Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|860
Gene name
LocationContig_130:2879..4088
Strand+
Gene length (bp)1209
Transcript length (bp)1209
Coding sequence length (bp)1209
Protein length (aa) 403

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01137 RTC RNA 3'-terminal phosphate cyclase 1.0E-26 10 350
PF05189 RTC_insert RNA 3'-terminal phosphate cyclase (RTC), insert domain 5.1E-25 208 318

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9JJT0|RCL1_MOUSE RNA 3'-terminal phosphate cyclase-like protein OS=Mus musculus GN=Rcl1 PE=2 SV=1 1 401 6.0E-55
sp|Q9Y2P8|RCL1_HUMAN RNA 3'-terminal phosphate cyclase-like protein OS=Homo sapiens GN=RCL1 PE=1 SV=3 1 401 1.0E-53
sp|Q2KHX8|RCL1_BOVIN RNA 3'-terminal phosphate cyclase-like protein OS=Bos taurus GN=RCL1 PE=2 SV=1 1 401 1.0E-53
sp|Q08096|RCL1_YEAST RNA 3'-terminal phosphate cyclase-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RCL1 PE=1 SV=1 2 402 3.0E-53
sp|Q09870|RCL1_SCHPO Probable RNA 3'-terminal phosphate cyclase-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC12G12.06c PE=3 SV=1 3 401 2.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9JJT0|RCL1_MOUSE RNA 3'-terminal phosphate cyclase-like protein OS=Mus musculus GN=Rcl1 PE=2 SV=1 1 401 6.0E-55
sp|Q9Y2P8|RCL1_HUMAN RNA 3'-terminal phosphate cyclase-like protein OS=Homo sapiens GN=RCL1 PE=1 SV=3 1 401 1.0E-53
sp|Q2KHX8|RCL1_BOVIN RNA 3'-terminal phosphate cyclase-like protein OS=Bos taurus GN=RCL1 PE=2 SV=1 1 401 1.0E-53
sp|Q08096|RCL1_YEAST RNA 3'-terminal phosphate cyclase-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RCL1 PE=1 SV=1 2 402 3.0E-53
sp|Q09870|RCL1_SCHPO Probable RNA 3'-terminal phosphate cyclase-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC12G12.06c PE=3 SV=1 3 401 2.0E-42
sp|Q54S38|RCL1_DICDI Probable RNA 3'-terminal phosphate cyclase-like protein OS=Dictyostelium discoideum GN=rcl1 PE=1 SV=2 7 399 1.0E-38
sp|Q23400|RCL1_CAEEL Probable RNA 3'-terminal phosphate cyclase-like protein OS=Caenorhabditis elegans GN=ZK1127.5 PE=3 SV=2 1 399 1.0E-37
sp|P56175|RCL1_DROME Probable RNA 3'-terminal phosphate cyclase-like protein OS=Drosophila melanogaster GN=Rtc1 PE=2 SV=3 10 392 2.0E-35
sp|Q9C578|RCL1_ARATH Probable RNA 3'-terminal phosphate cyclase-like protein OS=Arabidopsis thaliana GN=At5g22100 PE=2 SV=1 9 402 6.0E-33
sp|Q2HJ88|RTCA_BOVIN RNA 3'-terminal phosphate cyclase OS=Bos taurus GN=RTCA PE=2 SV=1 22 396 2.0E-08
sp|Q4R3J0|RTCA_MACFA RNA 3'-terminal phosphate cyclase OS=Macaca fascicularis GN=RTCA PE=2 SV=1 22 347 4.0E-08
sp|A1RSJ7|RTCA_PYRIL RNA 3'-terminal phosphate cyclase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rtcA PE=3 SV=1 20 338 5.0E-08
sp|O00442|RTCA_HUMAN RNA 3'-terminal phosphate cyclase OS=Homo sapiens GN=RTCA PE=1 SV=1 22 396 1.0E-07
sp|A3MXQ7|RTCA_PYRCJ RNA 3'-terminal phosphate cyclase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rtcA PE=3 SV=1 20 350 4.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4066
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4048
Ophiocordyceps australis map64 (Brazil) OphauB2|4933
Ophiocordyceps camponoti-floridani Ophcf2|07344
Ophiocordyceps camponoti-rufipedis Ophun1|860 (this protein)
Ophiocordyceps kimflemingae Ophio5|1523
Ophiocordyceps subramaniannii Hirsu2|8198

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|860
MSSNTEFIRFMGHTAFSRRLTIATLLGRPVHISKIRVAWPTSPGLAPHHISFLRLLEAVTNGSSIQISFTGTTIT
YRPGLITGTVAGQGATEGDVIVHNIPESNTRGVTYYLLPLCLLAPFSKAHMNVRFSGPGVITSATEEGDVSIDTF
RTAIIPLFGLFGIPPARIELRVLQRSCPGAEGRGGGGCVEFRFAGQVRLPKTLHFHRDAGRVKRIRGVAYSTGVS
ASNNSRMIQTVREKLKSFCADIQIAAQYDKAPLVATGKEGEKRRLGIGFGLSLVAESSTPGVFYSADKVTPPSGH
TVPEEIGRDCVNQLLASIKLGGCVSEVSSSIVLVLMSLGSEDVGRVRIAEGVFASKHHWRLARDLRMFGAHPWGL
RDAGNTAHDMIVTVKGAGVGNVGRKMA*
Coding >Ophun1|860
ATGTCGTCCAACACCGAGTTCATACGGTTCATGGGCCACACTGCATTTAGTCGGCGCCTAACAATCGCAACTCTT
CTCGGTCGTCCCGTTCACATCTCCAAGATCCGCGTCGCGTGGCCCACGAGCCCGGGTCTCGCTCCCCATCACATC
TCCTTCTTACGACTTCTCGAGGCCGTCACAAATGGCAGCTCGATACAAATCTCCTTCACAGGCACCACCATCACG
TATCGTCCCGGGCTGATAACGGGAACCGTCGCCGGCCAGGGCGCCACCGAGGGCGACGTGATTGTGCACAATATC
CCCGAGTCTAACACGAGGGGCGTCACATACTATCTACTACCGCTATGCCTACTGGCGCCCTTCTCTAAAGCACAC
ATGAACGTTCGCTTTTCGGGTCCGGGTGTCATTACCTCGGCCACCGAGGAGGGCGACGTCTCCATCGACACGTTC
CGGACCGCCATCATACCTCTTTTCGGCCTGTTCGGCATCCCGCCCGCGAGGATCGAACTCAGGGTGCTGCAACGG
TCCTGCCCCGGCGCAGAAGGCCGAGGCGGCGGCGGCTGCGTCGAATTCCGCTTTGCAGGCCAGGTGCGGCTGCCC
AAGACGCTGCATTTTCACAGAGATGCCGGTCGAGTCAAGAGGATCAGGGGCGTCGCTTATAGCACCGGTGTCTCG
GCGTCCAACAACTCTCGCATGATCCAGACTGTCCGCGAAAAACTAAAGTCCTTTTGCGCCGACATCCAAATTGCC
GCGCAATACGACAAGGCCCCGCTGGTGGCCACGGGCAAGGAGGGTGAGAAGCGGAGGCTCGGCATCGGTTTCGGA
TTGAGCTTGGTGGCCGAGTCGAGCACTCCTGGCGTCTTCTATTCGGCAGACAAGGTGACGCCTCCATCGGGTCAT
ACTGTGCCCGAGGAAATCGGAAGAGATTGTGTGAACCAGCTGCTCGCGTCTATTAAGCTGGGCGGCTGCGTGAGC
GAAGTCTCCAGTTCCATCGTCTTGGTCCTCATGTCCCTGGGTTCGGAAGACGTCGGACGTGTGAGAATAGCCGAG
GGCGTTTTCGCGTCAAAACATCATTGGCGGCTGGCGAGGGACTTGCGAATGTTCGGCGCGCATCCCTGGGGTTTG
AGAGATGCGGGGAACACAGCCCATGATATGATTGTTACTGTCAAGGGAGCCGGCGTCGGTAATGTAGGCAGAAAG
ATGGCATAG
Transcript >Ophun1|860
ATGTCGTCCAACACCGAGTTCATACGGTTCATGGGCCACACTGCATTTAGTCGGCGCCTAACAATCGCAACTCTT
CTCGGTCGTCCCGTTCACATCTCCAAGATCCGCGTCGCGTGGCCCACGAGCCCGGGTCTCGCTCCCCATCACATC
TCCTTCTTACGACTTCTCGAGGCCGTCACAAATGGCAGCTCGATACAAATCTCCTTCACAGGCACCACCATCACG
TATCGTCCCGGGCTGATAACGGGAACCGTCGCCGGCCAGGGCGCCACCGAGGGCGACGTGATTGTGCACAATATC
CCCGAGTCTAACACGAGGGGCGTCACATACTATCTACTACCGCTATGCCTACTGGCGCCCTTCTCTAAAGCACAC
ATGAACGTTCGCTTTTCGGGTCCGGGTGTCATTACCTCGGCCACCGAGGAGGGCGACGTCTCCATCGACACGTTC
CGGACCGCCATCATACCTCTTTTCGGCCTGTTCGGCATCCCGCCCGCGAGGATCGAACTCAGGGTGCTGCAACGG
TCCTGCCCCGGCGCAGAAGGCCGAGGCGGCGGCGGCTGCGTCGAATTCCGCTTTGCAGGCCAGGTGCGGCTGCCC
AAGACGCTGCATTTTCACAGAGATGCCGGTCGAGTCAAGAGGATCAGGGGCGTCGCTTATAGCACCGGTGTCTCG
GCGTCCAACAACTCTCGCATGATCCAGACTGTCCGCGAAAAACTAAAGTCCTTTTGCGCCGACATCCAAATTGCC
GCGCAATACGACAAGGCCCCGCTGGTGGCCACGGGCAAGGAGGGTGAGAAGCGGAGGCTCGGCATCGGTTTCGGA
TTGAGCTTGGTGGCCGAGTCGAGCACTCCTGGCGTCTTCTATTCGGCAGACAAGGTGACGCCTCCATCGGGTCAT
ACTGTGCCCGAGGAAATCGGAAGAGATTGTGTGAACCAGCTGCTCGCGTCTATTAAGCTGGGCGGCTGCGTGAGC
GAAGTCTCCAGTTCCATCGTCTTGGTCCTCATGTCCCTGGGTTCGGAAGACGTCGGACGTGTGAGAATAGCCGAG
GGCGTTTTCGCGTCAAAACATCATTGGCGGCTGGCGAGGGACTTGCGAATGTTCGGCGCGCATCCCTGGGGTTTG
AGAGATGCGGGGAACACAGCCCATGATATGATTGTTACTGTCAAGGGAGCCGGCGTCGGTAATGTAGGCAGAAAG
ATGGCATAG
Gene >Ophun1|860
ATGTCGTCCAACACCGAGTTCATACGGTTCATGGGCCACACTGCATTTAGTCGGCGCCTAACAATCGCAACTCTT
CTCGGTCGTCCCGTTCACATCTCCAAGATCCGCGTCGCGTGGCCCACGAGCCCGGGTCTCGCTCCCCATCACATC
TCCTTCTTACGACTTCTCGAGGCCGTCACAAATGGCAGCTCGATACAAATCTCCTTCACAGGCACCACCATCACG
TATCGTCCCGGGCTGATAACGGGAACCGTCGCCGGCCAGGGCGCCACCGAGGGCGACGTGATTGTGCACAATATC
CCCGAGTCTAACACGAGGGGCGTCACATACTATCTACTACCGCTATGCCTACTGGCGCCCTTCTCTAAAGCACAC
ATGAACGTTCGCTTTTCGGGTCCGGGTGTCATTACCTCGGCCACCGAGGAGGGCGACGTCTCCATCGACACGTTC
CGGACCGCCATCATACCTCTTTTCGGCCTGTTCGGCATCCCGCCCGCGAGGATCGAACTCAGGGTGCTGCAACGG
TCCTGCCCCGGCGCAGAAGGCCGAGGCGGCGGCGGCTGCGTCGAATTCCGCTTTGCAGGCCAGGTGCGGCTGCCC
AAGACGCTGCATTTTCACAGAGATGCCGGTCGAGTCAAGAGGATCAGGGGCGTCGCTTATAGCACCGGTGTCTCG
GCGTCCAACAACTCTCGCATGATCCAGACTGTCCGCGAAAAACTAAAGTCCTTTTGCGCCGACATCCAAATTGCC
GCGCAATACGACAAGGCCCCGCTGGTGGCCACGGGCAAGGAGGGTGAGAAGCGGAGGCTCGGCATCGGTTTCGGA
TTGAGCTTGGTGGCCGAGTCGAGCACTCCTGGCGTCTTCTATTCGGCAGACAAGGTGACGCCTCCATCGGGTCAT
ACTGTGCCCGAGGAAATCGGAAGAGATTGTGTGAACCAGCTGCTCGCGTCTATTAAGCTGGGCGGCTGCGTGAGC
GAAGTCTCCAGTTCCATCGTCTTGGTCCTCATGTCCCTGGGTTCGGAAGACGTCGGACGTGTGAGAATAGCCGAG
GGCGTTTTCGCGTCAAAACATCATTGGCGGCTGGCGAGGGACTTGCGAATGTTCGGCGCGCATCCCTGGGGTTTG
AGAGATGCGGGGAACACAGCCCATGATATGATTGTTACTGTCAAGGGAGCCGGCGTCGGTAATGTAGGCAGAAAG
ATGGCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail