Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|87
Gene name
LocationContig_10:74318..76584
Strand-
Gene length (bp)2266
Transcript length (bp)2151
Coding sequence length (bp)2151
Protein length (aa) 717

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00009 GTP_EFTU Elongation factor Tu GTP binding domain 1.6E-41 282 501
PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain 2.4E-21 602 710
PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2 3.3E-07 526 594

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HGI6|ERF3_DEBHA Eukaryotic peptide chain release factor GTP-binding subunit OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SUP35 PE=3 SV=4 188 711 0.0E+00
sp|O74718|ERF3_SCHPO Eukaryotic peptide chain release factor GTP-binding subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sup35 PE=1 SV=2 14 711 0.0E+00
sp|O13354|ERF3_CANAX Eukaryotic peptide chain release factor GTP-binding subunit OS=Candida albicans GN=SUP35 PE=3 SV=1 186 711 0.0E+00
sp|Q9HGI4|ERF3_ZYGRO Eukaryotic peptide chain release factor GTP-binding subunit OS=Zygosaccharomyces rouxii GN=SUP35 PE=3 SV=2 261 711 0.0E+00
sp|Q9HGI7|ERF3_CANMA Eukaryotic peptide chain release factor GTP-binding subunit OS=Candida maltosa GN=SUP35 PE=3 SV=2 134 711 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HGI6|ERF3_DEBHA Eukaryotic peptide chain release factor GTP-binding subunit OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SUP35 PE=3 SV=4 188 711 0.0E+00
sp|O74718|ERF3_SCHPO Eukaryotic peptide chain release factor GTP-binding subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sup35 PE=1 SV=2 14 711 0.0E+00
sp|O13354|ERF3_CANAX Eukaryotic peptide chain release factor GTP-binding subunit OS=Candida albicans GN=SUP35 PE=3 SV=1 186 711 0.0E+00
sp|Q9HGI4|ERF3_ZYGRO Eukaryotic peptide chain release factor GTP-binding subunit OS=Zygosaccharomyces rouxii GN=SUP35 PE=3 SV=2 261 711 0.0E+00
sp|Q9HGI7|ERF3_CANMA Eukaryotic peptide chain release factor GTP-binding subunit OS=Candida maltosa GN=SUP35 PE=3 SV=2 134 711 0.0E+00
sp|Q9HGI8|ERF3_KLULA Eukaryotic peptide chain release factor GTP-binding subunit OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SUP35 PE=3 SV=1 51 713 0.0E+00
sp|P05453|ERF3_YEAST Eukaryotic peptide chain release factor GTP-binding subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUP35 PE=1 SV=1 69 710 0.0E+00
sp|P15170|ERF3A_HUMAN Eukaryotic peptide chain release factor GTP-binding subunit ERF3A OS=Homo sapiens GN=GSPT1 PE=1 SV=1 282 711 1.0E-173
sp|Q8R050|ERF3A_MOUSE Eukaryotic peptide chain release factor GTP-binding subunit ERF3A OS=Mus musculus GN=Gspt1 PE=1 SV=2 282 711 7.0E-173
sp|Q149F3|ERF3B_MOUSE Eukaryotic peptide chain release factor GTP-binding subunit ERF3B OS=Mus musculus GN=Gspt2 PE=1 SV=1 282 711 9.0E-172
sp|Q8IYD1|ERF3B_HUMAN Eukaryotic peptide chain release factor GTP-binding subunit ERF3B OS=Homo sapiens GN=GSPT2 PE=1 SV=2 282 711 2.0E-171
sp|Q5R4B3|ERF3B_PONAB Eukaryotic peptide chain release factor GTP-binding subunit ERF3B OS=Pongo abelii GN=GSPT2 PE=2 SV=1 282 711 3.0E-171
sp|Q7YZN9|ERF3_DICDI Eukaryotic peptide chain release factor GTP-binding subunit OS=Dictyostelium discoideum GN=erf3 PE=2 SV=1 282 710 6.0E-125
sp|A1RXW9|EF1A_THEPD Elongation factor 1-alpha OS=Thermofilum pendens (strain Hrk 5) GN=tuf PE=3 SV=1 282 715 1.0E-103
sp|A3DMQ1|EF1A_STAMF Elongation factor 1-alpha OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=tuf PE=3 SV=1 281 708 1.0E-95
sp|P41203|EF1A_DESMO Elongation factor 1-alpha OS=Desulfurococcus mobilis GN=tuf PE=3 SV=1 282 710 4.0E-95
sp|Q5R6Y0|HBS1L_PONAB HBS1-like protein OS=Pongo abelii GN=HBS1L PE=2 SV=1 226 710 2.0E-93
sp|Q9Y450|HBS1L_HUMAN HBS1-like protein OS=Homo sapiens GN=HBS1L PE=1 SV=1 226 710 3.0E-93
sp|Q04634|EF1A_TETPY Elongation factor 1-alpha OS=Tetrahymena pyriformis PE=2 SV=1 282 710 8.0E-93
sp|P86939|EF1A2_TRYB2 Elongation factor 1-alpha 2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=Tb10.70.5670 PE=1 SV=1 282 716 2.0E-92
sp|P86934|EF1A1_TRYB2 Elongation factor 1-alpha 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=TEF1 PE=1 SV=1 282 716 2.0E-92
sp|Q8LPC4|EF1A_PYRYE Elongation factor 1-alpha OS=Pyropia yezoensis PE=2 SV=1 282 707 3.0E-92
sp|P86933|EF1A_TRYBB Elongation factor 1-alpha OS=Trypanosoma brucei brucei GN=TEF1 PE=2 SV=1 282 716 1.0E-91
sp|Q69ZS7|HBS1L_MOUSE HBS1-like protein OS=Mus musculus GN=Hbs1l PE=1 SV=2 239 710 2.0E-91
sp|Q6AXM7|HBS1L_RAT HBS1-like protein OS=Rattus norvegicus GN=Hbs1l PE=1 SV=1 200 710 2.0E-91
sp|Q2KHZ2|HBS1L_BOVIN HBS1-like protein OS=Bos taurus GN=HBS1L PE=2 SV=1 267 710 2.0E-91
sp|P50256|EF1AC_PORPU Elongation factor 1-alpha C OS=Porphyra purpurea GN=TEF-C PE=2 SV=1 282 707 5.0E-91
sp|Q27139|EF1A1_EUPCR Elongation factor 1-alpha 1 OS=Euplotes crassus GN=EFA1 PE=3 SV=1 282 710 1.0E-90
sp|P35021|EF1A_SULSO Elongation factor 1-alpha OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=tuf PE=1 SV=3 282 708 2.0E-90
sp|A3MV69|EF1A_PYRCJ Elongation factor 1-alpha OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=tuf PE=3 SV=1 282 710 7.0E-90
sp|P34825|EF1A_HYPJE Elongation factor 1-alpha OS=Hypocrea jecorina GN=tef1 PE=3 SV=1 282 707 1.0E-89
sp|P54959|EF1A_BLAHO Elongation factor 1-alpha OS=Blastocystis hominis PE=2 SV=1 282 707 1.0E-89
sp|P0CT32|EF1A2_DICDI Elongation factor 1-alpha OS=Dictyostelium discoideum GN=eef1a2 PE=1 SV=1 282 707 3.0E-89
sp|P0CT31|EF1A1_DICDI Elongation factor 1-alpha OS=Dictyostelium discoideum GN=eef1a1 PE=1 SV=1 282 707 3.0E-89
sp|A8MAJ1|EF1A_CALMQ Elongation factor 1-alpha OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=tuf PE=3 SV=1 282 710 7.0E-89
sp|Q01765|EF1A_PODCU Elongation factor 1-alpha OS=Podospora curvicolla GN=TEF PE=3 SV=1 282 710 7.0E-89
sp|P0CT55|EF1A3_SCHPO Elongation factor 1-alpha-B/C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef103 PE=1 SV=1 282 707 7.0E-89
sp|P0CT54|EF1A2_SCHPO Elongation factor 1-alpha-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef102 PE=1 SV=1 282 707 7.0E-89
sp|P28295|EF1A_ABSGL Elongation factor 1-alpha OS=Absidia glauca GN=TEF-1 PE=3 SV=1 282 707 9.0E-89
sp|Q01372|EF1A_NEUCR Elongation factor 1-alpha OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tef-1 PE=3 SV=2 282 707 1.0E-88
sp|P0CT53|EF1A1_SCHPO Elongation factor 1-alpha-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef101 PE=1 SV=1 282 707 1.0E-88
sp|P17196|EF1A_SULAC Elongation factor 1-alpha OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=tuf PE=3 SV=1 282 707 2.0E-88
sp|A4WKK8|EF1A_PYRAR Elongation factor 1-alpha OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=tuf PE=3 SV=1 282 710 2.0E-88
sp|Q09069|EF1A_SORMA Elongation factor 1-alpha OS=Sordaria macrospora GN=TEF PE=3 SV=1 282 707 3.0E-88
sp|Q01520|EF1A_PODAS Elongation factor 1-alpha OS=Podospora anserina GN=TEF PE=3 SV=1 282 710 3.0E-88
sp|Q2HJN8|EF1A2_OSCTI Elongation factor 1-alpha 2 OS=Oscheius tipulae GN=eft-2 PE=3 SV=1 282 716 4.0E-88
sp|A1RRJ3|EF1A_PYRIL Elongation factor 1-alpha OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=tuf PE=3 SV=1 282 710 4.0E-88
sp|A4YCR6|EF1A_METS5 Elongation factor 1-alpha OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=tuf PE=3 SV=1 282 707 8.0E-88
sp|O93729|EF1A_PYRAE Elongation factor 1-alpha OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=tuf PE=3 SV=1 282 710 8.0E-88
sp|P0CY35|EF1A1_CANAL Elongation factor 1-alpha 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TEF1 PE=3 SV=1 282 707 2.0E-87
sp|A0RUM4|EF1A_CENSY Elongation factor 1-alpha OS=Cenarchaeum symbiosum (strain A) GN=tuf PE=3 SV=1 282 714 3.0E-87
sp|Q9YAV0|EF1A_AERPE Elongation factor 1-alpha OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=tuf PE=1 SV=1 282 708 4.0E-87
sp|A5DPE3|EF1A_PICGU Elongation factor 1-alpha OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TEF1 PE=3 SV=2 282 707 6.0E-87
sp|P13549|EF1A0_XENLA Elongation factor 1-alpha, somatic form OS=Xenopus laevis GN=eef1as PE=2 SV=1 282 707 7.0E-87
sp|B8GIQ3|EF1A_METPE Elongation factor 1-alpha OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=tuf PE=3 SV=1 282 705 7.0E-87
sp|Q90835|EF1A_CHICK Elongation factor 1-alpha 1 OS=Gallus gallus GN=EEF1A PE=2 SV=1 282 707 2.0E-86
sp|P40911|EF1A_AJECG Elongation factor 1-alpha OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=TEF PE=2 SV=1 282 711 2.0E-86
sp|P14864|EF1A2_MUCCL Elongation factor 1-alpha OS=Mucor circinelloides f. lusitanicus GN=TEF-2 PE=3 SV=1 282 707 2.0E-86
sp|Q2HJN4|EF1A1_OSCTI Elongation factor 1-alpha 1 OS=Oscheius tipulae GN=eft-1 PE=3 SV=1 282 716 2.0E-86
sp|P62630|EF1A1_RAT Elongation factor 1-alpha 1 OS=Rattus norvegicus GN=Eef1a1 PE=2 SV=1 282 707 2.0E-86
sp|P10126|EF1A1_MOUSE Elongation factor 1-alpha 1 OS=Mus musculus GN=Eef1a1 PE=1 SV=3 282 707 2.0E-86
sp|P62629|EF1A1_CRIGR Elongation factor 1-alpha 1 OS=Cricetulus griseus GN=EEF1A1 PE=2 SV=1 282 707 2.0E-86
sp|P68105|EF1A1_RABIT Elongation factor 1-alpha 1 OS=Oryctolagus cuniculus GN=EEF1A1 PE=1 SV=1 282 707 2.0E-86
sp|Q5R4R8|EF1A1_PONAB Elongation factor 1-alpha 1 OS=Pongo abelii GN=EEF1A1 PE=2 SV=2 282 707 2.0E-86
sp|Q5R1X2|EF1A1_PANTR Elongation factor 1-alpha 1 OS=Pan troglodytes GN=EEF1A1 PE=2 SV=1 282 707 2.0E-86
sp|P68104|EF1A1_HUMAN Elongation factor 1-alpha 1 OS=Homo sapiens GN=EEF1A1 PE=1 SV=1 282 707 2.0E-86
sp|Q66RN5|EF1A1_FELCA Elongation factor 1-alpha 1 OS=Felis catus GN=EEF1A1 PE=2 SV=1 282 707 2.0E-86
sp|P68103|EF1A1_BOVIN Elongation factor 1-alpha 1 OS=Bos taurus GN=EEF1A1 PE=1 SV=1 282 707 2.0E-86
sp|A2BN41|EF1A_HYPBU Elongation factor 1-alpha OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=tuf PE=3 SV=1 282 708 3.0E-86
sp|P41752|EF1A_ASHGO Elongation factor 1-alpha OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TEF PE=3 SV=1 282 711 3.0E-86
sp|Q2HJN6|EF1A3_OSCTI Elongation factor 1-alpha 3 OS=Oscheius tipulae GN=eft-3 PE=3 SV=1 282 716 3.0E-86
sp|Q5VTE0|EF1A3_HUMAN Putative elongation factor 1-alpha-like 3 OS=Homo sapiens GN=EEF1A1P5 PE=5 SV=1 282 707 3.0E-86
sp|Q59QD6|EF1A2_CANAL Elongation factor 1-alpha 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TEF2 PE=3 SV=1 282 707 3.0E-86
sp|Q9Y713|EF1A_ASPOR Elongation factor 1-alpha OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tef1 PE=3 SV=1 282 715 3.0E-86
sp|Q2HJN9|EF1A4_OSCTI Elongation factor 1-alpha 4 OS=Oscheius tipulae GN=eft-4 PE=3 SV=1 282 716 6.0E-86
sp|P06805|EF1A1_MUCCL Elongation factor 1-alpha OS=Mucor circinelloides f. lusitanicus GN=TEF-1 PE=3 SV=1 282 707 8.0E-86
sp|Q96WZ1|EF1A_COCIM Elongation factor 1-alpha OS=Coccidioides immitis (strain RS) GN=TEF PE=2 SV=2 282 707 8.0E-86
sp|Q00251|EF1A_AURPU Elongation factor 1-alpha OS=Aureobasidium pullulans GN=TEF1 PE=3 SV=1 282 707 9.0E-86
sp|P31018|EF1A_ENTHI Elongation factor 1-alpha OS=Entamoeba histolytica PE=2 SV=1 282 707 1.0E-85
sp|O42820|EF1A_SCHCO Elongation factor 1-alpha OS=Schizophyllum commune GN=TEF1 PE=3 SV=1 282 707 2.0E-85
sp|A8ABM5|EF1A_IGNH4 Elongation factor 1-alpha OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=tuf PE=3 SV=1 282 708 2.0E-85
sp|P14865|EF1A3_MUCCL Elongation factor 1-alpha OS=Mucor circinelloides f. lusitanicus GN=TEF-3 PE=3 SV=1 282 707 2.0E-85
sp|P0CN30|EF1A_CRYNJ Elongation factor 1-alpha OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TEF1 PE=3 SV=1 282 707 3.0E-85
sp|P0CN31|EF1A_CRYNB Elongation factor 1-alpha OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TEF1 PE=2 SV=1 282 707 3.0E-85
sp|A2Q0Z0|EF1A1_HORSE Elongation factor 1-alpha 1 OS=Equus caballus GN=EEF1A1 PE=2 SV=1 282 707 3.0E-85
sp|Q71V39|EF1A2_RABIT Elongation factor 1-alpha 2 OS=Oryctolagus cuniculus GN=EEF1A2 PE=1 SV=1 282 710 3.0E-85
sp|Q05639|EF1A2_HUMAN Elongation factor 1-alpha 2 OS=Homo sapiens GN=EEF1A2 PE=1 SV=1 282 710 3.0E-85
sp|Q32PH8|EF1A2_BOVIN Elongation factor 1-alpha 2 OS=Bos taurus GN=EEF1A2 PE=2 SV=1 282 710 3.0E-85
sp|A7I656|EF1A_METB6 Elongation factor 1-alpha OS=Methanoregula boonei (strain 6A8) GN=tuf PE=3 SV=1 282 705 4.0E-85
sp|P62632|EF1A2_RAT Elongation factor 1-alpha 2 OS=Rattus norvegicus GN=Eef1a2 PE=1 SV=1 282 710 5.0E-85
sp|P62631|EF1A2_MOUSE Elongation factor 1-alpha 2 OS=Mus musculus GN=Eef1a2 PE=1 SV=1 282 710 5.0E-85
sp|P90519|EF1A_CRYPV Elongation factor 1-alpha OS=Cryptosporidium parvum PE=2 SV=1 282 716 1.0E-84
sp|P25166|EF1A_STYLE Elongation factor 1-alpha OS=Stylonychia lemnae GN=EFAA PE=3 SV=1 282 714 1.0E-84
sp|P17508|EF1A3_XENLA Elongation factor 1-alpha, oocyte form OS=Xenopus laevis PE=1 SV=2 282 707 2.0E-84
sp|Q976B1|EF1A_SULTO Elongation factor 1-alpha OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=tuf PE=3 SV=1 282 707 2.0E-84
sp|Q03033|EF1A_WHEAT Elongation factor 1-alpha OS=Triticum aestivum GN=TEF1 PE=2 SV=1 282 707 2.0E-84
sp|Q9HDF6|EF1A_PIRIN Elongation factor 1-alpha OS=Piriformospora indica GN=TEF1 PE=2 SV=1 282 715 3.0E-84
sp|P29520|EF1A_BOMMO Elongation factor 1-alpha OS=Bombyx mori PE=2 SV=1 282 707 3.0E-84
sp|P02994|EF1A_YEAST Elongation factor 1-alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TEF1 PE=1 SV=1 282 707 3.0E-84
sp|P19039|EF1A_APIME Elongation factor 1-alpha OS=Apis mellifera PE=3 SV=1 281 707 5.0E-84
sp|P27592|EF1A_ONCVO Elongation factor 1-alpha OS=Onchocerca volvulus PE=2 SV=1 282 715 8.0E-84
sp|P53013|EF1A_CAEEL Elongation factor 1-alpha OS=Caenorhabditis elegans GN=eft-3 PE=3 SV=1 282 716 2.0E-83
sp|Q8GTY0|EF1A4_ARATH Elongation factor 1-alpha 4 OS=Arabidopsis thaliana GN=A4 PE=1 SV=2 281 707 2.0E-83
sp|Q0WL56|EF1A3_ARATH Elongation factor 1-alpha 3 OS=Arabidopsis thaliana GN=A3 PE=1 SV=2 281 707 2.0E-83
sp|Q8W4H7|EF1A2_ARATH Elongation factor 1-alpha 2 OS=Arabidopsis thaliana GN=A2 PE=1 SV=2 281 707 2.0E-83
sp|P0DH99|EF1A1_ARATH Elongation factor 1-alpha 1 OS=Arabidopsis thaliana GN=A1 PE=1 SV=1 281 707 2.0E-83
sp|P51554|EF1A_HYDVU Elongation factor 1-alpha OS=Hydra vulgaris PE=2 SV=1 282 707 3.0E-83
sp|P32186|EF1A_PUCGR Elongation factor 1-alpha OS=Puccinia graminis GN=TEF PE=3 SV=2 282 707 4.0E-83
sp|P41745|EF1A_BLAAD Elongation factor 1-alpha OS=Blastobotrys adeninivorans GN=TEF PE=3 SV=1 282 707 5.0E-83
sp|P43643|EF1A_TOBAC Elongation factor 1-alpha OS=Nicotiana tabacum PE=2 SV=1 281 707 5.0E-83
sp|P02993|EF1A_ARTSA Elongation factor 1-alpha OS=Artemia salina PE=1 SV=2 281 707 6.0E-83
sp|O24534|EF1A_VICFA Elongation factor 1-alpha OS=Vicia faba PE=2 SV=1 282 707 8.0E-83
sp|O59949|EF1A_YARLI Elongation factor 1-alpha OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TEF PE=2 SV=2 282 707 2.0E-82
sp|Q41011|EF1A_PEA Elongation factor 1-alpha OS=Pisum sativum PE=2 SV=1 282 707 2.0E-82
sp|O64937|EF1A_ORYSJ Elongation factor 1-alpha OS=Oryza sativa subsp. japonica GN=REFA1 PE=2 SV=2 282 707 3.0E-82
sp|P19486|EF1A_THEAC Elongation factor 1-alpha OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=tuf PE=3 SV=2 282 710 3.0E-82
sp|P17507|EF1A2_XENLA Elongation factor 1-alpha, oocyte form OS=Xenopus laevis GN=eef1ao PE=1 SV=1 282 707 3.0E-82
sp|P34824|EF1A1_HORVU Elongation factor 1-alpha OS=Hordeum vulgare PE=1 SV=1 281 707 6.0E-82
sp|Q41803|EF1A_MAIZE Elongation factor 1-alpha OS=Zea mays GN=EF1A PE=3 SV=1 282 707 6.0E-82
sp|P17786|EF1A_SOLLC Elongation factor 1-alpha OS=Solanum lycopersicum PE=2 SV=1 281 707 6.0E-82
sp|Q979T1|EF1A_THEVO Elongation factor 1-alpha OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=tuf PE=3 SV=2 282 710 7.0E-82
sp|P17506|EF1A1_XENLA Elongation factor 1-alpha OS=Xenopus laevis PE=1 SV=2 282 707 1.0E-81
sp|Q40034|EF1A2_HORVU Elongation factor 1-alpha OS=Hordeum vulgare GN=BLT63 PE=1 SV=1 281 707 1.0E-81
sp|Q8TRC4|EF1A_METAC Elongation factor 1-alpha OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=tuf PE=3 SV=1 282 705 2.0E-81
sp|P29521|EF1A1_DAUCA Elongation factor 1-alpha OS=Daucus carota PE=1 SV=1 282 707 2.0E-81
sp|Q9YIC0|EF1A_ORYLA Elongation factor 1-alpha OS=Oryzias latipes GN=eef1a PE=2 SV=1 281 714 2.0E-81
sp|P05303|EF1A2_DROME Elongation factor 1-alpha 2 OS=Drosophila melanogaster GN=Ef1alpha100E PE=2 SV=2 281 707 3.0E-81
sp|O49169|EF1A_MANES Elongation factor 1-alpha OS=Manihot esculenta GN=EF1 PE=3 SV=1 282 707 3.0E-81
sp|P34823|EF1A2_DAUCA Elongation factor 1-alpha OS=Daucus carota PE=2 SV=1 281 707 3.0E-81
sp|P25698|EF1A_SOYBN Elongation factor 1-alpha OS=Glycine max GN=TEFS1 PE=3 SV=2 282 707 4.0E-81
sp|Q00080|EF1A_PLAFK Elongation factor 1-alpha OS=Plasmodium falciparum (isolate K1 / Thailand) GN=MEF-1 PE=3 SV=1 282 710 5.0E-81
sp|P08736|EF1A1_DROME Elongation factor 1-alpha 1 OS=Drosophila melanogaster GN=Ef1alpha48D PE=1 SV=2 281 707 5.0E-81
sp|A2STF0|EF1A_METLZ Elongation factor 1-alpha OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=tuf PE=3 SV=1 281 707 8.0E-81
sp|Q92005|EF1A_DANRE Elongation factor 1-alpha OS=Danio rerio GN=eef1a PE=2 SV=1 282 707 2.0E-80
sp|Q2FRI3|EF1A_METHJ Elongation factor 1-alpha OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=tuf PE=3 SV=1 282 711 2.0E-80
sp|A6UV43|EF1A_META3 Elongation factor 1-alpha OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=tuf PE=3 SV=1 285 705 3.0E-80
sp|O29325|EF1A_ARCFU Elongation factor 1-alpha OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=tuf PE=3 SV=1 282 710 1.0E-79
sp|Q57770|EF1A_METJA Elongation factor 1-alpha OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=tuf PE=3 SV=1 285 705 1.0E-79
sp|A3CTG3|EF1A_METMJ Elongation factor 1-alpha OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=tuf PE=3 SV=1 282 705 2.0E-79
sp|Q27140|EF1A2_EUPCR Elongation factor 1-alpha 2 OS=Euplotes crassus GN=EFA2 PE=3 SV=1 282 711 4.0E-79
sp|P14963|EF1A_EUGGR Elongation factor 1-alpha OS=Euglena gracilis GN=TEF PE=2 SV=1 282 707 1.0E-78
sp|Q12WT3|EF1A_METBU Elongation factor 1-alpha OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=tuf PE=3 SV=1 282 705 1.0E-78
sp|Q0W8G2|EF1A_METAR Elongation factor 1-alpha OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=tuf PE=3 SV=1 282 707 1.0E-77
sp|Q6L202|EF1A_PICTO Elongation factor 1-alpha OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=tuf PE=3 SV=1 282 710 5.0E-77
sp|Q18EY5|EF1A_HALWD Elongation factor 1-alpha OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=tuf PE=3 SV=1 282 710 3.0E-76
sp|Q3IUD8|EF1A_NATPD Elongation factor 1-alpha OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=tuf PE=3 SV=1 282 710 6.0E-76
sp|Q8TYP6|EF1A_METKA Elongation factor 1-alpha OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=tuf PE=3 SV=1 282 710 1.0E-75
sp|Q8PUR8|EF1A_METMA Elongation factor 1-alpha OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=tuf PE=3 SV=1 282 705 1.0E-75
sp|A0B7D6|EF1A_METTP Elongation factor 1-alpha OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=tuf PE=3 SV=1 282 705 2.0E-75
sp|A4FWE9|EF1A_METM5 Elongation factor 1-alpha OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=tuf PE=3 SV=1 282 705 8.0E-75
sp|A6VGV6|EF1A_METM7 Elongation factor 1-alpha OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=tuf PE=3 SV=1 282 705 2.0E-74
sp|A9A9U3|EF1A_METM6 Elongation factor 1-alpha OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=tuf PE=3 SV=1 282 705 3.0E-74
sp|C6A4R7|EF1A_THESM Elongation factor 1-alpha OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=tuf PE=3 SV=1 282 710 9.0E-74
sp|Q08046|EF1A_GIAIN Elongation factor 1-alpha (Fragment) OS=Giardia intestinalis GN=TEF1 PE=2 SV=1 298 696 9.0E-74
sp|A5ULM5|EF1A_METS3 Elongation factor 1-alpha OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=tuf PE=3 SV=2 282 705 1.0E-73
sp|Q464Z4|EF1A_METBF Elongation factor 1-alpha OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=tuf PE=3 SV=1 282 705 2.0E-73
sp|P07810|EF1A_METVA Elongation factor 1-alpha OS=Methanococcus vannielii GN=tuf PE=3 SV=1 282 705 6.0E-73
sp|A6UQ14|EF1A_METVS Elongation factor 1-alpha OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=tuf PE=3 SV=1 282 705 7.0E-73
sp|Q9HM89|EF1A_HALSA Elongation factor 1-alpha OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=tuf PE=3 SV=1 284 707 1.0E-72
sp|B0R8C3|EF1A_HALS3 Elongation factor 1-alpha OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=tuf PE=3 SV=1 284 707 1.0E-72
sp|Q6LXI1|EF1A_METMP Elongation factor 1-alpha OS=Methanococcus maripaludis (strain S2 / LL) GN=tuf PE=3 SV=1 282 705 1.0E-72
sp|Q26487|EF1A_SPOFR Elongation factor 1-alpha (Fragment) OS=Spodoptera frugiperda PE=1 SV=1 292 696 4.0E-72
sp|P84316|EF1A_HELZE Elongation factor 1-alpha (Fragment) OS=Helicoverpa zea PE=3 SV=1 292 696 5.0E-71
sp|P84315|EF1A_HELVI Elongation factor 1-alpha (Fragment) OS=Heliothis virescens PE=3 SV=1 292 696 5.0E-71
sp|P84318|EF1A_HELGL Elongation factor 1-alpha (Fragment) OS=Helicoverpa gelotopoeon PE=3 SV=1 292 696 5.0E-71
sp|P84320|EF1A_HELDI Elongation factor 1-alpha (Fragment) OS=Heliocheilus discalis PE=3 SV=1 292 696 5.0E-71
sp|P84317|EF1A_HELAM Elongation factor 1-alpha (Fragment) OS=Helicoverpa armigera PE=3 SV=1 292 696 5.0E-71
sp|P84319|EF1A_HELAL Elongation factor 1-alpha (Fragment) OS=Heliocheilus albipunctella PE=3 SV=1 292 696 5.0E-71
sp|P84322|EF1A_ANIIF Elongation factor 1-alpha (Fragment) OS=Anicla infecta PE=3 SV=1 292 696 5.0E-71
sp|P84321|EF1A_ADIBE Elongation factor 1-alpha (Fragment) OS=Adisura bella PE=3 SV=1 292 696 5.0E-71
sp|Q74MI6|EF1A_NANEQ Elongation factor 1-alpha OS=Nanoarchaeum equitans (strain Kin4-M) GN=tuf PE=3 SV=1 282 712 1.0E-70
sp|P16018|EF1A_HALMA Elongation factor 1-alpha OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=tuf PE=1 SV=2 282 707 2.0E-70
sp|O74774|HBS1_SCHPO Elongation factor 1 alpha-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hbs1 PE=1 SV=4 285 710 1.0E-69
sp|O27132|EF1A_METTH Elongation factor 1-alpha OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=tuf PE=1 SV=1 282 711 3.0E-68
sp|Q8U152|EF1A_PYRFU Elongation factor 1-alpha OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=tuf PE=3 SV=1 282 710 1.0E-67
sp|P26751|EF1A_PYRWO Elongation factor 1-alpha OS=Pyrococcus woesei GN=tuf PE=3 SV=1 282 710 4.0E-67
sp|Q5JFZ4|EF1A_THEKO Elongation factor 1-alpha OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=tuf PE=3 SV=1 282 710 1.0E-66
sp|C5A5P4|EF1A_THEGJ Elongation factor 1-alpha OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=tuf PE=3 SV=1 282 710 3.0E-65
sp|Q9V0V7|EF1A_PYRAB Elongation factor 1-alpha OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=tuf PE=3 SV=1 282 710 4.0E-65
sp|P50257|EF1AS_PORPU Elongation factor 1-alpha S OS=Porphyra purpurea GN=TEF-S PE=2 SV=1 282 707 5.0E-65
sp|O59153|EF1A_PYRHO Elongation factor 1-alpha OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=tuf PE=1 SV=1 282 710 7.0E-65
sp|P17197|EF1A_THECE Elongation factor 1-alpha OS=Thermococcus celer GN=tuf PE=3 SV=1 282 710 5.0E-64
sp|B6YVG2|EF1A_THEON Elongation factor 1-alpha OS=Thermococcus onnurineus (strain NA1) GN=tuf PE=3 SV=1 282 710 8.0E-64
sp|Q2NEL1|EF1A_METST Elongation factor 1-alpha OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=tuf PE=3 SV=1 282 705 9.0E-64
sp|P32769|HBS1_YEAST Elongation factor 1 alpha-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HBS1 PE=1 SV=2 284 710 9.0E-61
sp|P27634|EF1A_RHYAM Elongation factor 1-alpha (Fragment) OS=Rhynchosciara americana PE=2 SV=1 330 711 3.0E-56
sp|Q07051|EF1A_EIMBO Elongation factor 1-alpha (Fragment) OS=Eimeria bovis PE=2 SV=1 382 707 3.0E-50
sp|Q8SS29|EF1A_ENCCU Elongation factor 1-alpha OS=Encephalitozoon cuniculi (strain GB-M1) GN=TEF1 PE=1 SV=2 282 712 1.0E-40
sp|Q7UMW2|CYSNC_RHOBA Bifunctional enzyme CysN/CysC OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=cysNC PE=3 SV=1 268 551 2.0E-36
sp|A8EWR6|CYSN_ARCB4 Sulfate adenylyltransferase subunit 1 OS=Arcobacter butzleri (strain RM4018) GN=cysN PE=3 SV=1 268 552 6.0E-35
sp|B1Z7C0|CYSN_METPB Sulfate adenylyltransferase subunit 1 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=cysN PE=3 SV=1 276 564 9.0E-34
sp|A6QB12|CYSN_SULNB Sulfate adenylyltransferase subunit 1 OS=Sulfurovum sp. (strain NBC37-1) GN=cysN PE=3 SV=1 276 558 1.0E-33
sp|Q8DE73|CYSN_VIBVU Sulfate adenylyltransferase subunit 1 OS=Vibrio vulnificus (strain CMCP6) GN=cysN PE=3 SV=1 282 558 4.0E-33
sp|C1D890|CYSN_LARHH Sulfate adenylyltransferase subunit 1 OS=Laribacter hongkongensis (strain HLHK9) GN=cysN PE=3 SV=1 282 590 5.0E-33
sp|B6ELP3|CYSN_ALISL Sulfate adenylyltransferase subunit 1 OS=Aliivibrio salmonicida (strain LFI1238) GN=cysN PE=3 SV=1 262 610 7.0E-33
sp|Q5LES3|CYSN_BACFN Sulfate adenylyltransferase subunit 1 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=cysN PE=3 SV=1 282 548 1.0E-32
sp|Q64VQ9|CYSN_BACFR Sulfate adenylyltransferase subunit 1 OS=Bacteroides fragilis (strain YCH46) GN=cysN PE=3 SV=1 282 548 1.0E-32
sp|Q482Z9|CYSN_COLP3 Sulfate adenylyltransferase subunit 1 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=cysN PE=3 SV=1 276 536 2.0E-32
sp|Q8AAP9|CYSN_BACTN Sulfate adenylyltransferase subunit 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=cysN PE=3 SV=1 282 558 2.0E-32
sp|A7ZQJ5|CYSN_ECO24 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=cysN PE=3 SV=1 282 536 3.0E-32
sp|B7LXG3|CYSN_ECO8A Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O8 (strain IAI1) GN=cysN PE=3 SV=1 282 536 3.0E-32
sp|B7LEG9|CYSN_ECO55 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain 55989 / EAEC) GN=cysN PE=3 SV=1 282 536 3.0E-32
sp|Q2JUX4|EFTU_SYNJA Elongation factor Tu OS=Synechococcus sp. (strain JA-3-3Ab) GN=tuf PE=3 SV=1 282 711 4.0E-32
sp|B6I6E1|CYSN_ECOSE Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain SE11) GN=cysN PE=3 SV=1 282 536 4.0E-32
sp|Q1QUF9|CYSN_CHRSD Sulfate adenylyltransferase subunit 1 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=cysN PE=3 SV=1 273 610 5.0E-32
sp|P9WNM5|CYSNC_MYCTU Bifunctional enzyme CysN/CysC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cysNC PE=1 SV=1 291 654 5.0E-32
sp|P9WNM4|CYSNC_MYCTO Bifunctional enzyme CysN/CysC OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cysNC PE=3 SV=1 291 654 5.0E-32
sp|Q5E830|CYSN_VIBF1 Sulfate adenylyltransferase subunit 1 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=cysN PE=3 SV=1 278 610 5.0E-32
sp|Q7MPF2|CYSN_VIBVY Sulfate adenylyltransferase subunit 1 OS=Vibrio vulnificus (strain YJ016) GN=cysN PE=3 SV=1 282 558 5.0E-32
sp|A9W4X1|CYSN_METEP Sulfate adenylyltransferase subunit 1 OS=Methylobacterium extorquens (strain PA1) GN=cysN PE=3 SV=1 276 590 5.0E-32
sp|B7UHH0|CYSN_ECO27 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=cysN PE=3 SV=1 282 536 6.0E-32
sp|Q3YYB1|CYSN_SHISS Sulfate adenylyltransferase subunit 1 OS=Shigella sonnei (strain Ss046) GN=cysN PE=3 SV=1 282 536 7.0E-32
sp|B1LQ72|CYSN_ECOSM Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=cysN PE=3 SV=1 282 536 7.0E-32
sp|P23845|CYSN_ECOLI Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain K12) GN=cysN PE=1 SV=1 282 536 7.0E-32
sp|Q0TEA7|CYSN_ECOL5 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=cysN PE=3 SV=1 282 536 7.0E-32
sp|B1XCS7|CYSN_ECODH Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain K12 / DH10B) GN=cysN PE=3 SV=1 282 536 7.0E-32
sp|C4ZZQ5|CYSN_ECOBW Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=cysN PE=3 SV=1 282 536 7.0E-32
sp|B7MZ52|CYSN_ECO81 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O81 (strain ED1a) GN=cysN PE=3 SV=1 282 536 7.0E-32
sp|B7NT95|CYSN_ECO7I Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=cysN PE=3 SV=1 282 536 7.0E-32
sp|A5CCA0|EFTU1_ORITB Elongation factor Tu 1 OS=Orientia tsutsugamushi (strain Boryong) GN=tuf1 PE=3 SV=1 282 711 7.0E-32
sp|Q1R7U0|CYSN_ECOUT Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain UTI89 / UPEC) GN=cysN PE=3 SV=1 282 536 8.0E-32
sp|Q8FEJ1|CYSN_ECOL6 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysN PE=3 SV=1 282 536 8.0E-32
sp|A1AEU5|CYSN_ECOK1 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O1:K1 / APEC GN=cysN PE=3 SV=1 282 536 8.0E-32
sp|B7MKM5|CYSN_ECO45 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=cysN PE=3 SV=1 282 536 8.0E-32
sp|A8A3N0|CYSN_ECOHS Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O9:H4 (strain HS) GN=cysN PE=3 SV=1 282 536 8.0E-32
sp|B5Z3B3|CYSN_ECO5E Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=cysN PE=3 SV=1 282 536 8.0E-32
sp|Q8X7X7|CYSN_ECO57 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O157:H7 GN=cysN PE=3 SV=1 282 536 8.0E-32
sp|B5FGJ9|CYSN_VIBFM Sulfate adenylyltransferase subunit 1 OS=Vibrio fischeri (strain MJ11) GN=cysN PE=3 SV=1 278 610 9.0E-32
sp|B7L0X9|CYSN_METC4 Sulfate adenylyltransferase subunit 1 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=cysN PE=3 SV=1 276 590 9.0E-32
sp|A7MJ69|CYSN_CROS8 Sulfate adenylyltransferase subunit 1 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=cysN PE=3 SV=1 282 603 1.0E-31
sp|B0CCD0|EFTU_ACAM1 Elongation factor Tu OS=Acaryochloris marina (strain MBIC 11017) GN=tuf PE=3 SV=1 282 711 1.0E-31
sp|B7VKY2|CYSN_VIBTL Sulfate adenylyltransferase subunit 1 OS=Vibrio tasmaniensis (strain LGP32) GN=cysN PE=3 SV=1 282 536 1.0E-31
sp|B2J5B1|EFTU_NOSP7 Elongation factor Tu OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=tuf PE=3 SV=1 282 711 1.0E-31
sp|Q8EB10|CYSN_SHEON Sulfate adenylyltransferase subunit 1 OS=Shewanella oneidensis (strain MR-1) GN=cysN PE=3 SV=2 264 594 1.0E-31
sp|A1JJT0|CYSN_YERE8 Sulfate adenylyltransferase subunit 1 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=cysN PE=3 SV=1 282 548 2.0E-31
sp|Q32CH9|CYSN_SHIDS Sulfate adenylyltransferase subunit 1 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=cysN PE=3 SV=1 282 536 2.0E-31
sp|A4IXZ5|CYSN_FRATW Sulfate adenylyltransferase subunit 1 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=cysN PE=3 SV=1 282 548 2.0E-31
sp|B1KMH4|CYSN_SHEWM Sulfate adenylyltransferase subunit 1 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=cysN PE=3 SV=1 273 610 3.0E-31
sp|B7N6Y1|CYSN_ECOLU Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=cysN PE=3 SV=1 282 536 3.0E-31
sp|A7MWE9|CYSN_VIBCB Sulfate adenylyltransferase subunit 1 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=cysN PE=3 SV=1 276 594 3.0E-31
sp|Q9TMM9|EFTU_TOXGO Elongation factor Tu, apicoplast OS=Toxoplasma gondii GN=tufA PE=3 SV=1 277 711 3.0E-31
sp|A5CCL4|EFTU2_ORITB Elongation factor Tu 2 OS=Orientia tsutsugamushi (strain Boryong) GN=tuf2 PE=3 SV=2 282 711 4.0E-31
sp|B7LWK4|CYSN_ESCF3 Sulfate adenylyltransferase subunit 1 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=cysN PE=3 SV=1 282 536 4.0E-31
sp|Q2NVM8|CYSN_SODGM Sulfate adenylyltransferase subunit 1 OS=Sodalis glossinidius (strain morsitans) GN=cysN PE=3 SV=1 282 548 4.0E-31
sp|P74227|EFTU_SYNY3 Elongation factor Tu OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=tuf PE=1 SV=1 282 711 4.0E-31
sp|B2VG01|CYSN_ERWT9 Sulfate adenylyltransferase subunit 1 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=cysN PE=3 SV=1 282 536 5.0E-31
sp|C4LAG3|CYSN_TOLAT Sulfate adenylyltransferase subunit 1 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=cysN PE=3 SV=1 273 548 7.0E-31
sp|Q31XB3|CYSN_SHIBS Sulfate adenylyltransferase subunit 1 OS=Shigella boydii serotype 4 (strain Sb227) GN=cysN PE=3 SV=1 282 536 9.0E-31
sp|A4FPM7|EFTU_SACEN Elongation factor Tu OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=tuf PE=3 SV=1 282 613 1.0E-30
sp|B2TZI0|CYSN_SHIB3 Sulfate adenylyltransferase subunit 1 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=cysN PE=3 SV=1 282 536 1.0E-30
sp|Q54HB2|EFTU_DICDI Elongation factor Tu, mitochondrial OS=Dictyostelium discoideum GN=tufm PE=1 SV=2 282 711 1.0E-30
sp|Q7N8L0|CYSN_PHOLL Sulfate adenylyltransferase subunit 1 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysN PE=3 SV=1 291 595 1.0E-30
sp|Q5NG10|CYSN_FRATT Sulfate adenylyltransferase subunit 1 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=cysN PE=3 SV=1 282 548 1.0E-30
sp|Q14HG2|CYSN_FRAT1 Sulfate adenylyltransferase subunit 1 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=cysN PE=3 SV=1 282 548 1.0E-30
sp|Q7V500|EFTU_PROMM Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9313) GN=tuf PE=3 SV=1 282 711 1.0E-30
sp|Q3AMT6|EFTU_SYNSC Elongation factor Tu OS=Synechococcus sp. (strain CC9605) GN=tuf PE=3 SV=1 282 711 1.0E-30
sp|A8ANW5|CYSN_CITK8 Sulfate adenylyltransferase subunit 1 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=cysN PE=3 SV=1 282 548 2.0E-30
sp|Q0T1I2|CYSN_SHIF8 Sulfate adenylyltransferase subunit 1 OS=Shigella flexneri serotype 5b (strain 8401) GN=cysN PE=3 SV=1 282 536 2.0E-30
sp|Q3MDM5|EFTU_ANAVT Elongation factor Tu OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=tuf PE=3 SV=1 282 711 2.0E-30
sp|A5F578|CYSN_VIBC3 Sulfate adenylyltransferase subunit 1 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=cysN PE=3 SV=1 264 590 2.0E-30
sp|Q8YP63|EFTU_NOSS1 Elongation factor Tu OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=tuf PE=1 SV=1 282 711 2.0E-30
sp|B1XI63|EFTU_SYNP2 Elongation factor Tu OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=tuf PE=3 SV=1 282 711 3.0E-30
sp|Q3AW53|EFTU_SYNS9 Elongation factor Tu OS=Synechococcus sp. (strain CC9902) GN=tuf PE=3 SV=1 282 711 3.0E-30
sp|A2CC87|EFTU_PROM3 Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9303) GN=tuf PE=3 SV=1 282 711 3.0E-30
sp|P42482|EFTU_WOLSU Elongation factor Tu OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=tuf PE=3 SV=2 277 613 3.0E-30
sp|Q66EC7|CYSN_YERPS Sulfate adenylyltransferase subunit 1 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cysN PE=3 SV=1 282 548 3.0E-30
sp|Q8ZBP2|CYSN_YERPE Sulfate adenylyltransferase subunit 1 OS=Yersinia pestis GN=cysN PE=3 SV=1 282 548 3.0E-30
sp|A7FLY2|CYSN_YERP3 Sulfate adenylyltransferase subunit 1 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=cysN PE=3 SV=1 282 548 3.0E-30
sp|B0JSE0|EFTU_MICAN Elongation factor Tu OS=Microcystis aeruginosa (strain NIES-843) GN=tuf PE=3 SV=1 282 711 3.0E-30
sp|Q118Z2|EFTU_TRIEI Elongation factor Tu OS=Trichodesmium erythraeum (strain IMS101) GN=tuf PE=3 SV=1 282 711 3.0E-30
sp|B1IUS8|CYSN_ECOLC Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=cysN PE=3 SV=1 282 536 4.0E-30
sp|B3QZH5|EFTU_PHYMT Elongation factor Tu OS=Phytoplasma mali (strain AT) GN=tuf PE=3 SV=1 282 613 4.0E-30
sp|A0LRL8|EFTU_ACIC1 Elongation factor Tu OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=tuf PE=3 SV=1 282 613 4.0E-30
sp|Q1ACI3|EFTU_CHAVU Elongation factor Tu, chloroplastic OS=Chara vulgaris GN=tufA PE=3 SV=1 282 711 4.0E-30
sp|A6Q1L5|EFTU_NITSB Elongation factor Tu OS=Nitratiruptor sp. (strain SB155-2) GN=tuf PE=3 SV=1 282 711 5.0E-30
sp|B8HVR7|EFTU_CYAP4 Elongation factor Tu OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=tuf PE=3 SV=1 282 711 5.0E-30
sp|B7K834|EFTU_CYAP7 Elongation factor Tu OS=Cyanothece sp. (strain PCC 7424) GN=tuf PE=3 SV=1 282 711 6.0E-30
sp|Q83JX8|CYSN_SHIFL Sulfate adenylyltransferase subunit 1 OS=Shigella flexneri GN=cysN PE=3 SV=1 282 536 8.0E-30
sp|C3LRM1|CYSN_VIBCM Sulfate adenylyltransferase subunit 1 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=cysN PE=3 SV=1 264 590 1.0E-29
sp|Q9KP20|CYSN_VIBCH Sulfate adenylyltransferase subunit 1 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cysN PE=3 SV=1 264 590 1.0E-29
sp|P50371|EFTU_CHACO Elongation factor Tu, chloroplastic OS=Chara connivens GN=tufA PE=3 SV=1 282 707 1.0E-29
sp|Q46IW4|EFTU_PROMT Elongation factor Tu OS=Prochlorococcus marinus (strain NATL2A) GN=tuf PE=3 SV=1 282 711 1.0E-29
sp|B3PII1|CYSN_CELJU Sulfate adenylyltransferase subunit 1 OS=Cellvibrio japonicus (strain Ueda107) GN=cysN PE=3 SV=1 282 565 1.0E-29
sp|A0Q6F0|CYSN_FRATN Sulfate adenylyltransferase subunit 1 OS=Francisella tularensis subsp. novicida (strain U112) GN=cysN PE=3 SV=1 282 548 1.0E-29
sp|B4RTW4|CYSN_ALTMD Sulfate adenylyltransferase subunit 1 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=cysN PE=3 SV=1 282 563 1.0E-29
sp|B7JUP5|EFTU_CYAP8 Elongation factor Tu OS=Cyanothece sp. (strain PCC 8801) GN=tuf PE=3 SV=1 282 711 1.0E-29
sp|A5GIP0|EFTU_SYNPW Elongation factor Tu OS=Synechococcus sp. (strain WH7803) GN=tuf PE=3 SV=1 282 711 1.0E-29
sp|B5BEY8|CYSN_SALPK Sulfate adenylyltransferase subunit 1 OS=Salmonella paratyphi A (strain AKU_12601) GN=cysN PE=3 SV=1 282 548 2.0E-29
sp|Q5PEH2|CYSN_SALPA Sulfate adenylyltransferase subunit 1 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=cysN PE=3 SV=1 282 548 2.0E-29
sp|P50064|EFTU_GLOVI Elongation factor Tu OS=Gloeobacter violaceus (strain PCC 7421) GN=tufA PE=3 SV=2 282 711 2.0E-29
sp|P18668|EFTU_SYNP6 Elongation factor Tu OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=tuf PE=3 SV=1 282 711 2.0E-29
sp|P33171|EFTU_SYNE7 Elongation factor Tu OS=Synechococcus elongatus (strain PCC 7942) GN=tuf PE=3 SV=2 282 711 2.0E-29
sp|O50274|CYSNC_PSEAE Bifunctional enzyme CysN/CysC OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysNC PE=3 SV=1 282 548 2.0E-29
sp|A7GZK6|EFTU_CAMC5 Elongation factor Tu OS=Campylobacter curvus (strain 525.92) GN=tuf PE=3 SV=1 282 613 2.0E-29
sp|Q15VB8|CYSN_PSEA6 Sulfate adenylyltransferase subunit 1 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=cysN PE=3 SV=1 282 566 3.0E-29
sp|B5RDQ7|CYSN_SALG2 Sulfate adenylyltransferase subunit 1 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=cysN PE=3 SV=1 282 548 3.0E-29
sp|A8EW02|EFTU_ARCB4 Elongation factor Tu OS=Arcobacter butzleri (strain RM4018) GN=tuf PE=3 SV=1 282 594 3.0E-29
sp|A1SNN5|EFTU_NOCSJ Elongation factor Tu OS=Nocardioides sp. (strain BAA-499 / JS614) GN=tuf PE=3 SV=1 282 613 4.0E-29
sp|A2C4U5|EFTU_PROM1 Elongation factor Tu OS=Prochlorococcus marinus (strain NATL1A) GN=tuf PE=3 SV=1 282 711 4.0E-29
sp|Q9ZEU3|EFTU_APPPP Elongation factor Tu OS=Apple proliferation phytoplasma GN=tuf PE=3 SV=1 282 613 4.0E-29
sp|B5QW22|CYSN_SALEP Sulfate adenylyltransferase subunit 1 OS=Salmonella enteritidis PT4 (strain P125109) GN=cysN PE=3 SV=1 282 548 4.0E-29
sp|Q6A6L7|EFTU_PROAC Elongation factor Tu OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=tuf PE=3 SV=1 282 614 5.0E-29
sp|A8G708|EFTU_PROM2 Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9215) GN=tuf PE=3 SV=1 282 711 5.0E-29
sp|Q06J54|EFTU_BIGNA Elongation factor Tu, chloroplastic OS=Bigelowiella natans GN=tufA PE=3 SV=1 282 613 5.0E-29
sp|Q87SX9|CYSN_VIBPA Sulfate adenylyltransferase subunit 1 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=cysN PE=3 SV=1 276 558 6.0E-29
sp|Q6YQV8|EFTU_ONYPE Elongation factor Tu OS=Onion yellows phytoplasma (strain OY-M) GN=tuf PE=3 SV=1 277 613 6.0E-29
sp|A1ST27|CYSN_PSYIN Sulfate adenylyltransferase subunit 1 OS=Psychromonas ingrahamii (strain 37) GN=cysN PE=3 SV=1 268 536 6.0E-29
sp|A5GW14|EFTU_SYNR3 Elongation factor Tu OS=Synechococcus sp. (strain RCC307) GN=tuf PE=3 SV=1 282 711 6.0E-29
sp|B4TFX1|CYSN_SALHS Sulfate adenylyltransferase subunit 1 OS=Salmonella heidelberg (strain SL476) GN=cysN PE=3 SV=1 282 548 7.0E-29
sp|B5FTS9|CYSN_SALDC Sulfate adenylyltransferase subunit 1 OS=Salmonella dublin (strain CT_02021853) GN=cysN PE=3 SV=1 282 548 7.0E-29
sp|B4TTW5|CYSN_SALSV Sulfate adenylyltransferase subunit 1 OS=Salmonella schwarzengrund (strain CVM19633) GN=cysN PE=3 SV=1 282 548 7.0E-29
sp|B5F415|CYSN_SALA4 Sulfate adenylyltransferase subunit 1 OS=Salmonella agona (strain SL483) GN=cysN PE=3 SV=1 282 548 7.0E-29
sp|A9N2D8|CYSN_SALPB Sulfate adenylyltransferase subunit 1 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=cysN PE=3 SV=1 282 548 8.0E-29
sp|Q9PD78|CYSNC_XYLFA Bifunctional enzyme CysN/CysC OS=Xylella fastidiosa (strain 9a5c) GN=cysNC PE=3 SV=2 276 548 9.0E-29
sp|Q8Z470|CYSN_SALTI Sulfate adenylyltransferase subunit 1 OS=Salmonella typhi GN=cysN PE=3 SV=1 282 548 9.0E-29
sp|P56893|CYSN_RHIME Sulfate adenylyltransferase subunit 1 OS=Rhizobium meliloti (strain 1021) GN=cysN PE=3 SV=1 273 548 1.0E-28
sp|A0KP35|CYSN_AERHH Sulfate adenylyltransferase subunit 1 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=cysN PE=3 SV=1 282 548 1.0E-28
sp|A4SRG8|CYSN_AERS4 Sulfate adenylyltransferase subunit 1 OS=Aeromonas salmonicida (strain A449) GN=cysN PE=3 SV=1 282 548 1.0E-28
sp|A3PEZ7|EFTU_PROM0 Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9301) GN=tuf PE=3 SV=1 282 711 1.0E-28
sp|A9MF24|CYSN_SALAR Sulfate adenylyltransferase subunit 1 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=cysN PE=3 SV=1 282 536 1.0E-28
sp|P51287|EFTU_PORPU Elongation factor Tu, chloroplastic OS=Porphyra purpurea GN=tufA PE=3 SV=1 282 711 1.0E-28
sp|Q1XDK1|EFTU_PYRYE Elongation factor Tu, chloroplastic OS=Pyropia yezoensis GN=tufA PE=3 SV=1 282 711 1.0E-28
sp|Q8ZMF5|CYSN_SALTY Sulfate adenylyltransferase subunit 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysN PE=3 SV=1 282 548 1.0E-28
sp|A9WFP3|EFTU_CHLAA Elongation factor Tu OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=tuf1 PE=3 SV=1 282 711 1.0E-28
sp|Q4G342|EFTU_EMIHU Elongation factor Tu, chloroplastic OS=Emiliania huxleyi GN=tufA PE=3 SV=1 282 711 1.0E-28
sp|Q4MYA4|EFTU_THEPA Elongation factor Tu, apicoplast OS=Theileria parva GN=tufA PE=3 SV=1 282 711 1.0E-28
sp|A2BYN4|EFTU_PROM5 Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9515) GN=tuf PE=3 SV=1 282 711 1.0E-28
sp|A2BT83|EFTU_PROMS Elongation factor Tu OS=Prochlorococcus marinus (strain AS9601) GN=tuf PE=3 SV=1 282 711 1.0E-28
sp|Q6LM69|CYSN_PHOPR Sulfate adenylyltransferase subunit 1 OS=Photobacterium profundum GN=cysN PE=3 SV=1 260 548 2.0E-28
sp|Q2NJ20|EFTU_AYWBP Elongation factor Tu OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=tuf PE=3 SV=1 277 613 2.0E-28
sp|Q9TJQ8|EFTU_PROWI Elongation factor Tu, plastid OS=Prototheca wickerhamii GN=tufA PE=3 SV=1 282 711 2.0E-28
sp|A9BCK0|EFTU_PROM4 Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9211) GN=tuf PE=3 SV=1 282 711 2.0E-28
sp|Q255F3|EFTU_CHLFF Elongation factor Tu OS=Chlamydophila felis (strain Fe/C-56) GN=tuf PE=3 SV=1 282 614 2.0E-28
sp|C4ZB99|EFTU_EUBR3 Elongation factor Tu OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=tuf PE=3 SV=1 282 613 2.0E-28
sp|Q04B37|EFTU_LACDB Elongation factor Tu OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=tuf PE=3 SV=1 282 613 2.0E-28
sp|Q1GAQ0|EFTU_LACDA Elongation factor Tu OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=tuf PE=3 SV=1 282 613 2.0E-28
sp|Q5L5H6|EFTU_CHLAB Elongation factor Tu OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=tuf PE=3 SV=1 282 614 2.0E-28
sp|C0PXB1|CYSN_SALPC Sulfate adenylyltransferase subunit 1 OS=Salmonella paratyphi C (strain RKS4594) GN=cysN PE=3 SV=1 282 548 3.0E-28
sp|Q57KJ0|CYSN_SALCH Sulfate adenylyltransferase subunit 1 OS=Salmonella choleraesuis (strain SC-B67) GN=cysN PE=3 SV=1 282 548 3.0E-28
sp|B1WQY4|EFTU_CYAA5 Elongation factor Tu OS=Cyanothece sp. (strain ATCC 51142) GN=tuf PE=3 SV=1 282 711 3.0E-28
sp|Q822I4|EFTU_CHLCV Elongation factor Tu OS=Chlamydophila caviae (strain GPIC) GN=tuf PE=3 SV=3 282 614 3.0E-28
sp|B4T461|CYSN_SALNS Sulfate adenylyltransferase subunit 1 OS=Salmonella newport (strain SL254) GN=cysN PE=3 SV=1 282 548 3.0E-28
sp|P09953|EFTU_MICLU Elongation factor Tu OS=Micrococcus luteus GN=tuf PE=3 SV=1 282 613 3.0E-28
sp|Q21IS6|CYSN_SACD2 Sulfate adenylyltransferase subunit 1 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=cysN PE=3 SV=1 282 610 3.0E-28
sp|A7ZCN0|EFTU_CAMC1 Elongation factor Tu OS=Campylobacter concisus (strain 13826) GN=tuf PE=3 SV=1 282 613 3.0E-28
sp|A2CI56|EFTU_CHLAT Elongation factor Tu, chloroplastic OS=Chlorokybus atmophyticus GN=tufA PE=3 SV=1 282 711 4.0E-28
sp|Q2EEV7|EFTU_HELSJ Elongation factor Tu, plastid OS=Helicosporidium sp. subsp. Simulium jonesii GN=tufA PE=3 SV=2 282 711 4.0E-28
sp|C5BSJ5|CYSN_TERTT Sulfate adenylyltransferase subunit 1 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=cysN PE=3 SV=1 282 565 4.0E-28
sp|Q318N5|EFTU_PROM9 Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9312) GN=tuf PE=3 SV=1 282 711 6.0E-28
sp|Q7NVN5|CYSN_CHRVO Sulfate adenylyltransferase subunit 1 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cysN PE=3 SV=1 274 548 6.0E-28
sp|O07309|NODQ_RHISB Bifunctional enzyme NodQ OS=Rhizobium sp. (strain BR816) GN=nodQ PE=3 SV=1 281 558 6.0E-28
sp|Q20EU5|EFTU_OLTVI Elongation factor Tu, chloroplastic OS=Oltmannsiellopsis viridis GN=tufA PE=3 SV=1 282 613 6.0E-28
sp|A1WVC4|EFTU1_HALHL Elongation factor Tu 1 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=tuf1 PE=3 SV=1 282 711 6.0E-28
sp|A6W5T5|EFTU_KINRD Elongation factor Tu OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=tuf PE=3 SV=1 282 613 6.0E-28
sp|P42471|EFTU_BRELN Elongation factor Tu OS=Brevibacterium linens GN=tuf PE=3 SV=1 282 613 6.0E-28
sp|Q9ZT91|EFTM_ARATH Elongation factor Tu, mitochondrial OS=Arabidopsis thaliana GN=TUFA PE=1 SV=1 282 712 6.0E-28
sp|P02992|EFTU_YEAST Elongation factor Tu, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUF1 PE=1 SV=1 282 711 6.0E-28
sp|B9E8Q0|EFTU_MACCJ Elongation factor Tu OS=Macrococcus caseolyticus (strain JCSC5402) GN=tuf PE=3 SV=1 282 613 7.0E-28
sp|A0RQJ3|EFTU_CAMFF Elongation factor Tu OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=tuf PE=3 SV=1 282 613 9.0E-28
sp|P17245|EFTU_CYAPA Elongation factor Tu, cyanelle OS=Cyanophora paradoxa GN=tufA PE=3 SV=2 282 711 1.0E-27
sp|P56003|EFTU_HELPY Elongation factor Tu OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=tuf PE=3 SV=1 282 613 1.0E-27
sp|P17745|EFTU_ARATH Elongation factor Tu, chloroplastic OS=Arabidopsis thaliana GN=TUFA PE=1 SV=1 282 614 1.0E-27
sp|P33165|EFTU_BACFR Elongation factor Tu OS=Bacteroides fragilis (strain YCH46) GN=tuf PE=3 SV=1 282 614 1.0E-27
sp|Q5L890|EFTU_BACFN Elongation factor Tu OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=tuf PE=3 SV=1 282 614 1.0E-27
sp|Q18CE4|EFTU_PEPD6 Elongation factor Tu OS=Peptoclostridium difficile (strain 630) GN=tuf1 PE=3 SV=1 282 711 1.0E-27
sp|B2RL52|EFTU_PORG3 Elongation factor Tu OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=tuf PE=3 SV=1 282 711 1.0E-27
sp|P13442|NODQ_RHIME Bifunctional enzyme NodQ OS=Rhizobium meliloti (strain 1021) GN=nodQ PE=3 SV=1 273 575 1.0E-27
sp|B2UUW8|EFTU_HELPS Elongation factor Tu OS=Helicobacter pylori (strain Shi470) GN=tuf PE=3 SV=1 282 613 1.0E-27
sp|Q99QM0|EFTU_CAUCR Elongation factor Tu OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=tufA PE=3 SV=1 282 594 1.0E-27
sp|A9BHA7|EFTU_PETMO Elongation factor Tu OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=tuf PE=3 SV=1 277 711 1.0E-27
sp|A1WVD6|EFTU2_HALHL Elongation factor Tu 2 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=tuf2 PE=3 SV=1 282 711 1.0E-27
sp|B3ETZ7|EFTU_AMOA5 Elongation factor Tu OS=Amoebophilus asiaticus (strain 5a2) GN=tuf PE=3 SV=1 282 613 2.0E-27
sp|Q98QG1|EFTU_MYCPU Elongation factor Tu OS=Mycoplasma pulmonis (strain UAB CTIP) GN=tuf PE=3 SV=1 282 614 2.0E-27
sp|B5Z8K3|EFTU_HELPG Elongation factor Tu OS=Helicobacter pylori (strain G27) GN=tuf PE=3 SV=1 282 613 2.0E-27
sp|B9KFF9|EFTU_CAMLR Elongation factor Tu OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=tuf PE=3 SV=1 282 711 2.0E-27
sp|A9VP75|EFTU_BACWK Elongation factor Tu OS=Bacillus weihenstephanensis (strain KBAB4) GN=tuf PE=3 SV=1 282 613 2.0E-27
sp|Q7UZY7|EFTU_PROMP Elongation factor Tu OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=tuf PE=3 SV=1 282 711 2.0E-27
sp|Q11Q98|EFTU_CYTH3 Elongation factor Tu OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=tuf PE=3 SV=1 282 613 2.0E-27
sp|Q87DG7|CYSNC_XYLFT Bifunctional enzyme CysN/CysC OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=cysNC PE=3 SV=1 276 596 3.0E-27
sp|B7IT17|EFTU_BACC2 Elongation factor Tu OS=Bacillus cereus (strain G9842) GN=tuf PE=3 SV=1 282 613 3.0E-27
sp|A4XI37|EFTU_CALS8 Elongation factor Tu OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=tuf PE=3 SV=1 282 613 3.0E-27
sp|P40175|EFTU3_STRCO Elongation factor Tu-3 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=tuf3 PE=3 SV=2 282 632 3.0E-27
sp|Q01SX2|EFTU_SOLUE Elongation factor Tu OS=Solibacter usitatus (strain Ellin6076) GN=tuf1 PE=3 SV=1 282 594 3.0E-27
sp|P72339|NODQ_RHIS3 Bifunctional enzyme NodQ OS=Rhizobium sp. (strain N33) GN=nodQ PE=3 SV=1 282 590 3.0E-27
sp|O50293|EFTU_AQUPY Elongation factor Tu OS=Aquifex pyrophilus GN=tuf PE=3 SV=1 282 613 3.0E-27
sp|B9MQH1|EFTU_CALBD Elongation factor Tu OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=tuf PE=3 SV=1 282 613 3.0E-27
sp|Q02WY9|EFTU_LACLS Elongation factor Tu OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=tuf PE=3 SV=1 277 613 4.0E-27
sp|A2RMT1|EFTU_LACLM Elongation factor Tu OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=tuf PE=3 SV=1 277 613 4.0E-27
sp|Q9CEI0|EFTU_LACLA Elongation factor Tu OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=tuf PE=3 SV=1 277 613 4.0E-27
sp|Q7VJ74|EFTU_HELHP Elongation factor Tu OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=tuf PE=3 SV=1 277 711 5.0E-27
sp|Q5HVZ7|EFTU_CAMJR Elongation factor Tu OS=Campylobacter jejuni (strain RM1221) GN=tuf PE=3 SV=1 282 613 5.0E-27
sp|A1VYI6|EFTU_CAMJJ Elongation factor Tu OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=tuf PE=3 SV=1 282 613 5.0E-27
sp|O69303|EFTU_CAMJE Elongation factor Tu OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=tuf PE=3 SV=1 282 613 5.0E-27
sp|A7H4R3|EFTU_CAMJD Elongation factor Tu OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=tuf PE=3 SV=1 282 613 5.0E-27
sp|A8FKQ5|EFTU_CAMJ8 Elongation factor Tu OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=tuf PE=3 SV=1 282 613 5.0E-27
sp|A0QS98|EFTU_MYCS2 Elongation factor Tu OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=tuf PE=1 SV=1 282 613 5.0E-27
sp|P0CD71|EFTU_CHLTR Elongation factor Tu OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=tuf PE=3 SV=1 282 594 5.0E-27
sp|Q3KM40|EFTU_CHLTA Elongation factor Tu OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=tuf PE=3 SV=1 282 594 5.0E-27
sp|Q1RHL9|EFTU_RICBR Elongation factor Tu OS=Rickettsia bellii (strain RML369-C) GN=tuf PE=3 SV=1 282 613 5.0E-27
sp|A8GVB2|EFTU_RICB8 Elongation factor Tu OS=Rickettsia bellii (strain OSU 85-389) GN=tuf PE=3 SV=1 282 613 5.0E-27
sp|P30768|EFTU_MYCLE Elongation factor Tu OS=Mycobacterium leprae (strain TN) GN=tuf PE=3 SV=2 282 613 5.0E-27
sp|B8ZSC1|EFTU_MYCLB Elongation factor Tu OS=Mycobacterium leprae (strain Br4923) GN=tuf PE=3 SV=1 282 613 5.0E-27
sp|Q9PK73|EFTU_CHLMU Elongation factor Tu OS=Chlamydia muridarum (strain MoPn / Nigg) GN=tuf PE=3 SV=3 282 594 5.0E-27
sp|B0BBV3|EFTU_CHLTB Elongation factor Tu OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=tuf PE=3 SV=1 282 594 6.0E-27
sp|B0B7N8|EFTU_CHLT2 Elongation factor Tu OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=tuf PE=1 SV=1 282 594 6.0E-27
sp|B8ELG5|EFTU_METSB Elongation factor Tu OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=tuf PE=3 SV=1 282 594 6.0E-27
sp|A7HWP7|EFTU_PARL1 Elongation factor Tu OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=tuf1 PE=3 SV=1 282 711 6.0E-27
sp|Q0ID59|EFTU_SYNS3 Elongation factor Tu OS=Synechococcus sp. (strain CC9311) GN=tuf PE=3 SV=1 282 711 6.0E-27
sp|B6JN44|EFTU_HELP2 Elongation factor Tu OS=Helicobacter pylori (strain P12) GN=tuf PE=3 SV=1 282 613 8.0E-27
sp|P42477|EFTU_HERAU Elongation factor Tu OS=Herpetosiphon aurantiacus GN=tuf PE=3 SV=1 282 711 8.0E-27
sp|Q83ES6|EFTU_COXBU Elongation factor Tu OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=tufA PE=1 SV=1 282 613 9.0E-27
sp|A9NAK7|EFTU_COXBR Elongation factor Tu OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=tuf1 PE=3 SV=1 282 613 9.0E-27
sp|A9KD33|EFTU_COXBN Elongation factor Tu OS=Coxiella burnetii (strain Dugway 5J108-111) GN=tuf1 PE=3 SV=1 282 613 9.0E-27
sp|Q73SD1|EFTU_MYCPA Elongation factor Tu OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=tuf PE=3 SV=1 282 613 9.0E-27
sp|A0QL35|EFTU_MYCA1 Elongation factor Tu OS=Mycobacterium avium (strain 104) GN=tuf PE=3 SV=1 282 613 9.0E-27
sp|P42474|EFTU_CELLY Elongation factor Tu OS=Cellulophaga lytica GN=tuf PE=3 SV=1 282 614 1.0E-26
sp|A6KYK9|EFTU_BACV8 Elongation factor Tu OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=tuf PE=3 SV=1 282 614 1.0E-26
sp|P29544|EFTU3_STRRA Elongation factor Tu-3 OS=Streptomyces ramocissimus GN=tuf3 PE=3 SV=1 282 632 1.0E-26
sp|A6LE88|EFTU_PARD8 Elongation factor Tu OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=tuf PE=3 SV=1 282 614 1.0E-26
sp|P18906|EFTU_MYCGA Elongation factor Tu OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=tuf PE=3 SV=1 282 593 1.0E-26
sp|A5D5I8|EFTU2_PELTS Elongation factor Tu 2 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=tuf2 PE=3 SV=1 282 593 1.0E-26
sp|Q9MUP0|EFTU_MESVI Elongation factor Tu, chloroplastic OS=Mesostigma viride GN=tufA PE=3 SV=1 282 711 1.0E-26
sp|P29542|EFTU1_STRRA Elongation factor Tu-1 OS=Streptomyces ramocissimus GN=tuf1 PE=3 SV=1 282 613 1.0E-26
sp|Q3A9R3|EFTU1_CARHZ Elongation factor Tu 1 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=tuf1 PE=3 SV=1 282 593 1.0E-26
sp|P52978|NODQ_RHITR Bifunctional enzyme NodQ OS=Rhizobium tropici GN=nodQ PE=3 SV=1 270 542 1.0E-26
sp|B9IZJ2|EFTU_BACCQ Elongation factor Tu OS=Bacillus cereus (strain Q1) GN=tuf PE=3 SV=1 282 613 1.0E-26
sp|B7HQU2|EFTU_BACC7 Elongation factor Tu OS=Bacillus cereus (strain AH187) GN=tuf PE=3 SV=1 282 613 1.0E-26
sp|Q73F98|EFTU_BACC1 Elongation factor Tu OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=tuf PE=3 SV=1 282 613 1.0E-26
sp|Q07KJ2|EFTU_RHOP5 Elongation factor Tu OS=Rhodopseudomonas palustris (strain BisA53) GN=tuf1 PE=3 SV=1 282 594 2.0E-26
sp|A8LC58|EFTU_FRASN Elongation factor Tu OS=Frankia sp. (strain EAN1pec) GN=tuf PE=3 SV=1 282 613 2.0E-26
sp|Q8UH69|CYSN_AGRFC Sulfate adenylyltransferase subunit 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysN PE=3 SV=1 285 548 2.0E-26
sp|Q1QN32|EFTU_NITHX Elongation factor Tu OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=tuf PE=3 SV=1 282 594 2.0E-26
sp|B8DLL9|EFTU_DESVM Elongation factor Tu OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=tuf PE=3 SV=1 282 613 2.0E-26
sp|Q03F25|EFTU_PEDPA Elongation factor Tu OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=tuf PE=3 SV=1 282 613 2.0E-26
sp|A5DN78|EFTU_PICGU Elongation factor Tu, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TUF1 PE=3 SV=1 282 594 2.0E-26
sp|P02991|EFTU_EUGGR Elongation factor Tu, chloroplastic OS=Euglena gracilis GN=tufA PE=1 SV=1 282 613 2.0E-26
sp|B2GIL2|EFTU_KOCRD Elongation factor Tu OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=tuf PE=3 SV=1 282 613 2.0E-26
sp|A5WH42|EFTU2_PSYWF Elongation factor Tu 2 OS=Psychrobacter sp. (strain PRwf-1) GN=tuf2 PE=3 SV=1 282 613 2.0E-26
sp|Q6HPR0|EFTU_BACHK Elongation factor Tu OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=tuf PE=3 SV=1 282 613 2.0E-26
sp|Q63H92|EFTU_BACCZ Elongation factor Tu OS=Bacillus cereus (strain ZK / E33L) GN=tuf PE=3 SV=1 282 613 2.0E-26
sp|Q814C4|EFTU_BACCR Elongation factor Tu OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=tuf PE=3 SV=1 282 613 2.0E-26
sp|B7HJ46|EFTU_BACC4 Elongation factor Tu OS=Bacillus cereus (strain B4264) GN=tuf PE=3 SV=1 282 613 2.0E-26
sp|C1ET37|EFTU_BACC3 Elongation factor Tu OS=Bacillus cereus (strain 03BB102) GN=tuf PE=3 SV=1 282 613 2.0E-26
sp|B7JKB7|EFTU_BACC0 Elongation factor Tu OS=Bacillus cereus (strain AH820) GN=tuf PE=3 SV=1 282 613 2.0E-26
sp|Q81VT2|EFTU_BACAN Elongation factor Tu OS=Bacillus anthracis GN=tuf PE=3 SV=1 282 613 2.0E-26
sp|A0R8H8|EFTU_BACAH Elongation factor Tu OS=Bacillus thuringiensis (strain Al Hakam) GN=tuf PE=3 SV=1 282 613 2.0E-26
sp|C3LJ80|EFTU_BACAC Elongation factor Tu OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=tuf PE=3 SV=1 282 613 2.0E-26
sp|C3P9Q3|EFTU_BACAA Elongation factor Tu OS=Bacillus anthracis (strain A0248) GN=tuf PE=3 SV=1 282 613 2.0E-26
sp|Q8A463|EFTU_BACTN Elongation factor Tu OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=tuf PE=3 SV=1 282 614 2.0E-26
sp|B3PMU1|EFTU_MYCA5 Elongation factor Tu OS=Mycoplasma arthritidis (strain 158L3-1) GN=tuf PE=3 SV=1 282 711 2.0E-26
sp|P26184|EFTU_FLESI Elongation factor Tu OS=Flexistipes sinusarabici GN=tuf PE=3 SV=1 282 593 2.0E-26
sp|A7I3U7|EFTU_CAMHC Elongation factor Tu OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=tuf PE=3 SV=1 282 711 2.0E-26
sp|Q0RRS3|EFTU_FRAAA Elongation factor Tu OS=Frankia alni (strain ACN14a) GN=tuf PE=3 SV=1 282 613 2.0E-26
sp|Q4A7K0|EFTU_MYCH7 Elongation factor Tu OS=Mycoplasma hyopneumoniae (strain 7448) GN=tuf PE=3 SV=1 282 614 2.0E-26
sp|Q600B6|EFTU_MYCH2 Elongation factor Tu OS=Mycoplasma hyopneumoniae (strain 232) GN=tuf PE=3 SV=1 282 614 2.0E-26
sp|A7GK18|EFTU_BACCN Elongation factor Tu OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=tuf PE=3 SV=1 282 613 2.0E-26
sp|Q5FKR8|EFTU_LACAC Elongation factor Tu OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=tuf PE=3 SV=1 282 614 2.0E-26
sp|A8YUS2|EFTU_LACH4 Elongation factor Tu OS=Lactobacillus helveticus (strain DPC 4571) GN=tuf PE=3 SV=1 282 614 2.0E-26
sp|P46280|EFTU2_SOYBN Elongation factor Tu, chloroplastic OS=Glycine max GN=TUFB1 PE=3 SV=1 282 594 2.0E-26
sp|P22679|EFTU_MYCHP Elongation factor Tu OS=Mycoplasma hominis (strain ATCC 23114 / NBRC 14850 / NCTC 10111 / PG21) GN=tuf PE=1 SV=1 282 614 2.0E-26
sp|A8Z5T8|EFTU_SULMW Elongation factor Tu OS=Sulcia muelleri (strain GWSS) GN=tuf PE=3 SV=1 277 614 2.0E-26
sp|Q9Y700|EFTU_SCHPO Elongation factor Tu, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tuf1 PE=3 SV=1 282 593 3.0E-26
sp|Q17VM8|EFTU_HELAH Elongation factor Tu OS=Helicobacter acinonychis (strain Sheeba) GN=tuf PE=3 SV=1 282 613 3.0E-26
sp|Q4A9G1|EFTU_MYCHJ Elongation factor Tu OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=tuf PE=3 SV=1 282 614 3.0E-26
sp|Q748X8|EFTU_GEOSL Elongation factor Tu OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=tuf1 PE=3 SV=1 282 594 3.0E-26
sp|Q1KVS9|EFTU_ACUOB Elongation factor Tu, chloroplastic OS=Acutodesmus obliquus GN=tufA PE=3 SV=1 282 711 3.0E-26
sp|P60339|EFTU2_THET8 Elongation factor Tu-B OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=tufB PE=1 SV=2 279 614 3.0E-26
sp|Q8KHX9|EFTU_BARHE Elongation factor Tu OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=tuf1 PE=3 SV=1 282 594 3.0E-26
sp|P42480|EFTU_HYMOC Elongation factor Tu OS=Hymenobacter ocellatus GN=tuf PE=3 SV=1 282 594 3.0E-26
sp|Q85FT7|EFTU_CYAME Elongation factor Tu, chloroplastic OS=Cyanidioschyzon merolae GN=tufA PE=3 SV=1 282 711 3.0E-26
sp|A5WGK9|EFTU1_PSYWF Elongation factor Tu 1 OS=Psychrobacter sp. (strain PRwf-1) GN=tuf1 PE=3 SV=1 282 613 3.0E-26
sp|B6YQ04|EFTU_AZOPC Elongation factor Tu OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=tuf PE=3 SV=1 282 711 4.0E-26
sp|A1T4L6|EFTU_MYCVP Elongation factor Tu OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=tuf PE=3 SV=1 282 594 4.0E-26
sp|Q211E6|EFTU_RHOPB Elongation factor Tu OS=Rhodopseudomonas palustris (strain BisB18) GN=tuf PE=3 SV=1 282 594 4.0E-26
sp|A0PM42|EFTU_MYCUA Elongation factor Tu OS=Mycobacterium ulcerans (strain Agy99) GN=tuf PE=3 SV=1 282 613 4.0E-26
sp|B2HSL3|EFTU_MYCMM Elongation factor Tu OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=tuf PE=3 SV=1 282 613 4.0E-26
sp|B8D9K1|CYSN_BUCA5 Sulfate adenylyltransferase subunit 1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=cysN PE=3 SV=1 291 705 4.0E-26
sp|Q826Z7|EFTU2_STRAW Elongation factor Tu 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=tuf2 PE=3 SV=1 282 616 4.0E-26
sp|Q2JFH8|EFTU_FRASC Elongation factor Tu OS=Frankia sp. (strain CcI3) GN=tuf PE=3 SV=1 282 613 4.0E-26
sp|A5D5K0|EFTU1_PELTS Elongation factor Tu 1 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=tuf1 PE=3 SV=1 282 593 4.0E-26
sp|Q1BDD3|EFTU_MYCSS Elongation factor Tu OS=Mycobacterium sp. (strain MCS) GN=tuf PE=3 SV=1 282 613 4.0E-26
sp|A1UBL1|EFTU_MYCSK Elongation factor Tu OS=Mycobacterium sp. (strain KMS) GN=tuf PE=3 SV=1 282 613 4.0E-26
sp|A3PV96|EFTU_MYCSJ Elongation factor Tu OS=Mycobacterium sp. (strain JLS) GN=tuf PE=3 SV=1 282 613 4.0E-26
sp|Q6AP73|EFTU2_DESPS Elongation factor Tu 2 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=tuf2 PE=3 SV=1 282 593 4.0E-26
sp|Q2IXR2|EFTU_RHOP2 Elongation factor Tu OS=Rhodopseudomonas palustris (strain HaA2) GN=tuf1 PE=3 SV=1 282 594 4.0E-26
sp|Q7VA05|EFTU_PROMA Elongation factor Tu OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=tuf PE=3 SV=1 282 711 5.0E-26
sp|Q9Z9A7|EFTU_CHLPN Elongation factor Tu OS=Chlamydia pneumoniae GN=tuf PE=3 SV=3 282 710 5.0E-26
sp|A6LPP6|EFTU_CLOB8 Elongation factor Tu OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=tuf1 PE=3 SV=1 282 614 5.0E-26
sp|A0L5V8|EFTU_MAGMM Elongation factor Tu OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=tuf1 PE=3 SV=1 282 595 5.0E-26
sp|Q1H4N9|EFTU2_METFK Elongation factor Tu 2 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=tuf2 PE=3 SV=1 282 613 5.0E-26
sp|Q3A9P8|EFTU2_CARHZ Elongation factor Tu 2 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=tuf2 PE=3 SV=1 282 593 5.0E-26
sp|Q7U4D1|EFTU_SYNPX Elongation factor Tu OS=Synechococcus sp. (strain WH8102) GN=tuf PE=3 SV=1 282 711 5.0E-26
sp|P42473|EFTU_CHLP8 Elongation factor Tu OS=Chlorobaculum parvum (strain NCIB 8327) GN=tuf PE=3 SV=1 282 711 5.0E-26
sp|Q38WR7|EFTU_LACSS Elongation factor Tu OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=tuf PE=3 SV=1 282 594 6.0E-26
sp|Q72GW4|EFTU_THET2 Elongation factor Tu OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=tuf1 PE=3 SV=1 279 614 6.0E-26
sp|Q2JMX7|EFTU_SYNJB Elongation factor Tu OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=tuf PE=3 SV=1 282 711 6.0E-26
sp|C4Z2R9|EFTU_EUBE2 Elongation factor Tu OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=tuf PE=3 SV=1 282 613 6.0E-26
sp|A1JS52|EFTU2_YERE8 Elongation factor Tu 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=tuf2 PE=3 SV=1 282 613 7.0E-26
sp|P23568|EFTU_MYCPN Elongation factor Tu OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=tuf PE=3 SV=2 282 593 7.0E-26
sp|Q01698|EFTU_THEAQ Elongation factor Tu OS=Thermus aquaticus GN=tuf PE=1 SV=2 279 614 7.0E-26
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0097159 organic cyclic compound binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:1901363 heterocyclic compound binding No
GO:0019001 guanyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0043167 ion binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0003674 molecular_function No
GO:0017111 nucleoside-triphosphatase activity No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0016462 pyrophosphatase activity No
GO:0016787 hydrolase activity No
GO:0000166 nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1503
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|117
Ophiocordyceps australis map64 (Brazil) OphauB2|7031
Ophiocordyceps camponoti-floridani Ophcf2|01144
Ophiocordyceps camponoti-rufipedis Ophun1|87 (this protein)
Ophiocordyceps kimflemingae Ophio5|6434
Ophiocordyceps subramaniannii Hirsu2|11157

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|87
MADLNSWEDDPAAQDEDLSRQAAQQLNVNAQNPAAPAGFRPNVASFHPGAQTFQPGQAYGGNFMPQYQQQQFYPQ
GYYPQYGQPQGFNQYSQGYGQGYGQGYGQAYGGSYPQYGHQNQQNPQQPPQPQPPAAAQQTPKQAAADNHATSSS
VKPVLTKEGGPKVLSIGGDAATTKPKAKVLSIGGTTKEKEDAKAETKTEPSDEPEAGQKAAAVKAIGKTGEKAGK
AAAGASKTSGKTSPTPSSGRSSPVGSGEKKPQRDVDAVTKEQAADVDEETLKEIYGKEHVNIIFIGHVDAGKSTL
GGSILWSTGMVDERTMEKYKKEAKDMGRESWYLSWVMDLTKEERSKGKTVEVGRGFFDTEKRRYSILDAPGHKTY
VPSMIGGASQADVGILVISARKGEYETGFERGGQTREHAMLAKTQGVNKLVVVINKMDDATVEWSHERYQECITK
LSQFLKATGYNLKTDVFFMPVAAQQSLNIKDRLPKGVAPWWDGPSLLEYLDDMKALERKVNAPFMMPINAKYRDM
GTMVDGKIEAGVVKKGMSLTMMPRKQSVEAAAIYGEQEDEVPILQCGDQVRMRLKGIEEEDILPGFVLCSTKRLV
HCVAEFEAQIRILELKSILTSGFNCVLHVHSAIEEVTFAALLHKLQKGTNRKSKMPPTHAKKGDSIIARMQVIGG
AGSVCVERFEDYPQMGRFTLRDQGQTIAIGKITRLITDEGN*
Coding >Ophun1|87
ATGGCAGATCTCAACTCGTGGGAGGACGACCCGGCCGCTCAGGACGAGGATCTCTCGAGACAGGCGGCTCAACAA
CTCAATGTGAACGCTCAAAACCCCGCGGCCCCGGCCGGCTTTCGACCCAATGTCGCCTCCTTTCACCCTGGCGCT
CAAACCTTTCAGCCGGGGCAGGCATACGGAGGAAACTTCATGCCGCAGTATCAACAGCAGCAATTCTATCCGCAA
GGCTACTATCCTCAATATGGTCAGCCCCAAGGCTTCAACCAGTACAGCCAGGGCTACGGCCAAGGATACGGCCAA
GGCTACGGTCAAGCTTATGGTGGTAGTTACCCTCAATACGGCCATCAGAACCAGCAGAACCCTCAGCAACCGCCT
CAACCACAGCCGCCCGCAGCTGCCCAGCAGACTCCCAAGCAAGCTGCAGCTGACAACCACGCCACGTCGTCGAGC
GTCAAGCCGGTACTGACGAAGGAAGGCGGTCCCAAAGTGCTAAGCATCGGCGGCGACGCGGCTACTACAAAGCCC
AAAGCCAAGGTCCTCTCCATCGGCGGCACTACCAAAGAAAAGGAAGATGCCAAGGCCGAGACCAAGACGGAGCCG
TCGGACGAGCCCGAAGCCGGGCAAAAGGCGGCAGCAGTCAAGGCCATCGGGAAAACCGGCGAGAAAGCGGGCAAG
GCCGCAGCAGGCGCCTCCAAGACGTCGGGAAAGACATCGCCGACACCATCTTCCGGCCGTTCGAGTCCGGTGGGC
TCGGGCGAGAAGAAGCCGCAGCGTGATGTAGACGCCGTCACCAAGGAGCAGGCCGCCGATGTGGACGAGGAGACG
CTCAAGGAGATTTACGGCAAGGAGCACGTCAACATCATCTTCATCGGCCACGTCGACGCCGGCAAATCTACTCTG
GGTGGCTCCATTCTCTGGAGCACCGGCATGGTGGACGAGAGGACCATGGAAAAGTATAAGAAGGAGGCCAAGGAC
ATGGGCCGCGAGTCCTGGTATCTGTCGTGGGTTATGGATCTGACCAAGGAAGAGCGCTCCAAGGGAAAGACGGTG
GAAGTTGGCAGAGGCTTTTTCGACACGGAGAAGCGCAGATACAGCATTCTGGACGCACCCGGGCACAAGACATAT
GTGCCGAGCATGATCGGAGGTGCCTCGCAGGCTGACGTGGGCATCCTCGTCATCTCGGCGCGCAAGGGCGAATAC
GAGACGGGATTCGAACGAGGCGGGCAGACGCGGGAGCACGCGATGCTGGCCAAGACGCAGGGCGTCAACAAGCTG
GTCGTGGTCATCAACAAGATGGACGACGCTACGGTCGAGTGGTCGCACGAGCGATATCAGGAGTGCATCACGAAG
CTCTCGCAGTTCCTCAAGGCGACCGGGTACAACCTCAAGACGGACGTCTTCTTCATGCCCGTGGCGGCGCAGCAG
TCGCTCAACATCAAGGATCGACTGCCCAAGGGAGTGGCGCCGTGGTGGGATGGGCCGTCGCTGCTGGAGTACCTG
GACGACATGAAGGCGCTGGAGCGCAAGGTCAACGCGCCCTTTATGATGCCCATCAACGCCAAGTACCGAGACATG
GGCACCATGGTGGACGGCAAGATCGAGGCGGGCGTGGTGAAGAAGGGCATGAGCCTGACGATGATGCCGCGCAAG
CAGTCGGTGGAGGCGGCGGCCATCTACGGCGAGCAGGAAGACGAGGTGCCGATCCTGCAGTGCGGCGATCAGGTG
CGGATGCGACTCAAGGGCATCGAGGAGGAAGACATTCTGCCCGGGTTCGTGCTGTGCTCGACCAAGAGGCTGGTG
CACTGCGTGGCCGAGTTTGAGGCGCAGATTCGGATCCTGGAGCTCAAGAGCATCCTGACGTCGGGCTTCAACTGC
GTGCTGCACGTGCACTCGGCCATTGAAGAGGTGACGTTTGCGGCTCTCCTGCACAAGCTGCAGAAGGGAACCAAC
CGGAAGAGCAAGATGCCGCCGACGCACGCCAAGAAGGGAGACAGCATCATTGCGCGGATGCAGGTGATTGGAGGT
GCCGGCTCCGTGTGCGTGGAGAGGTTCGAAGACTACCCTCAGATGGGCCGCTTCACGTTGCGAGACCAGGGACAG
ACGATTGCCATCGGAAAGATCACCAGGCTCATTACCGACGAGGGAAACTGA
Transcript >Ophun1|87
ATGGCAGATCTCAACTCGTGGGAGGACGACCCGGCCGCTCAGGACGAGGATCTCTCGAGACAGGCGGCTCAACAA
CTCAATGTGAACGCTCAAAACCCCGCGGCCCCGGCCGGCTTTCGACCCAATGTCGCCTCCTTTCACCCTGGCGCT
CAAACCTTTCAGCCGGGGCAGGCATACGGAGGAAACTTCATGCCGCAGTATCAACAGCAGCAATTCTATCCGCAA
GGCTACTATCCTCAATATGGTCAGCCCCAAGGCTTCAACCAGTACAGCCAGGGCTACGGCCAAGGATACGGCCAA
GGCTACGGTCAAGCTTATGGTGGTAGTTACCCTCAATACGGCCATCAGAACCAGCAGAACCCTCAGCAACCGCCT
CAACCACAGCCGCCCGCAGCTGCCCAGCAGACTCCCAAGCAAGCTGCAGCTGACAACCACGCCACGTCGTCGAGC
GTCAAGCCGGTACTGACGAAGGAAGGCGGTCCCAAAGTGCTAAGCATCGGCGGCGACGCGGCTACTACAAAGCCC
AAAGCCAAGGTCCTCTCCATCGGCGGCACTACCAAAGAAAAGGAAGATGCCAAGGCCGAGACCAAGACGGAGCCG
TCGGACGAGCCCGAAGCCGGGCAAAAGGCGGCAGCAGTCAAGGCCATCGGGAAAACCGGCGAGAAAGCGGGCAAG
GCCGCAGCAGGCGCCTCCAAGACGTCGGGAAAGACATCGCCGACACCATCTTCCGGCCGTTCGAGTCCGGTGGGC
TCGGGCGAGAAGAAGCCGCAGCGTGATGTAGACGCCGTCACCAAGGAGCAGGCCGCCGATGTGGACGAGGAGACG
CTCAAGGAGATTTACGGCAAGGAGCACGTCAACATCATCTTCATCGGCCACGTCGACGCCGGCAAATCTACTCTG
GGTGGCTCCATTCTCTGGAGCACCGGCATGGTGGACGAGAGGACCATGGAAAAGTATAAGAAGGAGGCCAAGGAC
ATGGGCCGCGAGTCCTGGTATCTGTCGTGGGTTATGGATCTGACCAAGGAAGAGCGCTCCAAGGGAAAGACGGTG
GAAGTTGGCAGAGGCTTTTTCGACACGGAGAAGCGCAGATACAGCATTCTGGACGCACCCGGGCACAAGACATAT
GTGCCGAGCATGATCGGAGGTGCCTCGCAGGCTGACGTGGGCATCCTCGTCATCTCGGCGCGCAAGGGCGAATAC
GAGACGGGATTCGAACGAGGCGGGCAGACGCGGGAGCACGCGATGCTGGCCAAGACGCAGGGCGTCAACAAGCTG
GTCGTGGTCATCAACAAGATGGACGACGCTACGGTCGAGTGGTCGCACGAGCGATATCAGGAGTGCATCACGAAG
CTCTCGCAGTTCCTCAAGGCGACCGGGTACAACCTCAAGACGGACGTCTTCTTCATGCCCGTGGCGGCGCAGCAG
TCGCTCAACATCAAGGATCGACTGCCCAAGGGAGTGGCGCCGTGGTGGGATGGGCCGTCGCTGCTGGAGTACCTG
GACGACATGAAGGCGCTGGAGCGCAAGGTCAACGCGCCCTTTATGATGCCCATCAACGCCAAGTACCGAGACATG
GGCACCATGGTGGACGGCAAGATCGAGGCGGGCGTGGTGAAGAAGGGCATGAGCCTGACGATGATGCCGCGCAAG
CAGTCGGTGGAGGCGGCGGCCATCTACGGCGAGCAGGAAGACGAGGTGCCGATCCTGCAGTGCGGCGATCAGGTG
CGGATGCGACTCAAGGGCATCGAGGAGGAAGACATTCTGCCCGGGTTCGTGCTGTGCTCGACCAAGAGGCTGGTG
CACTGCGTGGCCGAGTTTGAGGCGCAGATTCGGATCCTGGAGCTCAAGAGCATCCTGACGTCGGGCTTCAACTGC
GTGCTGCACGTGCACTCGGCCATTGAAGAGGTGACGTTTGCGGCTCTCCTGCACAAGCTGCAGAAGGGAACCAAC
CGGAAGAGCAAGATGCCGCCGACGCACGCCAAGAAGGGAGACAGCATCATTGCGCGGATGCAGGTGATTGGAGGT
GCCGGCTCCGTGTGCGTGGAGAGGTTCGAAGACTACCCTCAGATGGGCCGCTTCACGTTGCGAGACCAGGGACAG
ACGATTGCCATCGGAAAGATCACCAGGCTCATTACCGACGAGGGAAACTGA
Gene >Ophun1|87
ATGGCAGATCTCAACTCGTGGGAGGACGACCCGGCCGCTCAGGACGAGGATCTCTCGAGACAGGCGGCTCAACAA
CTCAATGTGAACGCTCAAAACCCCGCGGCCCCGGCCGGCTTTCGACCCAATGTCGCCTCCTTTCACCCTGGCGCT
CAAACCTTTCAGCCGGGGCAGGCATACGGAGGAAACTTCATGCCGCAGTATCAACAGCAGCAATTCTATCCGCAA
GGCTACTATCCTCAATATGGTCAGCCCCAAGGCTTCAACCAGTACAGCCAGGGCTACGGCCAAGGATACGGCCAA
GGCTACGGTCAAGCTTATGGTATGCTGTTGCTTTCTCCCGCCCCTTGTCGGTAGACGCTCACTGGCGTCTTTAGG
TGGTAGTTACCCTCAATACGGCCATCAGAACCAGCAGAACCCTCAGCAACCGCCTCAACCACAGCCGCCCGCAGC
TGCCCAGCAGACTCCCAAGCAAGCTGCAGCTGACAACCACGCCACGTCGTCGAGCGTCAAGCCGGTACTGACGAA
GGAAGGCGGTCCCAAAGTGCTAAGCATCGGCGGCGACGCGGCTACTACAAAGCCCAAAGCCAAGGTCCTCTCCAT
CGGCGGCACTACCAAAGAAAAGGAAGATGCCAAGGCCGAGACCAAGACGGAGCCGTCGGACGAGCCCGAAGCCGG
GCAAAAGGCGGCAGCAGTCAAGGCCATCGGGAAAACCGGCGAGAAAGCGGGCAAGGCCGCAGCAGGCGCCTCCAA
GACGTCGGGAAAGACATCGCCGACACCATCTTCCGGCCGTTCGAGTCCGGTGGGCTCGGGCGAGAAGAAGCCGCA
GCGTGATGTAGACGCCGTCACCAAGGAGCAGGCCGCCGATGTGGACGAGGAGACGCTCAAGGAGATTTACGGCAA
GGAGCACGTCAACATCATCTTCATCGGCCACGTCGACGCCGGCAAATCTACTCTGGGTGGCTCCATTCTCTGGAG
CACCGGCATGGTGGACGAGAGGACCATGGAAAAGTATAAGAAGGAGGCCAAGGACATGGGCCGCGAGTCCTGGTA
TCTGTCGTGGGTTATGGATCTGACCAAGGAAGAGCGCTCCAAGGGAAAGACGGTGGAAGTTGGCAGAGGCTTTTT
CGACACGGAGAAGCGCAGATACAGCATTCTGGACGCACCCGGGCACAAGACATATGTGCCGAGCATGATCGGAGG
TGCCTCGCAGGCTGACGTGGGCATCCTCGTCATCTCGGCGCGCAAGGGCGAATACGAGACGGGATTCGAACGAGG
CGGGCAGACGCGGGAGCACGCGATGCTGGCCAAGACGCAGGGCGTCAACAAGCTGGTCGTGGTCATCAACAAGAT
GGACGACGCTACGGTCGAGTGGTCGCACGAGCGATATCAGGAGTGCATCACGAAGCTCTCGCAGTTCCTCAAGGC
GACCGGGTACAACCTCAAGACGGACGTCTTCTTCATGCCCGTGGCGGCGCAGCAGTCGCTCAACATCAAGGATCG
ACTGCCCAAGGGAGTGGCGCCGTGGTGGGATGGGCCGTCGCTGCTGGAGTACCTGGACGACATGAAGGCGCTGGA
GCGCAAGGTCAACGCGCCCTTTATGATGCCCATCAACGCCAAGTACCGAGACATGGGCACCATGGTGGACGGCAA
GATCGAGGCGGGCGTGGTGAAGAAGGGCATGAGCCTGACGATGATGCCGCGCAAGCAGTCGGTGGAGGCGGCGGC
CATCTACGGCGAGCAGGAAGACGAGGTGCCGATCCTGCAGTGCGGCGATCAGGTGCGGATGCGACTCAAGGGCAT
CGAGGAGGAAGACATTCTGCCCGGGTTCGTGCTGTGCTCGACCAAGAGGCTGGTGCACTGCGTGGCCGAGTTTGA
GGCGCAGATTCGGATCCTGGAGCTCAAGAGCATCCTGACGTCGGGCTTCAACTGCGTGCTGCACGTGCACTCGGC
CATTGAAGAGGTGACGTTTGCGGCTCTCCTGCACAAGCTGCAGAAGGGAACCAACCGGAAGAGCAAGATGCCGCC
GACGCACGCCAAGAAGGGAGACAGCATCATTGCGCGGATGCAGGTGATTGGAGGTGCCGGCTCCGTGTGCGTGGA
GAGGTTCGAAGACTACCCTCAGATGGGCCGCTTCACGTTGCGAGACCAGGTAGGCCGAGGCCGGAGATGGGAGCG
GCATTGGGCGATGCTGACACTTTTGGGGTAACAGGGACAGACGATTGCCATCGGAAAGATCACCAGGCTCATTAC
CGACGAGGGAAACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail