Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|874
Gene name
LocationContig_1301:733..2981
Strand+
Gene length (bp)2248
Transcript length (bp)2070
Coding sequence length (bp)2070
Protein length (aa) 690

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03828 PAP_assoc Cid1 family poly A polymerase 4.2E-17 512 565
PF01909 NTP_transf_2 Nucleotidyltransferase domain 1.4E-05 316 404

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT49|CID13_SCHPO Poly(A) RNA polymerase cid13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cid13 PE=1 SV=1 246 613 4.0E-110
sp|O74326|CID11_SCHPO Poly(A) RNA polymerase cid11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cid11 PE=3 SV=1 245 605 1.0E-86
sp|O64642|URT1_ARATH UTP:RNA uridylyltransferase 1 OS=Arabidopsis thaliana GN=URT1 PE=1 SV=2 289 598 2.0E-63
sp|B2RX14|TUT4_MOUSE Terminal uridylyltransferase 4 OS=Mus musculus GN=Zcchc11 PE=1 SV=2 298 569 2.0E-44
sp|Q5TAX3|TUT4_HUMAN Terminal uridylyltransferase 4 OS=Homo sapiens GN=ZCCHC11 PE=1 SV=3 298 569 3.0E-44
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT49|CID13_SCHPO Poly(A) RNA polymerase cid13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cid13 PE=1 SV=1 246 613 4.0E-110
sp|O74326|CID11_SCHPO Poly(A) RNA polymerase cid11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cid11 PE=3 SV=1 245 605 1.0E-86
sp|O64642|URT1_ARATH UTP:RNA uridylyltransferase 1 OS=Arabidopsis thaliana GN=URT1 PE=1 SV=2 289 598 2.0E-63
sp|B2RX14|TUT4_MOUSE Terminal uridylyltransferase 4 OS=Mus musculus GN=Zcchc11 PE=1 SV=2 298 569 2.0E-44
sp|Q5TAX3|TUT4_HUMAN Terminal uridylyltransferase 4 OS=Homo sapiens GN=ZCCHC11 PE=1 SV=3 298 569 3.0E-44
sp|Q5VYS8|TUT7_HUMAN Terminal uridylyltransferase 7 OS=Homo sapiens GN=ZCCHC6 PE=1 SV=1 303 569 3.0E-41
sp|Q5BLK4|TUT7_MOUSE Terminal uridylyltransferase 7 OS=Mus musculus GN=Zcchc6 PE=1 SV=3 303 569 1.0E-39
sp|Q503I9|GLD2_DANRE Poly(A) RNA polymerase GLD2 OS=Danio rerio GN=papd4 PE=2 SV=1 305 621 2.0E-33
sp|Q641A1|GLD2A_XENLA Poly(A) RNA polymerase GLD2-A OS=Xenopus laevis GN=papd4-a PE=1 SV=1 332 588 4.0E-32
sp|Q6DFA8|GLD2B_XENLA Poly(A) RNA polymerase GLD2-B OS=Xenopus laevis GN=papd4-b PE=1 SV=1 332 588 2.0E-31
sp|Q0VFA3|GLD2_XENTR Poly(A) RNA polymerase GLD2 OS=Xenopus tropicalis GN=papd4 PE=2 SV=1 332 588 2.0E-30
sp|Q5U315|GLD2_RAT Poly(A) RNA polymerase GLD2 OS=Rattus norvegicus GN=Papd4 PE=2 SV=1 332 596 2.0E-30
sp|Q91YI6|GLD2_MOUSE Poly(A) RNA polymerase GLD2 OS=Mus musculus GN=Papd4 PE=1 SV=1 332 596 2.0E-30
sp|Q6PIY7|GLD2_HUMAN Poly(A) RNA polymerase GLD2 OS=Homo sapiens GN=PAPD4 PE=1 SV=1 332 596 4.0E-29
sp|Q2HJ44|GLD2_BOVIN Poly(A) RNA polymerase GLD2 OS=Bos taurus GN=PAPD4 PE=2 SV=1 332 596 7.0E-29
sp|Q9VD44|GLD2A_DROME Poly(A) RNA polymerase gld-2 homolog A OS=Drosophila melanogaster GN=Gld2 PE=1 SV=3 304 578 2.0E-28
sp|O13833|CID1_SCHPO Poly(A) RNA polymerase protein cid1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cid1 PE=1 SV=2 336 579 6.0E-27
sp|O17087|GLD2_CAEEL Poly(A) RNA polymerase gld-2 OS=Caenorhabditis elegans GN=gld-2 PE=1 SV=2 334 544 2.0E-25
sp|Q9VYS4|GLD2B_DROME Poly(A) RNA polymerase gld-2 homolog B OS=Drosophila melanogaster GN=wisp PE=1 SV=1 332 596 1.0E-22
sp|Q4KMD7|STPAP_DANRE Speckle targeted PIP5K1A-regulated poly(A) polymerase OS=Danio rerio GN=tut1 PE=2 SV=1 348 545 2.0E-20
sp|O13798|CID16_SCHPO Caffeine-induced protein 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cid16 PE=4 SV=1 331 595 2.0E-19
sp|Q9D0D3|PAPD1_MOUSE Poly(A) RNA polymerase, mitochondrial OS=Mus musculus GN=Mtpap PE=1 SV=1 375 568 2.0E-19
sp|Q9NVV4|PAPD1_HUMAN Poly(A) RNA polymerase, mitochondrial OS=Homo sapiens GN=MTPAP PE=1 SV=1 375 568 5.0E-19
sp|D2HS90|STPAP_AILME Speckle targeted PIP5K1A-regulated poly(A) polymerase OS=Ailuropoda melanoleuca GN=TUT1 PE=3 SV=1 350 568 1.0E-17
sp|Q5XG87|PAPD7_HUMAN Non-canonical poly(A) RNA polymerase PAPD7 OS=Homo sapiens GN=PAPD7 PE=1 SV=3 297 589 1.0E-17
sp|Q9UTN3|CID14_SCHPO Poly(A) RNA polymerase cid14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cid14 PE=1 SV=2 288 592 3.0E-17
sp|Q5BLK4|TUT7_MOUSE Terminal uridylyltransferase 7 OS=Mus musculus GN=Zcchc6 PE=1 SV=3 318 574 5.0E-17
sp|A9JTS5|STPAP_XENTR Speckle targeted PIP5K1A-regulated poly(A) polymerase OS=Xenopus tropicalis GN=tut1 PE=2 SV=1 310 533 5.0E-17
sp|Q6PB75|PAPD7_MOUSE Non-canonical poly(A) RNA polymerase PAPD7 OS=Mus musculus GN=Papd7 PE=2 SV=2 303 589 1.0E-16
sp|Q9H6E5|STPAP_HUMAN Speckle targeted PIP5K1A-regulated poly(A) polymerase OS=Homo sapiens GN=TUT1 PE=1 SV=2 375 568 1.0E-16
sp|Q1JPD6|STPAP_BOVIN Speckle targeted PIP5K1A-regulated poly(A) polymerase OS=Bos taurus GN=TUT1 PE=2 SV=1 375 544 2.0E-16
sp|P53632|PAP2_YEAST Poly(A) RNA polymerase protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAP2 PE=1 SV=1 305 592 2.0E-16
sp|Q3MHT4|STPAP_RAT Speckle targeted PIP5K1A-regulated poly(A) polymerase OS=Rattus norvegicus GN=Tut1 PE=1 SV=1 375 568 5.0E-15
sp|Q9HFW3|TRF5_ASHGO Poly(A) RNA polymerase protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TRF5 PE=3 SV=1 311 592 5.0E-14
sp|P48561|TRF5_YEAST Poly(A) RNA polymerase protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRF5 PE=1 SV=2 311 538 6.0E-14
sp|Q5VYS8|TUT7_HUMAN Terminal uridylyltransferase 7 OS=Homo sapiens GN=ZCCHC6 PE=1 SV=1 318 573 2.0E-13
sp|Q68ED3|PAPD5_MOUSE Non-canonical poly(A) RNA polymerase PAPD5 OS=Mus musculus GN=Papd5 PE=1 SV=2 297 589 7.0E-13
sp|Q8NDF8|PAPD5_HUMAN Non-canonical poly(A) RNA polymerase PAPD5 OS=Homo sapiens GN=PAPD5 PE=1 SV=2 297 589 2.0E-12
sp|Q8R3F9|STPAP_MOUSE Speckle targeted PIP5K1A-regulated poly(A) polymerase OS=Mus musculus GN=Tut1 PE=1 SV=1 375 519 6.0E-12
sp|G5EFL0|GLD4_CAEEL Poly(A) RNA polymerase gld-4 OS=Caenorhabditis elegans GN=gld-4 PE=1 SV=1 248 591 2.0E-11
sp|Q5TAX3|TUT4_HUMAN Terminal uridylyltransferase 4 OS=Homo sapiens GN=ZCCHC11 PE=1 SV=3 311 476 6.0E-10
sp|Q5XET5|HESO1_ARATH Protein HESO1 OS=Arabidopsis thaliana GN=HESO1 PE=1 SV=1 290 594 1.0E-09
sp|B2RX14|TUT4_MOUSE Terminal uridylyltransferase 4 OS=Mus musculus GN=Zcchc11 PE=1 SV=2 311 476 3.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0016779 nucleotidyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup636
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|108
Ophiocordyceps australis map64 (Brazil) OphauB2|4818
Ophiocordyceps camponoti-floridani Ophcf2|03880
Ophiocordyceps camponoti-rufipedis Ophun1|874 (this protein)
Ophiocordyceps kimflemingae Ophio5|1627
Ophiocordyceps subramaniannii Hirsu2|10326

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|874
MDGRASTSEHHHPYHHPASWSAATPPAASSSSSTASFPLTTAYDASSVSSSSSSYHFIPLLFPHQSDIYHAQLLD
YNKLVSPTRGGGLQAAPLPPAVSAHHVHAGPRSRSSSRVSLKDGGHGSRSHPTHDKSRPAMTTKDAPANMSAERH
HHHHHHHHHHHQAAAEPPRSVPKRSTAAAATAPTFAIQGQSHSSSVPSTPHQHARQFSFESRDPSPTVPNSHSPR
SAYSESNSTLPYLRPLPPRFGGCKFETAQMNSRRRIPYSVGNDRLDRLDPRNVKSKLTDDEERRLAADMRLLFDR
LLPTEAVEANRRKLVAKLETIFNDEWPGHDIRAHLFGSSGNLLCSDDSDVDICITTSWKELEGVCMIADLLARRG
MQKVVCISAAKVPIVKIWDPELGLACDMNVNNTLALENTRMVRTYVEADPRVRQLAMVIKYWTRRRIVNDAAFGG
TLSSYTWICLIIAFLQQRNPPVLPALHQLPYKLSKSDGSISDFADNLKKIRGFGNKNKSSVPDLLFQFFRFYAHE
FDYDKHVLSVRQGKLVTKADKKWTYQINNQLCVEEPFNVTRNLGNTADDYAFRGLHLELRRAFDLISEAKLTEAC
EQYVYPKEEERIFNRPAQQPRPALLRSSSQTQGNRGGRGGHRGGRHLGPLFRGGGTARGGKYKQTGLVETAHINI
SEPTKIKRISKAAI*
Coding >Ophun1|874
ATGGACGGCCGGGCCTCGACGTCGGAGCATCATCATCCCTATCATCATCCGGCCTCGTGGTCTGCTGCCACTCCG
CCAGCGGCATCGTCTTCCTCGTCGACAGCCTCGTTTCCGTTGACGACGGCCTACGACGCCTCTTCGGTGTCGTCG
TCGTCGTCGTCATACCACTTTATCCCCTTGCTGTTCCCTCACCAGTCCGACATCTATCACGCACAGCTCCTCGAT
TACAACAAGCTCGTCTCGCCCACCCGCGGAGGTGGTCTTCAGGCCGCCCCCTTGCCTCCCGCCGTGTCGGCCCAC
CACGTCCACGCCGGACCGAGGTCGCGCTCGTCCAGCAGGGTCTCGCTCAAGGACGGAGGCCATGGGAGCAGGTCG
CATCCGACCCACGACAAGAGCCGTCCGGCTATGACGACAAAGGACGCTCCCGCCAACATGTCGGCCGAGCGGCAT
CATCACCACCACCACCACCATCATCATCATCATCAGGCCGCCGCCGAGCCCCCGAGGAGCGTCCCCAAGCGGTCC
ACGGCCGCAGCCGCCACCGCCCCCACGTTCGCCATTCAGGGCCAGTCCCATTCCAGTTCGGTCCCCTCGACGCCT
CACCAGCACGCCCGCCAGTTCTCCTTCGAGTCCCGCGATCCCTCTCCCACCGTCCCCAACAGCCACTCGCCACGC
TCCGCCTACTCCGAATCCAACAGCACCTTGCCCTACCTGCGGCCTCTGCCCCCCCGCTTCGGCGGCTGCAAGTTC
GAGACGGCCCAGATGAATTCGAGGCGCCGCATACCCTACTCCGTCGGCAACGATCGCCTCGACCGTCTCGATCCA
CGCAATGTCAAGTCCAAGCTCACCGACGACGAGGAGCGGAGGTTGGCCGCCGACATGCGCCTCCTCTTTGATCGC
CTCTTGCCCACCGAGGCCGTCGAGGCTAACCGCCGGAAGCTCGTCGCCAAGTTGGAGACGATATTCAATGATGAG
TGGCCGGGACACGACATACGTGCACATCTCTTTGGCTCGTCTGGTAACCTGCTGTGTTCGGACGACTCGGATGTC
GACATTTGCATCACGACGTCTTGGAAAGAGCTTGAGGGTGTCTGTATGATTGCCGATCTGCTCGCCCGCCGCGGT
ATGCAAAAGGTGGTGTGCATCTCTGCCGCCAAGGTGCCCATTGTCAAGATCTGGGATCCTGAGCTGGGGCTCGCC
TGCGACATGAACGTCAACAACACGCTCGCCCTCGAGAATACGCGCATGGTTCGGACGTACGTCGAGGCCGATCCC
CGCGTGCGCCAGCTGGCCATGGTCATCAAGTACTGGACCAGGAGGCGGATAGTCAACGATGCCGCATTCGGCGGC
ACGCTGAGCTCGTACACGTGGATCTGCCTCATCATCGCCTTTCTCCAGCAGCGGAATCCGCCCGTGTTGCCGGCG
CTGCACCAGCTCCCGTACAAGCTCTCCAAGTCGGACGGCTCCATAAGCGACTTTGCCGATAACCTCAAGAAGATC
AGGGGCTTCGGCAACAAGAACAAGTCGTCGGTGCCGGACCTGCTTTTCCAATTCTTCCGCTTCTACGCGCACGAG
TTCGATTACGACAAGCACGTCCTCTCCGTCCGCCAGGGCAAACTCGTCACAAAGGCCGACAAGAAGTGGACCTAT
CAGATCAACAATCAGCTCTGCGTCGAGGAGCCCTTTAACGTGACGCGAAATTTGGGCAACACGGCCGACGACTAT
GCGTTTCGAGGCCTGCATCTCGAGCTGCGTCGGGCCTTTGATCTCATCTCCGAGGCCAAGTTGACGGAGGCGTGC
GAGCAGTACGTCTACCCCAAGGAGGAGGAGAGGATATTCAACCGTCCGGCGCAGCAGCCCCGTCCCGCCCTCCTG
CGCAGCTCGTCGCAGACGCAGGGGAACCGGGGCGGACGGGGAGGCCACCGGGGGGGTCGTCATTTGGGACCGTTG
TTCCGCGGCGGGGGGACGGCCCGCGGCGGCAAATACAAACAGACGGGCCTCGTCGAGACGGCTCATATAAACATC
TCCGAGCCCACGAAAATAAAGCGAATATCGAAAGCAGCCATCTGA
Transcript >Ophun1|874
ATGGACGGCCGGGCCTCGACGTCGGAGCATCATCATCCCTATCATCATCCGGCCTCGTGGTCTGCTGCCACTCCG
CCAGCGGCATCGTCTTCCTCGTCGACAGCCTCGTTTCCGTTGACGACGGCCTACGACGCCTCTTCGGTGTCGTCG
TCGTCGTCGTCATACCACTTTATCCCCTTGCTGTTCCCTCACCAGTCCGACATCTATCACGCACAGCTCCTCGAT
TACAACAAGCTCGTCTCGCCCACCCGCGGAGGTGGTCTTCAGGCCGCCCCCTTGCCTCCCGCCGTGTCGGCCCAC
CACGTCCACGCCGGACCGAGGTCGCGCTCGTCCAGCAGGGTCTCGCTCAAGGACGGAGGCCATGGGAGCAGGTCG
CATCCGACCCACGACAAGAGCCGTCCGGCTATGACGACAAAGGACGCTCCCGCCAACATGTCGGCCGAGCGGCAT
CATCACCACCACCACCACCATCATCATCATCATCAGGCCGCCGCCGAGCCCCCGAGGAGCGTCCCCAAGCGGTCC
ACGGCCGCAGCCGCCACCGCCCCCACGTTCGCCATTCAGGGCCAGTCCCATTCCAGTTCGGTCCCCTCGACGCCT
CACCAGCACGCCCGCCAGTTCTCCTTCGAGTCCCGCGATCCCTCTCCCACCGTCCCCAACAGCCACTCGCCACGC
TCCGCCTACTCCGAATCCAACAGCACCTTGCCCTACCTGCGGCCTCTGCCCCCCCGCTTCGGCGGCTGCAAGTTC
GAGACGGCCCAGATGAATTCGAGGCGCCGCATACCCTACTCCGTCGGCAACGATCGCCTCGACCGTCTCGATCCA
CGCAATGTCAAGTCCAAGCTCACCGACGACGAGGAGCGGAGGTTGGCCGCCGACATGCGCCTCCTCTTTGATCGC
CTCTTGCCCACCGAGGCCGTCGAGGCTAACCGCCGGAAGCTCGTCGCCAAGTTGGAGACGATATTCAATGATGAG
TGGCCGGGACACGACATACGTGCACATCTCTTTGGCTCGTCTGGTAACCTGCTGTGTTCGGACGACTCGGATGTC
GACATTTGCATCACGACGTCTTGGAAAGAGCTTGAGGGTGTCTGTATGATTGCCGATCTGCTCGCCCGCCGCGGT
ATGCAAAAGGTGGTGTGCATCTCTGCCGCCAAGGTGCCCATTGTCAAGATCTGGGATCCTGAGCTGGGGCTCGCC
TGCGACATGAACGTCAACAACACGCTCGCCCTCGAGAATACGCGCATGGTTCGGACGTACGTCGAGGCCGATCCC
CGCGTGCGCCAGCTGGCCATGGTCATCAAGTACTGGACCAGGAGGCGGATAGTCAACGATGCCGCATTCGGCGGC
ACGCTGAGCTCGTACACGTGGATCTGCCTCATCATCGCCTTTCTCCAGCAGCGGAATCCGCCCGTGTTGCCGGCG
CTGCACCAGCTCCCGTACAAGCTCTCCAAGTCGGACGGCTCCATAAGCGACTTTGCCGATAACCTCAAGAAGATC
AGGGGCTTCGGCAACAAGAACAAGTCGTCGGTGCCGGACCTGCTTTTCCAATTCTTCCGCTTCTACGCGCACGAG
TTCGATTACGACAAGCACGTCCTCTCCGTCCGCCAGGGCAAACTCGTCACAAAGGCCGACAAGAAGTGGACCTAT
CAGATCAACAATCAGCTCTGCGTCGAGGAGCCCTTTAACGTGACGCGAAATTTGGGCAACACGGCCGACGACTAT
GCGTTTCGAGGCCTGCATCTCGAGCTGCGTCGGGCCTTTGATCTCATCTCCGAGGCCAAGTTGACGGAGGCGTGC
GAGCAGTACGTCTACCCCAAGGAGGAGGAGAGGATATTCAACCGTCCGGCGCAGCAGCCCCGTCCCGCCCTCCTG
CGCAGCTCGTCGCAGACGCAGGGGAACCGGGGCGGACGGGGAGGCCACCGGGGGGGTCGTCATTTGGGACCGTTG
TTCCGCGGCGGGGGGACGGCCCGCGGCGGCAAATACAAACAGACGGGCCTCGTCGAGACGGCTCATATAAACATC
TCCGAGCCCACGAAAATAAAGCGAATATCGAAAGCAGCCATCTGA
Gene >Ophun1|874
ATGGACGGCCGGGCCTCGACGTCGGAGCATCATCATCCCTATCATCATCCGGCCTCGTGGTCTGCTGCCACTCCG
CCAGCGGCATCGTCTTCCTCGTCGACAGCCTCGTTTCCGTTGACGACGGCCTACGACGCCTCTTCGGTGTCGTCG
TCGTCGTCGTCATACCACTTTATCCCCTTGCTGTTCCCTCACCAGTCCGACATCTATCACGCACAGCTCCTCGAT
TACAACAAGCTCGTCTCGCCCACCCGCGGAGGTGGTCTTCAGGCCGCCCCCTTGCCTCCCGCCGTGTCGGCCCAC
CACGTCCACGCCGGACCGAGGTCGCGCTCGTCCAGCAGGGTCTCGCTCAAGGACGGAGGCCATGGGAGCAGGTCG
CATCCGACCCACGACAAGAGCCGTCCGGCTATGACGACAAAGGACGCTCCCGCCAACATGTCGGCCGAGCGGCAT
CATCACCACCACCACCACCATCATCATCATCATCAGGCCGCCGCCGAGCCCCCGAGGAGCGTCCCCAAGCGGTCC
ACGGCCGCAGCCGCCACCGCCCCCACGTTCGCCATTCAGGGCCAGTCCCATTCCAGTTCGGTCCCCTCGACGCCT
CACCAGCACGCCCGCCAGTTCTCCTTCGAGTCCCGCGATCCCTCTCCCACCGTCCCCAACAGCCACTCGCCACGC
TCCGCCTACTCCGAATCCAACAGCACCTTGCCCTACCTGCGGCCTCTGCCCCCCCGCTTCGGCGGCTGCAAGTTC
GAGACGGCCCAGATGAATTCGAGGCGCCGCATACCCTACTCCGTCGGCAACGATCGCCTCGACCGTCTCGATCCA
CGCAATGTCAAGTCCAAGCTCACCGACGACGAGGAGCGGAGGTTGGCCGCCGACATGCGCCTCCTCTTTGATCGC
CTCTTGCCCACCGAGGCCGTCGAGGCTAACCGCCGGAAGCTCGTCGCCAAGTTGGAGACGATATTCAATGATGAG
TGGCCGGGACACGACATACGTGCACATCTCTTTGGCTCGTCTGGTAACCTGCTGTGTTCGGACGACTCGGATGGT
TTGTCAATTCATCTGATGTGTGGCAAAAGAAGAGCGCTGACTAGTGAGAGTAGTCGACATTTGCATCACGACGTC
TTGGAAAGAGCTTGAGGGTGTCTGTATGATTGCCGATCTGCTCGCCCGCCGTACGTTTTCCCCCACTCCTTTCAG
CCGAGGATTCTTGAGTCGGCTGACTTGTCAATTCCCTCGCAGGCGGTATGCAAAAGGTGGTGTGCATCTCTGCCG
CCAAGGTGCCCATTGTCAAGATCTGGGATCCTGAGCTGGGGCTCGCCTGCGACATGAACGTCAACAACACGCTCG
CCCTCGAGAATACGCGCATGGTTCGGACGTACGTCGAGGCCGATCCCCGCGTGCGCCAGCTGGCCATGGTCATCA
AGTACTGGACCAGGAGGCGGATAGTCAACGATGCCGGTAAGGTCCCCATCTCCCTTTTGGTGGCCCCTCATGGCT
GATGATATCGTCGTCAGCATTCGGCGGCACGCTGAGCTCGTACACGTGGATCTGCCTCATCATCGCCTTTCTCCA
GCAGCGGAATCCGCCCGTGTTGCCGGCGCTGCACCAGCTCCCGTACAAGCTCTCCAAGTCGGACGGCTCCATAAG
CGACTTTGCCGATAACCTCAAGAAGATCAGGGGCTTCGGCAACAAGAACAAGTCGTCGGTGCCGGACCTGCTTTT
CCAATTCTTCCGCTTCTACGCGCACGAGTTCGATTACGACAAGCACGTCCTCTCCGTCCGCCAGGGCAAACTCGT
CACAAAGGCCGACAAGAAGTGGACCTATCAGATCAACAATCAGCTCTGCGTCGAGGAGCCCTTTAACGTGACGCG
AAATTTGGGCAACACGGCCGACGACTATGCGTTTCGAGGCCTGCATCTCGAGCTGCGTCGGGCCTTTGATCTCAT
CTCCGAGGCCAAGTTGACGGAGGCGTGCGAGCAGTACGTCTACCCCAAGGAGGAGGAGAGGATATTCAACCGTCC
GGCGCAGCAGCCCCGTCCCGCCCTCCTGCGCAGCTCGTCGCAGACGCAGGGGAACCGGGGCGGACGGGGAGGCCA
CCGGGGGGGTCGTCATTTGGGACCGTTGTTCCGCGGCGGGGGGACGGCCCGCGGCGGCAAATACAAACAGACGGG
CCTCGTCGAGACGGCTCATATAAACATCTCCGAGCCCACGAAAATAAAGCGAATATCGAAAGCAGCCATCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail