQLRVHAPYSQDDVAGCAQMLLESRLFQD
NKHYVRTQIIHSLLQEDDDGFLHAIVCLLLLDGQSDESTFPRMLDEACFARLLELLNTQRDVADPRLYQLLLQLL
YEMSRVQRIDADDLMLVQDDFVHCLFQDIEGDSNDAHDPYHYPTIRVLLVLNEQYMLASTDPATDVDAPSSPPPT
NRIVKCLSLHGPLFRTFGENIILLLNRETETALQLLILKLLYLLFTTKATHEYFYTNDLRVLVDVIIRNLMDLPD
EKNSLRHTYLRVMYPLLAYTQLSEPPHYKRDEVLRVLSILRGSDNAHFAPADETTLRLVDRVAKVGWLGGESNED
RESWDQAKVARKILGVSLSPSQYASSASVDDVAGVMERPGVQTPSRGHADDEAAVDTATPDQVAVAVKTKKPLPA
VPRHRHGIPVTQVDVNGERKRIPPKAPPPRRFGRMKDVQQPPGPYS*
Coding >Ophun1|885
ATGGGGGACGTCGATGAGCCCGTCCTTTCTCCCGCGCTCGCCGGAAGCTTGTGGACAGAGCTTGGCGTGCTCCTC
TCAAGCACTTGCGAAACTCACGAATCCATCGACGACGCGCTGCGAGGCTGGCTCGACGTCGCGACGCAGCTTCGC
GTCCACGCTCCCTACTCTCAGGACGATGTGGCGGGCTGCGCACAGATGCTACTGGAGAGCCGGCTCTTCCAAGAC
AACAAGCATTATGTCCGCACGCAAATCATCCACAGCCTCCTGCAAGAAGATGACGACGGATTCCTGCACGCCATC
GTCTGCCTGTTGCTGCTCGACGGCCAGAGTGACGAGTCGACCTTTCCTCGCATGTTGGACGAGGCCTGCTTCGCC
AGGCTCCTGGAACTACTGAATACGCAGCGCGACGTTGCCGACCCGCGCCTATACCAATTGCTGTTGCAACTTTTG
TACGAGATGTCACGCGTGCAGCGCATCGATGCCGACGACTTGATGCTTGTCCAAGATGACTTCGTCCACTGCCTC
TTCCAAGACATCGAGGGCGACTCAAATGATGCGCACGATCCGTACCACTATCCCACCATCAGAGTTCTACTCGTC
TTGAACGAACAATATATGCTGGCATCTACCGACCCAGCCACGGATGTTGATGCCCCGTCCTCGCCGCCGCCGACG
AACCGCATCGTCAAGTGCCTCAGCTTGCACGGCCCGCTCTTTCGTACCTTTGGGGAGAACATCATCTTACTGCTG
AATCGTGAGACTGAGACGGCACTTCAACTGCTGATACTGAAACTCCTCTACCTGCTTTTCACAACAAAGGCCACT
CACGAGTACTTTTACACCAATGATCTGCGCGTTCTCGTCGACGTCATCATCCGAAACCTCATGGACTTGCCGGAC
GAAAAGAATTCGCTGCGTCACACGTACCTGAGGGTCATGTATCCGCTGCTGGCTTACACGCAGCTCAGCGAGCCG
CCGCATTACAAGAGAGACGAGGTACTGCGTGTCCTGAGTATACTGCGCGGCTCCGACAATGCCCACTTCGCGCCG
GCAGACGAAACGACGCTGCGTCTGGTCGACAGGGTGGCCAAGGTCGGCTGGTTGGGAGGGGAATCCAACGAGGAT
AGGGAATCATGGGACCAGGCCAAGGTGGCGCGTAAAATTCTCGGCGTCAGTCTTTCACCGTCGCAGTACGCGAGC
AGCGCTAGCGTCGATGATGTCGCGGGTGTGATGGAGAGGCCAGGCGTACAGACACCGAGCCGCGGTCATGCGGAT
GATGAAGCAGCCGTCGACACCGCAACGCCCGACCAGGTAGCGGTAGCCGTCAAGACGAAGAAGCCCCTGCCGGCC
GTGCCAAGACACAGACACGGCATCCCGGTGACGCAGGTGGACGTCAACGGCGAGAGGAAGCGAATACCACCCAAG
GCGCCACCGCCGCGTCGTTTCGGCAGGATGAAGGATGTTCAGCAACCTCCGGGCCCCTATTCCTGA
Transcript >Ophun1|885
ATGGGGGACGTCGATGAGCCCGTCCTTTCTCCCGCGCTCGCCGGAAGCTTGTGGACAGAGCTTGGCGTGCTCCTC
TCAAGCACTTGCGAAACTCACGAATCCATCGACGACGCGCTGCGAGGCTGGCTCGACGTCGCGACGCAGCTTCGC
GTCCACGCTCCCTACTCTCAGGACGATGTGGCGGGCTGCGCACAGATGCTACTGGAGAGCCGGCTCTTCCAAGAC
AACAAGCATTATGTCCGCACGCAAATCATCCACAGCCTCCTGCAAGAAGATGACGACGGATTCCTGCACGCCATC
GTCTGCCTGTTGCTGCTCGACGGCCAGAGTGACGAGTCGACCTTTCCTCGCATGTTGGACGAGGCCTGCTTCGCC
AGGCTCCTGGAACTACTGAATACGCAGCGCGACGTTGCCGACCCGCGCCTATACCAATTGCTGTTGCAACTTTTG
TACGAGATGTCACGCGTGCAGCGCATCGATGCCGACGACTTGATGCTTGTCCAAGATGACTTCGTCCACTGCCTC
TTCCAAGACATCGAGGGCGACTCAAATGATGCGCACGATCCGTACCACTATCCCACCATCAGAGTTCTACTCGTC
TTGAACGAACAATATATGCTGGCATCTACCGACCCAGCCACGGATGTTGATGCCCCGTCCTCGCCGCCGCCGACG
AACCGCATCGTCAAGTGCCTCAGCTTGCACGGCCCGCTCTTTCGTACCTTTGGGGAGAACATCATCTTACTGCTG
AATCGTGAGACTGAGACGGCACTTCAACTGCTGATACTGAAACTCCTCTACCTGCTTTTCACAACAAAGGCCACT
CACGAGTACTTTTACACCAATGATCTGCGCGTTCTCGTCGACGTCATCATCCGAAACCTCATGGACTTGCCGGAC
GAAAAGAATTCGCTGCGTCACACGTACCTGAGGGTCATGTATCCGCTGCTGGCTTACACGCAGCTCAGCGAGCCG
CCGCATTACAAGAGAGACGAGGTACTGCGTGTCCTGAGTATACTGCGCGGCTCCGACAATGCCCACTTCGCGCCG
GCAGACGAAACGACGCTGCGTCTGGTCGACAGGGTGGCCAAGGTCGGCTGGTTGGGAGGGGAATCCAACGAGGAT
AGGGAATCATGGGACCAGGCCAAGGTGGCGCGTAAAATTCTCGGCGTCAGTCTTTCACCGTCGCAGTACGCGAGC
AGCGCTAGCGTCGATGATGTCGCGGGTGTGATGGAGAGGCCAGGCGTACAGACACCGAGCCGCGGTCATGCGGAT
GATGAAGCAGCCGTCGACACCGCAACGCCCGACCAGGTAGCGGTAGCCGTCAAGACGAAGAAGCCCCTGCCGGCC
GTGCCAAGACACAGACACGGCATCCCGGTGACGCAGGTGGACGTCAACGGCGAGAGGAAGCGAATACCACCCAAG
GCGCCACCGCCGCGTCGTTTCGGCAGGATGAAGGATGTTCAGCAACCTCCGGGCCCCTATTCCTGA
Gene >Ophun1|885
ATGGGGGACGTCGATGAGCCCGTCCTTTCTCCCGCGCTCGCCGGAAGCTTGTGGACAGGTGCGTCGGCAAAAGTC
CACTTGCCTCGAGACAATTGGCCGAGCTGACCACAATCTCGGCAGAGCTTGGCGTGCTCCTCTCAAGCACTTGCG
AAACTCACGAATCCATCGACGACGCGCTGCGAGGCTGGCTCGACGTCGCGACGCAGCTTCGCGTCCACGCTCCCT
ACTCTCAGGACGATGTGGCGGGCTGCGCACAGATGCTACTGGAGAGCCGGCTCTTCCAAGACAACAAGCATTATG
TCCGCACGCAAATCATCCACAGCCTCCTGCAAGAAGATGACGACGGATTCCTGCACGCCATCGTCTGCCTGTTGC
TGCTCGACGGCCAGAGTGACGAGTCGACCTTTCCTCGCATGTTGGACGAGGCCTGCTTCGCCAGGCTCCTGGAAC
TACTGAATACGCAGCGCGACGTTGCCGACCCGCGCCTATACCAATTGCTGTTGCAACTTTTGTACGAGATGTCAC
GCGTGCAGCGCATCGATGCCGACGACTTGATGCTTGTCCAAGATGACTTCGTCCACTGCCTCTTCCAAGACATCG
AGGGCGACTCAAATGATGCGCACGATCCGTACCACTATCCCACCATCAGAGTTCTAGTAAGTCGGTCGGCGGGGG
GAAGCTGATACCGACATGCTTGATGAATGCTGACGAATGCGCGGCAGCTCGTCTTGAACGAACAATATATGCTGG
CATCTACCGACCCAGCCACGGATGTTGATGCCCCGTCCTCGCCGCCGCCGACGAACCGCATCGTCAAGTGCCTCA
GCTTGCACGGCCCGCTCTTTCGTACCTTTGGGGAGAACATCATCTTACTGCTGAATCGTGAGACTGAGACGGCAC
TTCAACTGCTGATACTGAAACTCCTCTACCTGCTTTTCACAACAAAGGCCACTCACGAGTACTTTTACACCAATG
ATCTGCGCGTTCTCGTCGACGTCATCATCCGAAACCTCATGGACTTGCCGGACGAAAAGAATTCGCTGCGTCACA
CGTACCTGAGGGTCATGTATCCGCTGCTGGCTTACACGCAGCTCAGCGAGCCGCCGCATTACAAGAGAGACGAGG
TACTGCGTGTCCTGAGTATACTGCGCGGCTCCGACAATGCCCACTTCGCGCCGGCAGACGAAACGACGCTGCGTC
TGGTCGACAGGGTGGCCAAGGTCGGCTGGTTGGGAGGGGAATCCAACGAGGATAGGGAATCATGGGACCAGGCCA
AGGTGGCGCGTAAAATTCTCGGCGTCAGTCTTTCACCGTCGCAGTACGCGAGCAGCGCTAGCGTCGATGATGTCG
CGGGTGTGATGGAGAGGCCAGGCGTACAGACACCGAGCCGCGGTCATGCGGATGATGAAGCAGCCGTCGACACCG
CAACGCCCGACCAGGTAGCGGTAGCCGTCAAGACGAAGAAGCCCCTGCCGGCCGTGCCAAGACACAGACACGGCA
TCCCGGTGACGCAGGTGGACGTCAACGGCGAGAGGAAGCGAATACCACCCAAGGCGCCACCGCCGCGTCGTTTCG
GCAGGATGAAGGATGTTCAGCAACCTCCGGGCCCCTATTCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail