Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|855
Gene name
LocationContig_13:59745..62104
Strand-
Gene length (bp)2359
Transcript length (bp)1638
Coding sequence length (bp)1638
Protein length (aa) 546

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00071 Ras Ras family 7.8E-52 355 530
PF12542 CWC25 Pre-mRNA splicing factor 7.5E-26 66 157
PF08477 Roc Ras of Complex, Roc, domain of DAPkinase 7.2E-20 355 468
PF10197 Cir_N N-terminal domain of CBF1 interacting co-repressor CIR 6.1E-12 11 47
PF00025 Arf ADP-ribosylation factor family 1.6E-06 353 477

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IRI9|CWC25_GIBZE Pre-mRNA-splicing factor CWC25 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CWC25 PE=3 SV=1 1 179 9.0E-97
sp|Q00245|RHO3_YEAST GTP-binding protein RHO3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHO3 PE=1 SV=2 344 545 2.0E-93
sp|Q9HF51|RHO3_ASHGO GTP-binding protein RHO3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RHO3 PE=3 SV=1 341 545 2.0E-92
sp|O13928|RHO3_SCHPO GTP-binding protein rho3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho3 PE=1 SV=2 346 532 1.0E-84
sp|Q9P8J9|RHO3_SCHCO GTP-binding protein Rho3 OS=Schizophyllum commune GN=RHO3 PE=2 SV=1 343 545 2.0E-76
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IRI9|CWC25_GIBZE Pre-mRNA-splicing factor CWC25 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CWC25 PE=3 SV=1 1 179 9.0E-97
sp|Q00245|RHO3_YEAST GTP-binding protein RHO3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHO3 PE=1 SV=2 344 545 2.0E-93
sp|Q9HF51|RHO3_ASHGO GTP-binding protein RHO3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RHO3 PE=3 SV=1 341 545 2.0E-92
sp|O13928|RHO3_SCHPO GTP-binding protein rho3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho3 PE=1 SV=2 346 532 1.0E-84
sp|Q9P8J9|RHO3_SCHCO GTP-binding protein Rho3 OS=Schizophyllum commune GN=RHO3 PE=2 SV=1 343 545 2.0E-76
sp|Q9C3Y4|RHOA_EMENI GTP-binding protein rhoA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rhoA PE=3 SV=1 352 545 1.0E-62
sp|Q9HE04|RHO5_SCHPO GTP-binding protein rho5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho5 PE=3 SV=1 352 545 3.0E-62
sp|Q09914|RHO1_SCHPO GTP-binding protein rho1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho1 PE=2 SV=1 352 545 3.0E-60
sp|Q10133|RHO2_SCHPO GTP-binding protein rho2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho2 PE=1 SV=1 349 544 6.0E-60
sp|O42825|RHO1_CANAL GTP-binding protein RHO1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RHO1 PE=3 SV=1 348 545 7.0E-60
sp|Q6DHE8|RHOAD_DANRE Rho-related GTP-binding protein RhoA-D OS=Danio rerio GN=rhoad PE=1 SV=1 352 545 2.0E-59
sp|Q6DHM9|RHOAB_DANRE Rho-related GTP-binding protein RhoA-B OS=Danio rerio GN=rhoab PE=1 SV=1 352 545 3.0E-59
sp|Q5REY6|RHOA_PONAB Transforming protein RhoA OS=Pongo abelii GN=RHOA PE=2 SV=2 352 545 1.0E-58
sp|P61586|RHOA_HUMAN Transforming protein RhoA OS=Homo sapiens GN=RHOA PE=1 SV=1 352 545 1.0E-58
sp|P61585|RHOA_BOVIN Transforming protein RhoA OS=Bos taurus GN=RHOA PE=1 SV=1 352 545 1.0E-58
sp|P61589|RHOA_RAT Transforming protein RhoA OS=Rattus norvegicus GN=Rhoa PE=1 SV=1 352 545 2.0E-58
sp|Q9QUI0|RHOA_MOUSE Transforming protein RhoA OS=Mus musculus GN=Rhoa PE=1 SV=1 352 545 2.0E-58
sp|Q6NUX8|RHOAA_DANRE Rho-related GTP-binding protein RhoA-A OS=Danio rerio GN=rhoaa PE=1 SV=1 352 545 2.0E-58
sp|P24406|RHOA_CANLF Transforming protein RhoA OS=Canis lupus familiaris GN=RHOA PE=2 SV=1 352 545 3.0E-58
sp|Q5RCK9|RHOC_PONAB Rho-related GTP-binding protein RhoC OS=Pongo abelii GN=RHOC PE=2 SV=1 352 545 4.0E-58
sp|Q62159|RHOC_MOUSE Rho-related GTP-binding protein RhoC OS=Mus musculus GN=Rhoc PE=1 SV=2 352 545 4.0E-58
sp|P08134|RHOC_HUMAN Rho-related GTP-binding protein RhoC OS=Homo sapiens GN=RHOC PE=1 SV=1 352 545 4.0E-58
sp|Q1RMJ6|RHOC_BOVIN Rho-related GTP-binding protein RhoC OS=Bos taurus GN=RHOC PE=2 SV=1 352 545 4.0E-58
sp|Q7T2E8|RHOAC_DANRE Rho-related GTP-binding protein RhoA-C OS=Danio rerio GN=rhoac PE=1 SV=1 352 545 4.0E-58
sp|P48148|RHO1_DROME Ras-like GTP-binding protein Rho1 OS=Drosophila melanogaster GN=Rho1 PE=1 SV=1 351 545 4.0E-58
sp|Q9PSX7|RHOC_CHICK Rho-related GTP-binding protein RhoC OS=Gallus gallus GN=RHOC PE=1 SV=1 352 545 6.0E-58
sp|P62747|RHOB_RAT Rho-related GTP-binding protein RhoB OS=Rattus norvegicus GN=Rhob PE=1 SV=1 352 531 8.0E-57
sp|P62746|RHOB_MOUSE Rho-related GTP-binding protein RhoB OS=Mus musculus GN=Rhob PE=1 SV=1 352 531 8.0E-57
sp|P62745|RHOB_HUMAN Rho-related GTP-binding protein RhoB OS=Homo sapiens GN=RHOB PE=1 SV=1 352 531 8.0E-57
sp|Q3ZBW5|RHOB_BOVIN Rho-related GTP-binding protein RhoB OS=Bos taurus GN=RHOB PE=2 SV=1 352 531 8.0E-57
sp|Q8J212|RHO1_KLULA GTP-binding protein Rho1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RHO1 PE=3 SV=1 347 531 2.0E-56
sp|Q9HF54|RHO1_ASHGO GTP-binding protein RHO1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RHO1 PE=3 SV=1 349 531 3.0E-56
sp|P06780|RHO1_YEAST GTP-binding protein RHO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHO1 PE=1 SV=3 351 531 4.0E-56
sp|Q22038|RHO1_CAEEL Ras-like GTP-binding protein rhoA OS=Caenorhabditis elegans GN=rho-1 PE=1 SV=1 352 531 4.0E-56
sp|P22122|RHO_DIPOM Ras-like GTP-binding protein O-RHO OS=Diplobatis ommata PE=2 SV=1 352 545 1.0E-55
sp|P01122|RHO_APLCA Ras-like GTP-binding protein RHO OS=Aplysia californica GN=RHO PE=2 SV=1 352 545 1.0E-54
sp|Q7SI59|CWC25_NEUCR Pre-mRNA-splicing factor cwc25 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=msp-6 PE=3 SV=1 1 171 3.0E-54
sp|P06781|RHO2_YEAST GTP-binding protein RHO2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHO2 PE=1 SV=2 350 545 4.0E-54
sp|Q6RUV5|RAC1_RAT Ras-related C3 botulinum toxin substrate 1 OS=Rattus norvegicus GN=Rac1 PE=1 SV=1 355 545 5.0E-50
sp|P63001|RAC1_MOUSE Ras-related C3 botulinum toxin substrate 1 OS=Mus musculus GN=Rac1 PE=1 SV=1 355 545 5.0E-50
sp|P63000|RAC1_HUMAN Ras-related C3 botulinum toxin substrate 1 OS=Homo sapiens GN=RAC1 PE=1 SV=1 355 545 5.0E-50
sp|P62999|RAC1_CANLF Ras-related C3 botulinum toxin substrate 1 OS=Canis lupus familiaris GN=RAC1 PE=2 SV=1 355 545 5.0E-50
sp|P62998|RAC1_BOVIN Ras-related C3 botulinum toxin substrate 1 OS=Bos taurus GN=RAC1 PE=1 SV=1 355 545 5.0E-50
sp|Q874R1|RHO4_SCHPO GTP-binding protein rho4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho4 PE=1 SV=2 348 545 2.0E-49
sp|P34148|RACB_DICDI Rho-related protein racB OS=Dictyostelium discoideum GN=racB PE=1 SV=1 355 545 2.0E-49
sp|P15153|RAC2_HUMAN Ras-related C3 botulinum toxin substrate 2 OS=Homo sapiens GN=RAC2 PE=1 SV=1 355 541 5.0E-49
sp|P40792|RAC1_DROME Ras-related protein Rac1 OS=Drosophila melanogaster GN=Rac1 PE=1 SV=2 355 545 7.0E-49
sp|Q9TU25|RAC2_BOVIN Ras-related C3 botulinum toxin substrate 2 OS=Bos taurus GN=RAC2 PE=2 SV=1 355 541 8.0E-49
sp|Q05144|RAC2_MOUSE Ras-related C3 botulinum toxin substrate 2 OS=Mus musculus GN=Rac2 PE=1 SV=1 355 541 1.0E-48
sp|Q03206|RAC1_CAEEL Ras-related protein ced-10 OS=Caenorhabditis elegans GN=ced-10 PE=1 SV=2 355 545 1.0E-48
sp|P48554|RAC2_DROME Ras-related protein Rac2 OS=Drosophila melanogaster GN=Rac2 PE=1 SV=1 355 545 6.0E-48
sp|P34145|RAC1B_DICDI Rho-related protein rac1B OS=Dictyostelium discoideum GN=rac1B PE=1 SV=2 355 545 9.0E-48
sp|P34144|RAC1A_DICDI Rho-related protein rac1A OS=Dictyostelium discoideum GN=rac1A PE=1 SV=2 355 540 9.0E-48
sp|Q4P6I3|CWC25_USTMA Pre-mRNA-splicing factor CWC25 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CWC25 PE=3 SV=2 1 170 1.0E-47
sp|P60764|RAC3_MOUSE Ras-related C3 botulinum toxin substrate 3 OS=Mus musculus GN=Rac3 PE=1 SV=1 355 532 3.0E-47
sp|P60763|RAC3_HUMAN Ras-related C3 botulinum toxin substrate 3 OS=Homo sapiens GN=RAC3 PE=1 SV=1 355 532 3.0E-47
sp|P84096|RHOG_MOUSE Rho-related GTP-binding protein RhoG OS=Mus musculus GN=Rhog PE=1 SV=1 355 545 3.0E-47
sp|P84095|RHOG_HUMAN Rho-related GTP-binding protein RhoG OS=Homo sapiens GN=RHOG PE=1 SV=1 355 545 3.0E-47
sp|P84097|RHOG_CRICR Rho-related GTP-binding protein RhoG OS=Cricetus cricetus GN=RHOG PE=2 SV=1 355 545 3.0E-47
sp|O88931|RAC2_CAVPO Ras-related C3 botulinum toxin substrate 2 OS=Cavia porcellus GN=RAC2 PE=2 SV=2 355 541 4.0E-47
sp|Q9HBH0|RHOF_HUMAN Rho-related GTP-binding protein RhoF OS=Homo sapiens GN=RHOF PE=1 SV=1 355 545 3.0E-46
sp|O76321|RECG_ENTHI Rho-related protein racG OS=Entamoeba histolytica GN=RACG PE=3 SV=1 355 532 3.0E-46
sp|P34146|RAC1C_DICDI Rho-related protein rac1C OS=Dictyostelium discoideum GN=rac1C PE=1 SV=2 355 545 5.0E-46
sp|C4YDI6|CDC42_CANAW Cell division control protein 42 homolog OS=Candida albicans (strain WO-1) GN=CDC42 PE=3 SV=1 355 545 4.0E-45
sp|P0CY33|CDC42_CANAL Cell division control protein 42 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC42 PE=3 SV=1 355 545 4.0E-45
sp|Q3SZA1|RHOF_BOVIN Rho-related GTP-binding protein RhoF OS=Bos taurus GN=RHOF PE=2 SV=1 355 545 7.0E-45
sp|Q01112|CDC42_SCHPO Cell division control protein 42 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc42 PE=1 SV=1 355 545 1.0E-44
sp|Q5R9F4|RND3_PONAB Rho-related GTP-binding protein RhoE OS=Pongo abelii GN=RND3 PE=2 SV=1 352 541 4.0E-44
sp|Q6SA80|RND3_RAT Rho-related GTP-binding protein RhoE OS=Rattus norvegicus GN=Rnd3 PE=2 SV=1 352 541 5.0E-44
sp|P61588|RND3_MOUSE Rho-related GTP-binding protein RhoE OS=Mus musculus GN=Rnd3 PE=1 SV=1 352 541 5.0E-44
sp|P61587|RND3_HUMAN Rho-related GTP-binding protein RhoE OS=Homo sapiens GN=RND3 PE=1 SV=1 352 541 5.0E-44
sp|P19073|CDC42_YEAST Cell division control protein 42 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC42 PE=1 SV=2 355 545 5.0E-44
sp|Q24814|RACA_ENTHI Rho-related protein racA OS=Entamoeba histolytica GN=RACA PE=3 SV=1 355 532 1.0E-43
sp|Q8BYP3|RHOF_MOUSE Rho-related GTP-binding protein RhoF OS=Mus musculus GN=Rhof PE=1 SV=1 355 545 1.0E-43
sp|P97348|RHOD_MOUSE Rho-related GTP-binding protein RhoD OS=Mus musculus GN=Rhod PE=1 SV=1 355 532 1.0E-43
sp|O77683|RND3_PIG Rho-related GTP-binding protein RhoE OS=Sus scrofa GN=RND3 PE=2 SV=1 352 541 1.0E-43
sp|Q9HF56|CDC42_ASHGO Cell division control protein 42 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CDC42 PE=3 SV=1 355 545 1.0E-43
sp|Q96WY0|RHOC_EMENI GTP-binding protein rhoC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rhoC PE=3 SV=2 354 536 4.0E-43
sp|P34149|RACC_DICDI Rho-related protein racC OS=Dictyostelium discoideum GN=racC PE=1 SV=1 355 545 5.0E-43
sp|O00212|RHOD_HUMAN Rho-related GTP-binding protein RhoD OS=Homo sapiens GN=RHOD PE=1 SV=2 336 532 1.0E-42
sp|P40793|CDC42_DROME Cdc42 homolog OS=Drosophila melanogaster GN=Cdc42 PE=1 SV=1 355 542 1.0E-42
sp|Q17031|CDC42_ANOGA Cdc42 homolog OS=Anopheles gambiae GN=Cdc42 PE=2 SV=2 355 542 1.0E-42
sp|Q8CFN2|CDC42_RAT Cell division control protein 42 homolog OS=Rattus norvegicus GN=Cdc42 PE=1 SV=2 355 545 1.0E-42
sp|Q007T2|CDC42_PIG Cell division control protein 42 homolog OS=Sus scrofa GN=CDC42 PE=2 SV=2 355 545 1.0E-42
sp|P60766|CDC42_MOUSE Cell division control protein 42 homolog OS=Mus musculus GN=Cdc42 PE=1 SV=2 355 545 1.0E-42
sp|P60953|CDC42_HUMAN Cell division control protein 42 homolog OS=Homo sapiens GN=CDC42 PE=1 SV=2 355 545 1.0E-42
sp|P60952|CDC42_CANLF Cell division control protein 42 homolog OS=Canis lupus familiaris GN=CDC42 PE=2 SV=2 355 545 1.0E-42
sp|Q2KJ93|CDC42_BOVIN Cell division control protein 42 homolog OS=Bos taurus GN=CDC42 PE=1 SV=1 355 545 1.0E-42
sp|Q90694|CDC42_CHICK Cell division control protein 42 homolog OS=Gallus gallus GN=CDC42 PE=2 SV=1 355 545 1.0E-42
sp|Q4R4R6|CDC42_MACFA Cell division control protein 42 homolog OS=Macaca fascicularis GN=CDC42 PE=2 SV=1 355 545 2.0E-42
sp|Q16YG0|CDC42_AEDAE Cdc42 homolog OS=Aedes aegypti GN=Cdc42 PE=3 SV=1 355 542 2.0E-42
sp|Q29HY3|CDC42_DROPS Cdc42 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Cdc42 PE=3 SV=1 355 542 2.0E-42
sp|Q9GPS3|RACF2_DICDI Rho-related protein racF2 OS=Dictyostelium discoideum GN=racF2 PE=3 SV=1 355 531 9.0E-42
sp|Q9D3G9|RHOH_MOUSE Rho-related GTP-binding protein RhoH OS=Mus musculus GN=Rhoh PE=1 SV=1 355 541 3.0E-41
sp|Q05062|CDC42_CAEEL Cell division control protein 42 homolog OS=Caenorhabditis elegans GN=cdc-42 PE=1 SV=2 355 545 5.0E-41
sp|Q94124|RAC2_CAEEL Ras-related protein rac-2 OS=Caenorhabditis elegans GN=rac-2 PE=3 SV=1 355 545 5.0E-41
sp|Q15669|RHOH_HUMAN Rho-related GTP-binding protein RhoH OS=Homo sapiens GN=RHOH PE=1 SV=1 355 532 5.0E-41
sp|Q00246|RHO4_YEAST GTP-binding protein RHO4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHO4 PE=1 SV=2 355 532 6.0E-41
sp|Q24816|RACC_ENTHI Rho-related protein racC OS=Entamoeba histolytica GN=RACC PE=1 SV=1 350 545 7.0E-41
sp|O96390|RACF1_DICDI Rho-related protein racF1 OS=Dictyostelium discoideum GN=racF1 PE=1 SV=1 355 534 1.0E-40
sp|Q6Z7L8|RAC7_ORYSJ Rac-like GTP-binding protein 7 OS=Oryza sativa subsp. japonica GN=RAC7 PE=2 SV=1 355 545 2.0E-40
sp|Q24815|RACB_ENTHI Rho-related protein racB (Fragment) OS=Entamoeba histolytica GN=RACB PE=3 SV=1 360 526 8.0E-40
sp|Q38903|RAC2_ARATH Rac-like GTP-binding protein ARAC2 OS=Arabidopsis thaliana GN=ARAC2 PE=1 SV=1 355 531 9.0E-40
sp|Q2HJG3|RHOH_BOVIN Rho-related GTP-binding protein RhoH OS=Bos taurus GN=RHOH PE=2 SV=1 355 532 2.0E-39
sp|Q6Z808|RAC3_ORYSJ Rac-like GTP-binding protein 3 OS=Oryza sativa subsp. japonica GN=RAC3 PE=2 SV=1 355 539 2.0E-39
sp|Q38912|RAC3_ARATH Rac-like GTP-binding protein ARAC3 OS=Arabidopsis thaliana GN=ARAC3 PE=1 SV=1 355 531 2.0E-39
sp|Q23862|RACE_DICDI Rho-related protein racE OS=Dictyostelium discoideum GN=racE PE=1 SV=1 348 531 3.0E-39
sp|P92978|RAC11_ARATH Rac-like GTP-binding protein ARAC11 OS=Arabidopsis thaliana GN=ARAC11 PE=1 SV=2 355 531 3.0E-39
sp|Q9Y805|CWC25_SCHPO Pre-mRNA-splicing factor cwf25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf25 PE=1 SV=1 1 154 4.0E-39
sp|Q24817|RACD_ENTHI Rho-related protein racD (Fragment) OS=Entamoeba histolytica GN=RACD PE=2 SV=1 355 535 4.0E-39
sp|Q38902|RAC1_ARATH Rac-like GTP-binding protein ARAC1 OS=Arabidopsis thaliana GN=ARAC1 PE=1 SV=1 355 531 7.0E-39
sp|Q39435|RAC1_BETVU Rac-like GTP-binding protein RHO1 OS=Beta vulgaris GN=RHO1 PE=2 SV=1 355 531 1.0E-38
sp|O04369|RAC1_LOTJA Rac-like GTP-binding protein RAC1 OS=Lotus japonicus GN=RAC1 PE=2 SV=1 355 531 1.0E-38
sp|Q6EP31|RAC5_ORYSJ Rac-like GTP-binding protein 5 OS=Oryza sativa subsp. japonica GN=RAC5 PE=2 SV=2 355 531 1.0E-38
sp|Q9SBJ6|RAC6_ARATH Rac-like GTP-binding protein ARAC6 OS=Arabidopsis thaliana GN=ARAC6 PE=1 SV=2 355 531 1.0E-38
sp|Q9GPQ8|RACL_DICDI Rho-related protein racL OS=Dictyostelium discoideum GN=racL PE=3 SV=1 355 545 1.0E-38
sp|Q6ZHA3|RAC6_ORYSJ Rac-like GTP-binding protein 6 OS=Oryza sativa subsp. japonica GN=RAC6 PE=2 SV=1 355 531 2.0E-38
sp|P33153|CRL1_CANAW GTP-binding RHO-like protein OS=Candida albicans (strain WO-1) GN=CRL1 PE=3 SV=2 355 526 3.0E-38
sp|Q9P8V0|RHO4_ASHGO GTP-binding protein RHO4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RHO4 PE=3 SV=1 355 531 3.0E-38
sp|Q38919|RAC4_ARATH Rac-like GTP-binding protein ARAC4 OS=Arabidopsis thaliana GN=ARAC4 PE=1 SV=1 355 531 4.0E-38
sp|Q38937|RAC5_ARATH Rac-like GTP-binding protein ARAC5 OS=Arabidopsis thaliana GN=ARAC5 PE=1 SV=1 355 531 5.0E-38
sp|Q5B0I1|CWC25_EMENI Pre-mRNA-splicing factor cwc25 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cwc25 PE=3 SV=1 3 158 5.0E-38
sp|Q9SSX0|RAC1_ORYSJ Rac-like GTP-binding protein 1 OS=Oryza sativa subsp. japonica GN=RAC1 PE=1 SV=1 355 531 6.0E-38
sp|Q9SU67|RAC8_ARATH Rac-like GTP-binding protein ARAC8 OS=Arabidopsis thaliana GN=ARAC8 PE=1 SV=2 355 531 7.0E-38
sp|Q35638|RHO1_PEA Rac-like GTP-binding protein RHO1 OS=Pisum sativum GN=RHO1 PE=2 SV=1 355 531 7.0E-38
sp|Q9XGU0|RAC9_ARATH Rac-like GTP-binding protein ARAC9 OS=Arabidopsis thaliana GN=ARAC9 PE=1 SV=1 355 541 1.0E-37
sp|Q67VP4|RAC4_ORYSJ Rac-like GTP-binding protein 4 OS=Oryza sativa subsp. japonica GN=RAC4 PE=2 SV=1 355 531 1.0E-37
sp|Q40220|RAC2_LOTJA Rac-like GTP-binding protein RAC2 OS=Lotus japonicus GN=RAC2 PE=2 SV=1 355 531 2.0E-37
sp|Q68Y52|RAC2_ORYSJ Rac-like GTP-binding protein 2 OS=Oryza sativa subsp. japonica GN=RAC2 PE=2 SV=1 347 539 4.0E-37
sp|Q24192|RHOL_DROME Ras-like GTP-binding protein RhoL OS=Drosophila melanogaster GN=RhoL PE=2 SV=1 355 545 6.0E-37
sp|Q41254|RAC9_GOSHI Rac-like GTP-binding protein RAC9 OS=Gossypium hirsutum GN=RAC9 PE=2 SV=1 355 531 6.0E-37
sp|Q9GPR2|RACI_DICDI Rho-related protein racI OS=Dictyostelium discoideum GN=racI PE=3 SV=1 355 531 2.0E-36
sp|O82481|RAC10_ARATH Rac-like GTP-binding protein ARAC10 OS=Arabidopsis thaliana GN=ARAC10 PE=1 SV=1 355 528 2.0E-36
sp|P17081|RHOQ_HUMAN Rho-related GTP-binding protein RhoQ OS=Homo sapiens GN=RHOQ PE=1 SV=2 348 541 2.0E-36
sp|Q7L0Q8|RHOU_HUMAN Rho-related GTP-binding protein RhoU OS=Homo sapiens GN=RHOU PE=1 SV=1 355 530 2.0E-36
sp|Q41253|RAC13_GOSHI Rac-like GTP-binding protein RAC13 OS=Gossypium hirsutum GN=RAC13 PE=2 SV=1 355 531 3.0E-36
sp|P34147|RACA_DICDI Rho-related protein racA OS=Dictyostelium discoideum GN=racA PE=1 SV=2 355 541 3.0E-36
sp|Q9JJL4|RHOQ_RAT Rho-related GTP-binding protein RhoQ OS=Rattus norvegicus GN=Rhoq PE=2 SV=1 348 541 3.0E-36
sp|Q8R527|RHOQ_MOUSE Rho-related GTP-binding protein RhoQ OS=Mus musculus GN=Rhoq PE=1 SV=2 348 541 3.0E-36
sp|Q8BLR7|RND1_MOUSE Rho-related GTP-binding protein Rho6 OS=Mus musculus GN=Rnd1 PE=2 SV=1 352 531 3.0E-36
sp|Q54HZ7|RACM_DICDI Rho-related protein racM OS=Dictyostelium discoideum GN=racM PE=3 SV=2 355 545 4.0E-36
sp|Q9H4E5|RHOJ_HUMAN Rho-related GTP-binding protein RhoJ OS=Homo sapiens GN=RHOJ PE=1 SV=1 355 542 5.0E-36
sp|Q2HJ68|RND1_BOVIN Rho-related GTP-binding protein Rho6 OS=Bos taurus GN=RND1 PE=2 SV=1 355 531 6.0E-36
sp|O82480|RAC7_ARATH Rac-like GTP-binding protein ARAC7 OS=Arabidopsis thaliana GN=ARAC7 PE=1 SV=1 355 531 6.0E-36
sp|P52198|RND2_HUMAN Rho-related GTP-binding protein RhoN OS=Homo sapiens GN=RND2 PE=1 SV=2 355 511 9.0E-36
sp|Q9QYM5|RND2_MOUSE Rho-related GTP-binding protein RhoN OS=Mus musculus GN=Rnd2 PE=2 SV=1 355 511 1.0E-35
sp|Q4X1D7|CWC25_ASPFU Pre-mRNA-splicing factor cwc25 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cwc25 PE=3 SV=1 3 164 1.0E-35
sp|Q92730|RND1_HUMAN Rho-related GTP-binding protein Rho6 OS=Homo sapiens GN=RND1 PE=1 SV=1 355 531 1.0E-35
sp|Q9EQT3|RHOU_MOUSE Rho-related GTP-binding protein RhoU OS=Mus musculus GN=Rhou PE=2 SV=1 355 530 2.0E-35
sp|Q9Z1Y0|RHOV_RAT Rho-related GTP-binding protein RhoV OS=Rattus norvegicus GN=Rhov PE=1 SV=1 355 541 3.0E-35
sp|A5D7J5|RHOU_BOVIN Rho-related GTP-binding protein RhoU OS=Bos taurus GN=RHOU PE=2 SV=1 355 530 4.0E-35
sp|P31021|RHO1_ENTHI Ras-like GTP-binding protein RHO1 OS=Entamoeba histolytica GN=RHO1 PE=3 SV=1 355 532 6.0E-35
sp|Q8VDU1|RHOV_MOUSE Rho-related GTP-binding protein RhoV OS=Mus musculus GN=Rhov PE=2 SV=1 355 541 1.0E-34
sp|Q96L33|RHOV_HUMAN Rho-related GTP-binding protein RhoV OS=Homo sapiens GN=RHOV PE=1 SV=1 355 541 1.0E-34
sp|P0CM98|CWC25_CRYNJ Pre-mRNA-splicing factor CWC25 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CWC25 PE=3 SV=1 1 176 1.0E-34
sp|P0CM99|CWC25_CRYNB Pre-mRNA-splicing factor CWC25 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CWC25 PE=3 SV=1 1 176 1.0E-34
sp|Q9GPS0|RACG_DICDI Rho-related protein racG OS=Dictyostelium discoideum GN=racG PE=3 SV=1 355 526 2.0E-34
sp|Q9ER71|RHOJ_MOUSE Rho-related GTP-binding protein RhoJ OS=Mus musculus GN=Rhoj PE=1 SV=2 355 526 3.0E-34
sp|Q17QI8|RHOV_BOVIN Rho-related GTP-binding protein RhoV OS=Bos taurus GN=Rhov PE=2 SV=1 355 541 4.0E-34
sp|Q9GPR7|RACH_DICDI Rho-related protein racH OS=Dictyostelium discoideum GN=racH PE=3 SV=1 355 531 5.0E-34
sp|P34150|RACD_DICDI Rho-related protein racD OS=Dictyostelium discoideum GN=racD PE=2 SV=3 367 521 6.0E-33
sp|Q54YY4|RACN_DICDI Rho-related protein racN OS=Dictyostelium discoideum GN=racN PE=3 SV=1 355 529 9.0E-32
sp|O94103|CDC42_COLGL Cell division control protein 42 homolog OS=Colletotrichum gloeosporioides GN=CDC42 PE=3 SV=1 355 545 8.0E-31
sp|P53879|RHO5_YEAST GTP-binding protein RHO5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHO5 PE=1 SV=2 355 531 2.0E-29
sp|Q6C1V6|CWC25_YARLI Pre-mRNA-splicing factor CWC25 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CWC25 PE=3 SV=1 4 145 1.0E-26
sp|Q9NXE8|CWC25_HUMAN Pre-mRNA-splicing factor CWC25 homolog OS=Homo sapiens GN=CWC25 PE=1 SV=1 1 163 7.0E-19
sp|Q9DBF7|CWC25_MOUSE Pre-mRNA-splicing factor CWC25 homolog OS=Mus musculus GN=Cwc25 PE=2 SV=2 1 163 2.0E-18
sp|Q54Z85|RACO_DICDI Rho-related protein racO OS=Dictyostelium discoideum GN=racO PE=3 SV=1 353 532 1.0E-17
sp|Q94694|RAP1_PHYPO Ras-related protein Rap-1 OS=Physarum polycephalum GN=RAP1 PE=2 SV=1 355 545 4.0E-17
sp|Q86JP3|RAB5A_DICDI Ras-related protein Rab-5A OS=Dictyostelium discoideum GN=rab5A PE=3 SV=1 349 528 6.0E-17
sp|F1PTE3|RAB13_CANLF Ras-related protein Rab-13 OS=Canis lupus familiaris GN=RAB13 PE=1 SV=2 355 528 2.0E-16
sp|P18613|RAPA_DICDI Ras-related protein rapA OS=Dictyostelium discoideum GN=rapA PE=1 SV=1 355 528 2.0E-16
sp|O94844|RHBT1_HUMAN Rho-related BTB domain-containing protein 1 OS=Homo sapiens GN=RHOBTB1 PE=2 SV=2 355 531 4.0E-16
sp|Q9DAK3|RHBT1_MOUSE Rho-related BTB domain-containing protein 1 OS=Mus musculus GN=Rhobtb1 PE=1 SV=2 355 531 5.0E-16
sp|Q1RMR4|RAB15_BOVIN Ras-related protein Rab-15 OS=Bos taurus GN=RAB15 PE=2 SV=1 352 539 9.0E-16
sp|Q54FK5|RABN1_DICDI Ras-related protein RabN1 OS=Dictyostelium discoideum GN=rabN1 PE=3 SV=1 355 532 3.0E-15
sp|P17609|YPT2_SCHPO GTP-binding protein ypt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt2 PE=3 SV=1 355 528 3.0E-15
sp|P51153|RAB13_HUMAN Ras-related protein Rab-13 OS=Homo sapiens GN=RAB13 PE=1 SV=1 355 528 3.0E-15
sp|P59190|RAB15_HUMAN Ras-related protein Rab-15 OS=Homo sapiens GN=RAB15 PE=1 SV=1 352 539 3.0E-15
sp|Q9DD03|RAB13_MOUSE Ras-related protein Rab-13 OS=Mus musculus GN=Rab13 PE=1 SV=1 355 528 4.0E-15
sp|Q58DS5|RAB13_BOVIN Ras-related protein Rab-13 OS=Bos taurus GN=RAB13 PE=1 SV=1 355 528 4.0E-15
sp|Q8K386|RAB15_MOUSE Ras-related protein Rab-15 OS=Mus musculus GN=Rab15 PE=1 SV=1 352 536 5.0E-15
sp|Q7T3A4|RAB13_DANRE Ras-related protein Rab-13 OS=Danio rerio GN=rab13 PE=1 SV=1 355 536 5.0E-15
sp|P35289|RAB15_RAT Ras-related protein Rab-15 OS=Rattus norvegicus GN=Rab15 PE=2 SV=1 352 536 5.0E-15
sp|Q8WQ53|RAB21_GEOCY Ras-related protein Rab-21 OS=Geodia cydonium GN=RAB21 PE=2 SV=1 351 534 5.0E-15
sp|P70550|RAB8B_RAT Ras-related protein Rab-8B OS=Rattus norvegicus GN=Rab8b PE=1 SV=1 355 528 6.0E-15
sp|P61028|RAB8B_MOUSE Ras-related protein Rab-8B OS=Mus musculus GN=Rab8b PE=1 SV=1 355 528 6.0E-15
sp|Q92930|RAB8B_HUMAN Ras-related protein Rab-8B OS=Homo sapiens GN=RAB8B PE=1 SV=2 355 528 6.0E-15
sp|Q9GP33|RAB4A_ECHMU Probable Ras-related protein Rab-4A OS=Echinococcus multilocularis PE=2 SV=1 355 532 6.0E-15
sp|Q6TEN1|RAP1B_DANRE Ras-related protein Rap-1b OS=Danio rerio GN=rap1b PE=2 SV=1 355 528 6.0E-15
sp|Q5REC9|RAB8B_PONAB Ras-related protein Rab-8B OS=Pongo abelii GN=RAB8B PE=2 SV=1 355 528 6.0E-15
sp|Q9YH37|RAP1B_CYPCA Ras-related protein Rap-1b OS=Cyprinus carpio GN=rap1b PE=2 SV=1 355 528 6.0E-15
sp|Q2HJI8|RAB8B_BOVIN Ras-related protein Rab-8B OS=Bos taurus GN=RAB8B PE=2 SV=1 355 528 7.0E-15
sp|P35286|RAB13_RAT Ras-related protein Rab-13 OS=Rattus norvegicus GN=Rab13 PE=1 SV=2 355 528 7.0E-15
sp|P22123|RAPA_DIPOM Ras-related protein O-Krev OS=Diplobatis ommata PE=2 SV=1 355 542 7.0E-15
sp|Q5KTJ6|RAB13_MESAU Ras-related protein Rab-13 OS=Mesocricetus auratus GN=RAB13 PE=2 SV=1 355 528 7.0E-15
sp|Q62636|RAP1B_RAT Ras-related protein Rap-1b OS=Rattus norvegicus GN=Rap1b PE=1 SV=2 355 528 8.0E-15
sp|Q5RDM6|RAP1B_PONAB Ras-related protein Rap-1b OS=Pongo abelii GN=RAP1B PE=2 SV=1 355 528 8.0E-15
sp|A5A6J7|RAP1B_PANTR Ras-related protein Rap-1b OS=Pan troglodytes GN=RAP1B PE=2 SV=1 355 528 8.0E-15
sp|Q99JI6|RAP1B_MOUSE Ras-related protein Rap-1b OS=Mus musculus GN=Rap1b PE=1 SV=2 355 528 8.0E-15
sp|Q4R9D4|RAP1B_MACFA Ras-related protein Rap-1b OS=Macaca fascicularis GN=RAP1B PE=2 SV=1 355 528 8.0E-15
sp|P61224|RAP1B_HUMAN Ras-related protein Rap-1b OS=Homo sapiens GN=RAP1B PE=1 SV=1 355 528 8.0E-15
sp|Q5ZHX1|RAP1B_CHICK Ras-related protein Rap-1b OS=Gallus gallus GN=RAP1B PE=2 SV=1 355 528 8.0E-15
sp|P61223|RAP1B_BOVIN Ras-related protein Rap-1b OS=Bos taurus GN=RAP1B PE=2 SV=1 355 528 8.0E-15
sp|Q9CB01|RABF1_ARATH Ras-related protein RABF1 OS=Arabidopsis thaliana GN=RABF1 PE=1 SV=1 349 528 9.0E-15
sp|Q9GPQ9|RACJ_DICDI Rho-related protein racJ OS=Dictyostelium discoideum GN=racJ PE=3 SV=1 355 532 2.0E-14
sp|Q640R7|RAP1B_XENTR Ras-related protein Rap-1b OS=Xenopus tropicalis GN=rap1b PE=2 SV=1 355 528 2.0E-14
sp|Q7ZXH7|RAP1B_XENLA Ras-related protein Rap-1b OS=Xenopus laevis GN=rap1b PE=2 SV=1 355 528 2.0E-14
sp|Q9BYZ6|RHBT2_HUMAN Rho-related BTB domain-containing protein 2 OS=Homo sapiens GN=RHOBTB2 PE=2 SV=2 355 531 2.0E-14
sp|Q91V93|RHBT2_MOUSE Rho-related BTB domain-containing protein 2 OS=Mus musculus GN=Rhobtb2 PE=2 SV=2 355 531 2.0E-14
sp|Q8BHH2|RAB9B_MOUSE Ras-related protein Rab-9B OS=Mus musculus GN=Rab9b PE=1 SV=1 350 544 2.0E-14
sp|P22128|RAB8_DIPOM Ras-related protein Rab-8 OS=Diplobatis ommata PE=2 SV=1 355 539 2.0E-14
sp|Q5F470|RAB8A_CHICK Ras-related protein Rab-8A OS=Gallus gallus GN=RAB8A PE=2 SV=1 355 528 3.0E-14
sp|Q18246|RAP1_CAEEL Ras-related protein Rap-1 OS=Caenorhabditis elegans GN=rap-1 PE=3 SV=1 355 528 3.0E-14
sp|Q9NP90|RAB9B_HUMAN Ras-related protein Rab-9B OS=Homo sapiens GN=RAB9B PE=1 SV=1 350 544 5.0E-14
sp|Q5R4W9|RAB9B_PONAB Ras-related protein Rab-9B OS=Pongo abelii GN=RAB9B PE=2 SV=1 350 544 5.0E-14
sp|Q1ZXE7|RABZ_DICDI Ras-related protein RabZ OS=Dictyostelium discoideum GN=rabZ PE=3 SV=2 356 538 6.0E-14
sp|Q0WQN4|RAA6B_ARATH Ras-related protein RABA6b OS=Arabidopsis thaliana GN=RABA6B PE=2 SV=2 355 523 6.0E-14
sp|Q54FK7|RABL_DICDI Ras-related protein RabL OS=Dictyostelium discoideum GN=rabL PE=3 SV=1 355 531 6.0E-14
sp|P62836|RAP1A_RAT Ras-related protein Rap-1A OS=Rattus norvegicus GN=Rap1a PE=1 SV=1 353 528 6.0E-14
sp|P62835|RAP1A_MOUSE Ras-related protein Rap-1A OS=Mus musculus GN=Rap1a PE=1 SV=1 353 528 6.0E-14
sp|P62834|RAP1A_HUMAN Ras-related protein Rap-1A OS=Homo sapiens GN=RAP1A PE=1 SV=1 353 528 6.0E-14
sp|P62833|RAP1A_BOVIN Ras-related protein Rap-1A OS=Bos taurus GN=RAP1A PE=1 SV=1 353 528 6.0E-14
sp|O94655|YPT7_SCHPO GTP-binding protein ypt7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt7 PE=3 SV=1 347 531 9.0E-14
sp|A4FV54|RAB8A_BOVIN Ras-related protein Rab-8A OS=Bos taurus GN=RAB8A PE=2 SV=1 355 528 1.0E-13
sp|A6NIZ1|RP1BL_HUMAN Ras-related protein Rap-1b-like protein OS=Homo sapiens PE=2 SV=1 355 528 1.0E-13
sp|P35280|RAB8A_RAT Ras-related protein Rab-8A OS=Rattus norvegicus GN=Rab8a PE=1 SV=2 355 528 1.0E-13
sp|P55258|RAB8A_MOUSE Ras-related protein Rab-8A OS=Mus musculus GN=Rab8a PE=1 SV=2 355 528 1.0E-13
sp|Q4R5P1|RAB8A_MACFA Ras-related protein Rab-8A OS=Macaca fascicularis GN=RAB8A PE=2 SV=1 355 528 1.0E-13
sp|P61006|RAB8A_HUMAN Ras-related protein Rab-8A OS=Homo sapiens GN=RAB8A PE=1 SV=1 355 528 1.0E-13
sp|P61007|RAB8A_CANLF Ras-related protein Rab-8A OS=Canis lupus familiaris GN=RAB8A PE=2 SV=1 355 528 1.0E-13
sp|Q9C2L8|RAB7_NEUCR Probable Ras-related protein Rab7 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=17E5.300 PE=3 SV=1 350 531 2.0E-13
sp|Q9ULW5|RAB26_HUMAN Ras-related protein Rab-26 OS=Homo sapiens GN=RAB26 PE=1 SV=3 315 528 2.0E-13
sp|P36411|RAB7A_DICDI Ras-related protein Rab-7A OS=Dictyostelium discoideum GN=rab7A PE=1 SV=1 350 533 2.0E-13
sp|Q9C9U7|RAA6A_ARATH Ras-related protein RABA6a OS=Arabidopsis thaliana GN=RABA6A PE=2 SV=1 355 523 2.0E-13
sp|P40393|RIC2_ORYSJ Ras-related protein RIC2 OS=Oryza sativa subsp. japonica GN=RIC2 PE=2 SV=2 355 526 3.0E-13
sp|P22127|RAB10_DIPOM Ras-related protein Rab-10 OS=Diplobatis ommata PE=2 SV=1 355 527 3.0E-13
sp|Q5R5U1|RAB10_PONAB Ras-related protein Rab-10 OS=Pongo abelii GN=RAB10 PE=2 SV=1 355 527 3.0E-13
sp|P61027|RAB10_MOUSE Ras-related protein Rab-10 OS=Mus musculus GN=Rab10 PE=1 SV=1 355 527 3.0E-13
sp|P61026|RAB10_HUMAN Ras-related protein Rab-10 OS=Homo sapiens GN=RAB10 PE=1 SV=1 355 527 3.0E-13
sp|O24466|RAE1A_ARATH Ras-related protein RABE1a OS=Arabidopsis thaliana GN=RABE1A PE=1 SV=1 355 528 4.0E-13
sp|Q504M8|RAB26_MOUSE Ras-related protein Rab-26 OS=Mus musculus GN=Rab26 PE=1 SV=1 352 528 4.0E-13
sp|P36862|YPTV3_VOLCA GTP-binding protein yptV3 OS=Volvox carteri GN=YPTV3 PE=3 SV=1 355 525 4.0E-13
sp|P13856|RSR1_YEAST Ras-related protein RSR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSR1 PE=3 SV=1 355 528 4.0E-13
sp|P51151|RAB9A_HUMAN Ras-related protein Rab-9A OS=Homo sapiens GN=RAB9A PE=1 SV=1 350 532 5.0E-13
sp|P51156|RAB26_RAT Ras-related protein Rab-26 OS=Rattus norvegicus GN=Rab26 PE=2 SV=2 352 528 5.0E-13
sp|P24409|RAB10_CANLF Ras-related protein Rab-10 OS=Canis lupus familiaris GN=RAB10 PE=1 SV=1 355 527 5.0E-13
sp|P24408|RAB9A_CANLF Ras-related protein Rab-9A OS=Canis lupus familiaris GN=RAB9A PE=1 SV=2 350 532 5.0E-13
sp|Q9SJ11|RABG2_ARATH Ras-related protein RABG2 OS=Arabidopsis thaliana GN=RABG2 PE=2 SV=2 355 539 6.0E-13
sp|Q54FK8|RABM_DICDI Ras-related protein RabM OS=Dictyostelium discoideum GN=rabM PE=3 SV=2 355 538 6.0E-13
sp|Q5ZIT5|RAB10_CHICK Ras-related protein Rab-10 OS=Gallus gallus GN=RAB10 PE=2 SV=1 355 527 6.0E-13
sp|Q99P75|RAB9A_RAT Ras-related protein Rab-9A OS=Rattus norvegicus GN=Rab9a PE=1 SV=2 350 533 7.0E-13
sp|Q54RX9|RAB5B_DICDI Putative ras-related protein Rab-5B OS=Dictyostelium discoideum GN=rab5B PE=5 SV=1 355 528 7.0E-13
sp|Q9R0M6|RAB9A_MOUSE Ras-related protein Rab-9A OS=Mus musculus GN=Rab9a PE=1 SV=1 350 533 7.0E-13
sp|Q39433|RB1BV_BETVU Ras-related protein RAB1BV OS=Beta vulgaris GN=RAB1BV PE=2 SV=1 355 528 7.0E-13
sp|P41924|RYL1_YARLI Ras-like GTP-binding protein RYL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RYL1 PE=3 SV=1 355 527 9.0E-13
sp|Q5U316|RAB35_RAT Ras-related protein Rab-35 OS=Rattus norvegicus GN=Rab35 PE=1 SV=1 355 478 1.0E-12
sp|Q6PHN9|RAB35_MOUSE Ras-related protein Rab-35 OS=Mus musculus GN=Rab35 PE=1 SV=1 355 478 1.0E-12
sp|Q15286|RAB35_HUMAN Ras-related protein Rab-35 OS=Homo sapiens GN=RAB35 PE=1 SV=1 355 478 1.0E-12
sp|Q9SID8|RAH1D_ARATH Ras-related protein RABH1d OS=Arabidopsis thaliana GN=RABH1D PE=3 SV=1 349 472 1.0E-12
sp|Q58DS9|RAB5C_BOVIN Ras-related protein Rab-5C OS=Bos taurus GN=RAB5C PE=2 SV=1 347 469 1.0E-12
sp|Q54GY8|RAB18_DICDI Ras-related protein Rab-18 OS=Dictyostelium discoideum GN=rab18 PE=3 SV=1 353 533 1.0E-12
sp|P51147|RAB5C_CANLF Ras-related protein Rab-5C OS=Canis lupus familiaris GN=RAB5C PE=2 SV=1 347 469 1.0E-12
sp|Q01111|YPT3_NICPL Ras-related protein YPT3 OS=Nicotiana plumbaginifolia GN=YPT3 PE=2 SV=1 355 526 1.0E-12
sp|Q5R7L7|RAB5C_PONAB Ras-related protein Rab-5C OS=Pongo abelii GN=RAB5C PE=2 SV=1 347 469 1.0E-12
sp|P51148|RAB5C_HUMAN Ras-related protein Rab-5C OS=Homo sapiens GN=RAB5C PE=1 SV=2 347 469 1.0E-12
sp|Q96HU8|DIRA2_HUMAN GTP-binding protein Di-Ras2 OS=Homo sapiens GN=DIRAS2 PE=1 SV=1 355 545 1.0E-12
sp|P35278|RAB5C_MOUSE Ras-related protein Rab-5C OS=Mus musculus GN=Rab5c PE=1 SV=2 347 469 1.0E-12
sp|Q9LK99|RAA1G_ARATH Ras-related protein RABA1g OS=Arabidopsis thaliana GN=RABA1G PE=2 SV=1 355 526 1.0E-12
sp|Q5PR73|DIRA2_MOUSE GTP-binding protein Di-Ras2 OS=Mus musculus GN=Diras2 PE=1 SV=1 355 545 1.0E-12
sp|Q95KD9|DIRA2_MACFA GTP-binding protein Di-Ras2 OS=Macaca fascicularis GN=DIRAS2 PE=2 SV=1 355 545 1.0E-12
sp|Q54FL2|RABG2_DICDI Ras-related protein RabG2 OS=Dictyostelium discoideum GN=rabG2 PE=3 SV=2 355 527 1.0E-12
sp|Q8BHD0|RB39A_MOUSE Ras-related protein Rab-39A OS=Mus musculus GN=Rab39a PE=1 SV=1 353 528 1.0E-12
sp|P28186|RAE1C_ARATH Ras-related protein RABE1c OS=Arabidopsis thaliana GN=RABE1C PE=1 SV=1 355 528 2.0E-12
sp|Q9FJH0|RAA1F_ARATH Ras-related protein RABA1f OS=Arabidopsis thaliana GN=RABA1F PE=2 SV=1 355 526 2.0E-12
sp|Q9ULC3|RAB23_HUMAN Ras-related protein Rab-23 OS=Homo sapiens GN=RAB23 PE=1 SV=1 352 527 2.0E-12
sp|P36586|YPT5_SCHPO GTP-binding protein ypt5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt5 PE=1 SV=1 351 472 2.0E-12
sp|Q5R6S2|DIRA2_PONAB GTP-binding protein Di-Ras2 OS=Pongo abelii GN=DIRAS2 PE=2 SV=1 355 545 2.0E-12
sp|Q96AX2|RAB37_HUMAN Ras-related protein Rab-37 OS=Homo sapiens GN=RAB37 PE=1 SV=3 346 528 2.0E-12
sp|Q59LQ5|CWC25_CANAL Pre-mRNA-splicing factor CWC25 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CWC25 PE=3 SV=1 3 143 2.0E-12
sp|Q9LV79|RAH1A_ARATH Ras-related protein RABH1a OS=Arabidopsis thaliana GN=RABH1A PE=2 SV=1 355 491 2.0E-12
sp|P29687|RAB5_TOBAC Ras-related protein Rab5 OS=Nicotiana tabacum GN=RAB5 PE=2 SV=1 355 528 2.0E-12
sp|P31583|RHN1_NICPL Ras-related protein RHN1 OS=Nicotiana plumbaginifolia GN=RHN1 PE=2 SV=1 355 528 3.0E-12
sp|O49513|RAA1E_ARATH Ras-related protein RABA1e OS=Arabidopsis thaliana GN=RABA1E PE=2 SV=1 355 526 3.0E-12
sp|Q54E92|RABG1_DICDI Ras-related protein RabG1 OS=Dictyostelium discoideum GN=rabG1 PE=3 SV=1 355 527 3.0E-12
sp|M0RC99|RAB5A_RAT Ras-related protein Rab-5A OS=Rattus norvegicus GN=Rab5a PE=2 SV=1 348 469 3.0E-12
sp|Q5ZHW4|RAB5B_CHICK Ras-related protein Rab-5B OS=Gallus gallus GN=RAB5B PE=2 SV=1 348 469 3.0E-12
sp|P36861|YPTV2_VOLCA GTP-binding protein yptV2 OS=Volvox carteri GN=YPTV2 PE=3 SV=1 355 532 3.0E-12
sp|Q9CQD1|RAB5A_MOUSE Ras-related protein Rab-5A OS=Mus musculus GN=Rab5a PE=1 SV=1 348 469 4.0E-12
sp|Q98932|RAB5C_CHICK Ras-related protein Rab-5C OS=Gallus gallus GN=RAB5C PE=1 SV=1 347 469 4.0E-12
sp|Q5RBG1|RAB5B_PONAB Ras-related protein Rab-5B OS=Pongo abelii GN=RAB5B PE=2 SV=1 348 469 4.0E-12
sp|P61021|RAB5B_MOUSE Ras-related protein Rab-5B OS=Mus musculus GN=Rab5b PE=1 SV=1 348 469 4.0E-12
sp|P61020|RAB5B_HUMAN Ras-related protein Rab-5B OS=Homo sapiens GN=RAB5B PE=1 SV=1 348 469 4.0E-12
sp|Q29RR0|RAB26_BOVIN Ras-related protein Rab-26 OS=Bos taurus GN=RAB26 PE=2 SV=1 352 528 4.0E-12
sp|Q55CB7|RASY_DICDI Ras-like protein rasY OS=Dictyostelium discoideum GN=rasY PE=3 SV=1 355 530 4.0E-12
sp|P25228|RAB3_DROME Ras-related protein Rab-3 OS=Drosophila melanogaster GN=Rab3 PE=1 SV=1 355 523 4.0E-12
sp|Q5R4A3|RAB8A_PONAB Ras-related protein Rab-8A OS=Pongo abelii GN=RAB8A PE=2 SV=1 355 528 5.0E-12
sp|P61271|RAB5A_MACFA Ras-related protein Rab-5A OS=Macaca fascicularis GN=RAB5A PE=2 SV=1 348 469 5.0E-12
sp|P20339|RAB5A_HUMAN Ras-related protein Rab-5A OS=Homo sapiens GN=RAB5A PE=1 SV=2 348 469 5.0E-12
sp|P18066|RAB5A_CANLF Ras-related protein Rab-5A OS=Canis lupus familiaris GN=RAB5A PE=1 SV=1 348 469 5.0E-12
sp|Q7F7I7|RAN1_ORYSJ GTP-binding nuclear protein Ran-1 OS=Oryza sativa subsp. japonica GN=RAN1 PE=2 SV=1 355 528 5.0E-12
sp|A2WSI7|RAN1_ORYSI GTP-binding nuclear protein Ran-1 OS=Oryza sativa subsp. indica GN=RAN1 PE=2 SV=2 355 528 5.0E-12
sp|Q9SMR4|RAH1C_ARATH Ras-related protein RABH1c OS=Arabidopsis thaliana GN=RABH1C PE=1 SV=1 349 477 5.0E-12
sp|Q0IIG7|RAB5A_BOVIN Ras-related protein Rab-5A OS=Bos taurus GN=RAB5A PE=2 SV=1 348 469 5.0E-12
sp|Q9SN35|RAA1D_ARATH Ras-related protein RABA1d OS=Arabidopsis thaliana GN=RABA1D PE=2 SV=1 355 526 5.0E-12
sp|P34143|RABC_DICDI Ras-related protein RabC OS=Dictyostelium discoideum GN=rabC PE=2 SV=2 355 523 6.0E-12
sp|Q9HDY0|YPT71_SCHPO GTP-binding protein ypt71 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt71 PE=3 SV=1 347 531 7.0E-12
sp|P41918|RANA1_TOBAC GTP-binding nuclear protein Ran-A1 OS=Nicotiana tabacum GN=RAN-A1 PE=2 SV=1 355 528 7.0E-12
sp|Q9VP48|RAB26_DROME Ras-related protein Rab-26 OS=Drosophila melanogaster GN=Rab26 PE=2 SV=2 338 528 7.0E-12
sp|Q8H156|RAN3_ARATH GTP-binding nuclear protein Ran-3 OS=Arabidopsis thaliana GN=RAN3 PE=1 SV=2 355 528 8.0E-12
sp|P38546|RAN1_SOLLC GTP-binding nuclear protein Ran1 OS=Solanum lycopersicum GN=RAN1 PE=2 SV=1 355 528 8.0E-12
sp|P38545|RAN_PLAFA GTP-binding nuclear protein Ran OS=Plasmodium falciparum PE=2 SV=1 353 528 8.0E-12
sp|P41916|RAN1_ARATH GTP-binding nuclear protein Ran-1 OS=Arabidopsis thaliana GN=RAN1 PE=1 SV=1 355 528 8.0E-12
sp|Q06AU6|RAB5A_PIG Ras-related protein Rab-5A OS=Sus scrofa GN=RAB5A PE=2 SV=1 348 469 8.0E-12
sp|Q40723|RLGP2_ORYSJ Ras-related protein RGP2 OS=Oryza sativa subsp. japonica GN=RGP2 PE=2 SV=2 355 523 9.0E-12
sp|P41919|RANB1_TOBAC GTP-binding nuclear protein Ran-B1 OS=Nicotiana tabacum GN=RAN-B1 PE=2 SV=1 355 528 9.0E-12
sp|P38547|RAN2_SOLLC GTP-binding nuclear protein Ran2 OS=Solanum lycopersicum GN=RAN2 PE=2 SV=1 355 528 9.0E-12
sp|Q55CC0|RASW_DICDI Ras-like protein rasW OS=Dictyostelium discoideum GN=rasW PE=3 SV=1 356 530 9.0E-12
sp|Q550H6|RB11C_DICDI Ras-related protein Rab-11C OS=Dictyostelium discoideum GN=rab11C PE=1 SV=1 355 523 9.0E-12
sp|Q948K6|RABG1_ARATH Ras-related protein RABG1 OS=Arabidopsis thaliana GN=RABG1 PE=2 SV=1 355 532 9.0E-12
sp|P38548|RAN_VICFA GTP-binding nuclear protein Ran/TC4 OS=Vicia faba PE=2 SV=1 355 528 1.0E-11
sp|Q40194|RB11D_LOTJA Ras-related protein Rab11D OS=Lotus japonicus GN=RAB11D PE=2 SV=1 355 526 1.0E-11
sp|Q17R06|RAB21_BOVIN Ras-related protein Rab-21 OS=Bos taurus GN=RAB21 PE=2 SV=1 350 528 1.0E-11
sp|P41917|RAN2_ARATH GTP-binding nuclear protein Ran-2 OS=Arabidopsis thaliana GN=RAN2 PE=1 SV=3 355 528 1.0E-11
sp|P54765|RAN1A_LOTJA GTP-binding nuclear protein Ran1A (Fragment) OS=Lotus japonicus GN=RAN1A PE=2 SV=1 355 528 1.0E-11
sp|Q9FK68|RAA1C_ARATH Ras-related protein RABA1c OS=Arabidopsis thaliana GN=RABA1C PE=2 SV=1 355 525 1.0E-11
sp|Q9SRS5|RAA5B_ARATH Ras-related protein RABA5b OS=Arabidopsis thaliana GN=RABA5B PE=2 SV=1 355 523 1.0E-11
sp|P54766|RAN1B_LOTJA GTP-binding nuclear protein Ran1B (Fragment) OS=Lotus japonicus GN=RAN1B PE=2 SV=1 355 528 1.0E-11
sp|Q9LFT9|RAH1E_ARATH Ras-related protein RABH1e OS=Arabidopsis thaliana GN=RABH1E PE=2 SV=1 349 469 1.0E-11
sp|O23657|RABC1_ARATH Ras-related protein RABC1 OS=Arabidopsis thaliana GN=RABC1 PE=1 SV=1 355 525 1.0E-11
sp|P22279|RAS2_MUCCL Ras-like protein 2 OS=Mucor circinelloides f. lusitanicus GN=RAS2 PE=2 SV=2 347 528 1.0E-11
sp|Q01387|RAS2_NEUCR Protein ras-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ras-2 PE=3 SV=2 348 528 1.0E-11
sp|Q14964|RB39A_HUMAN Ras-related protein Rab-39A OS=Homo sapiens GN=RAB39A PE=1 SV=2 353 528 1.0E-11
sp|Q55CB0|RASU_DICDI Ras-like protein rasU OS=Dictyostelium discoideum GN=rasU PE=3 SV=1 355 528 1.0E-11
sp|P35281|RAB10_RAT Ras-related protein Rab-10 OS=Rattus norvegicus GN=Rab10 PE=1 SV=1 355 523 1.0E-11
sp|Q6AXT5|RAB21_RAT Ras-related protein Rab-21 OS=Rattus norvegicus GN=Rab21 PE=2 SV=1 355 528 1.0E-11
sp|Q99260|YPT6_YEAST GTP-binding protein YPT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT6 PE=1 SV=1 347 528 2.0E-11
sp|O80501|RAH1B_ARATH Ras-related protein RABH1b OS=Arabidopsis thaliana GN=RABH1B PE=1 SV=1 349 469 2.0E-11
sp|O35509|RB11B_RAT Ras-related protein Rab-11B OS=Rattus norvegicus GN=Rab11b PE=1 SV=4 355 530 2.0E-11
sp|P46638|RB11B_MOUSE Ras-related protein Rab-11B OS=Mus musculus GN=Rab11b PE=1 SV=3 355 530 2.0E-11
sp|Q15907|RB11B_HUMAN Ras-related protein Rab-11B OS=Homo sapiens GN=RAB11B PE=1 SV=4 355 530 2.0E-11
sp|Q3MHP2|RB11B_BOVIN Ras-related protein Rab-11B OS=Bos taurus GN=RAB11B PE=2 SV=3 355 530 2.0E-11
sp|Q9H0T7|RAB17_HUMAN Ras-related protein Rab-17 OS=Homo sapiens GN=RAB17 PE=1 SV=2 335 528 2.0E-11
sp|P22129|RB11B_DIPOM Ras-related protein Rab-11B OS=Diplobatis ommata PE=2 SV=1 355 530 2.0E-11
sp|Q5ZJN2|RB11A_CHICK Ras-related protein Rab-11A OS=Gallus gallus GN=RAB11A PE=2 SV=1 355 530 2.0E-11
sp|P55745|RAB21_CANLF Ras-related protein Rab-21 OS=Canis lupus familiaris GN=RAB21 PE=3 SV=3 355 528 2.0E-11
sp|P62494|RB11A_RAT Ras-related protein Rab-11A OS=Rattus norvegicus GN=Rab11a PE=1 SV=3 355 530 2.0E-11
sp|P62493|RB11A_RABIT Ras-related protein Rab-11A OS=Oryctolagus cuniculus GN=RAB11A PE=2 SV=3 355 530 2.0E-11
sp|Q5R9M7|RB11A_PONAB Ras-related protein Rab-11A OS=Pongo abelii GN=RAB11A PE=2 SV=3 355 530 2.0E-11
sp|Q52NJ1|RB11A_PIG Ras-related protein Rab-11A OS=Sus scrofa GN=RAB11A PE=2 SV=3 355 530 2.0E-11
sp|P62492|RB11A_MOUSE Ras-related protein Rab-11A OS=Mus musculus GN=Rab11a PE=1 SV=3 355 530 2.0E-11
sp|P62491|RB11A_HUMAN Ras-related protein Rab-11A OS=Homo sapiens GN=RAB11A PE=1 SV=3 355 530 2.0E-11
sp|P62490|RB11A_CANLF Ras-related protein Rab-11A OS=Canis lupus familiaris GN=RAB11A PE=2 SV=3 355 530 2.0E-11
sp|Q40521|RB11B_TOBAC Ras-related protein Rab11B OS=Nicotiana tabacum GN=RAB11B PE=2 SV=1 355 526 2.0E-11
sp|P32253|RASC_DICDI Ras-like protein rasC OS=Dictyostelium discoideum GN=rasC PE=2 SV=1 355 528 2.0E-11
sp|Q55CB8|RASX_DICDI Ras-like protein rasX OS=Dictyostelium discoideum GN=rasX PE=3 SV=1 355 530 2.0E-11
sp|P35288|RAB23_MOUSE Ras-related protein Rab-23 OS=Mus musculus GN=Rab23 PE=1 SV=2 352 473 2.0E-11
sp|P35282|RAB21_MOUSE Ras-related protein Rab-21 OS=Mus musculus GN=Rab21 PE=1 SV=4 355 528 2.0E-11
sp|Q69XM7|RAN3_ORYSJ GTP-binding nuclear protein Ran-3 OS=Oryza sativa subsp. japonica GN=RAN3 PE=2 SV=1 355 528 3.0E-11
sp|A2YEQ6|RAN3_ORYSI GTP-binding nuclear protein Ran-3 OS=Oryza sativa subsp. indica GN=RAN3 PE=2 SV=2 355 528 3.0E-11
sp|Q40191|RB11A_LOTJA Ras-related protein Rab11A OS=Lotus japonicus GN=RAB11A PE=2 SV=1 355 524 3.0E-11
sp|Q9SN68|RAF2B_ARATH Ras-related protein RABF2b OS=Arabidopsis thaliana GN=RABF2B PE=1 SV=1 347 528 3.0E-11
sp|P40392|RIC1_ORYSJ Ras-related protein RIC1 OS=Oryza sativa subsp. japonica GN=RIC1 PE=2 SV=2 355 527 3.0E-11
sp|P36018|YPT52_YEAST GTP-binding protein YPT52 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT52 PE=1 SV=1 352 523 3.0E-11
sp|Q9UL25|RAB21_HUMAN Ras-related protein Rab-21 OS=Homo sapiens GN=RAB21 PE=1 SV=3 355 528 3.0E-11
sp|P36864|YPTV5_VOLCA GTP-binding protein yptV5 OS=Volvox carteri GN=YPTV5 PE=3 SV=1 355 460 3.0E-11
sp|P53854|CWC25_YEAST Pre-mRNA-splicing factor CWC25 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CWC25 PE=1 SV=1 1 101 3.0E-11
sp|P17608|RYH1_SCHPO GTP-binding protein ryh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ryh1 PE=1 SV=1 355 469 4.0E-11
sp|P22125|RAB1_DIPOM Ras-related protein ORAB-1 OS=Diplobatis ommata PE=2 SV=1 355 529 4.0E-11
sp|O23561|RAB1A_ARATH Ras-related protein RABB1a OS=Arabidopsis thaliana GN=RABB1A PE=2 SV=1 349 527 4.0E-11
sp|Q39572|YPTC6_CHLRE Ras-related protein YPTC6 OS=Chlamydomonas reinhardtii GN=YPTC6 PE=3 SV=1 355 525 4.0E-11
sp|Q2TA29|RB11A_BOVIN Ras-related protein Rab-11A OS=Bos taurus GN=RAB11A PE=2 SV=3 355 530 5.0E-11
sp|Q8BHC1|RB39B_MOUSE Ras-related protein Rab-39B OS=Mus musculus GN=Rab39b PE=1 SV=1 353 528 6.0E-11
sp|Q6NYB7|RAB1A_RAT Ras-related protein Rab-1A OS=Rattus norvegicus GN=Rab1A PE=1 SV=3 355 529 6.0E-11
sp|P62821|RAB1A_MOUSE Ras-related protein Rab-1A OS=Mus musculus GN=Rab1A PE=1 SV=3 355 529 6.0E-11
sp|P62820|RAB1A_HUMAN Ras-related protein Rab-1A OS=Homo sapiens GN=RAB1A PE=1 SV=3 355 529 6.0E-11
sp|P62822|RAB1A_CANLF Ras-related protein Rab-1A OS=Canis lupus familiaris GN=RAB1A PE=1 SV=3 355 529 6.0E-11
sp|Q96DA2|RB39B_HUMAN Ras-related protein Rab-39B OS=Homo sapiens GN=RAB39B PE=1 SV=1 353 528 7.0E-11
sp|Q17QU4|RB39B_BOVIN Ras-related protein Rab-39B OS=Bos taurus GN=RAB39B PE=2 SV=1 353 528 7.0E-11
sp|P91580|RAB33_CIOIN Putative Ras-related protein Rab-33 OS=Ciona intestinalis GN=COS41.2 PE=3 SV=1 348 474 7.0E-11
sp|Q8CB87|RAB44_MOUSE Ras-related protein Rab-44 OS=Mus musculus GN=Rab44 PE=1 SV=1 356 528 7.0E-11
sp|P20790|RAB8A_DICDI Ras-related protein Rab-8A OS=Dictyostelium discoideum GN=rab8A PE=3 SV=1 355 528 7.0E-11
sp|Q54FK2|RABN2_DICDI Ras-related protein RabN2 OS=Dictyostelium discoideum GN=rabN2 PE=3 SV=1 358 532 8.0E-11
sp|P52301|RAN_XENLA GTP-binding nuclear protein Ran OS=Xenopus laevis GN=ran PE=1 SV=2 348 528 9.0E-11
sp|Q6BNE1|CWC25_DEBHA Pre-mRNA-splicing factor CWC25 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CWC25 PE=3 SV=2 4 153 9.0E-11
sp|O42819|SEC4_CANGA Ras-related protein SEC4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC4 PE=3 SV=1 355 529 1.0E-10
sp|Q6GL85|RAN_XENTR GTP-binding nuclear protein Ran OS=Xenopus tropicalis GN=ran PE=2 SV=1 348 528 1.0E-10
sp|P31582|RAF2A_ARATH Ras-related protein RABF2a OS=Arabidopsis thaliana GN=RABF2A PE=1 SV=1 348 469 1.0E-10
sp|P34140|RAB1B_DICDI Ras-related protein Rab-1B OS=Dictyostelium discoideum GN=rab1B PE=2 SV=2 355 527 1.0E-10
sp|Q7GD79|RAN2_ORYSJ GTP-binding nuclear protein Ran-2 OS=Oryza sativa subsp. japonica GN=RAN2 PE=2 SV=1 355 528 1.0E-10
sp|A2Y7R5|RAN2_ORYSI GTP-binding nuclear protein Ran-2 OS=Oryza sativa subsp. indica GN=RAN2 PE=2 SV=1 355 528 1.0E-10
sp|Q55CA9|RASZ_DICDI Ras-like protein rasZ OS=Dictyostelium discoideum GN=rasZ PE=3 SV=1 355 528 1.0E-10
sp|Q52NJ2|RAB1A_PIG Ras-related protein Rab-1A OS=Sus scrofa GN=RAB1A PE=2 SV=3 355 529 1.0E-10
sp|Q9TVU5|RAB1_THEPA Ras-related protein Rab-1 OS=Theileria parva GN=rab1 PE=1 SV=1 355 528 1.0E-10
sp|P42558|RAN_CHICK GTP-binding nuclear protein Ran OS=Gallus gallus GN=RAN PE=2 SV=1 348 528 1.0E-10
sp|P0CY30|SEC4_CANAX Ras-related protein SEC4 OS=Candida albicans GN=SEC4 PE=3 SV=1 355 529 1.0E-10
sp|C4YL11|SEC4_CANAW Ras-related protein SEC4 OS=Candida albicans (strain WO-1) GN=SEC4 PE=3 SV=1 355 529 1.0E-10
sp|P0CY31|SEC4_CANAL Ras-related protein SEC4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC4 PE=3 SV=1 355 529 1.0E-10
sp|P33519|RAN_DICDI GTP-binding nuclear protein Ran OS=Dictyostelium discoideum GN=ranA PE=1 SV=1 353 524 1.0E-10
sp|Q38922|RAB1B_ARATH Ras-related protein RABB1b OS=Arabidopsis thaliana GN=RABB1B PE=2 SV=1 355 527 1.0E-10
sp|P62828|RAN_RAT GTP-binding nuclear protein Ran OS=Rattus norvegicus GN=Ran PE=1 SV=3 348 528 1.0E-10
sp|Q5R556|RAN_PONAB GTP-binding nuclear protein Ran OS=Pongo abelii GN=RAN PE=2 SV=3 348 528 1.0E-10
sp|P62827|RAN_MOUSE GTP-binding nuclear protein Ran OS=Mus musculus GN=Ran PE=1 SV=3 348 528 1.0E-10
sp|Q4R4M9|RAN_MACFA GTP-binding nuclear protein Ran OS=Macaca fascicularis GN=RAN PE=2 SV=3 348 528 1.0E-10
sp|P62826|RAN_HUMAN GTP-binding nuclear protein Ran OS=Homo sapiens GN=RAN PE=1 SV=3 348 528 1.0E-10
sp|P62825|RAN_CANLF GTP-binding nuclear protein Ran OS=Canis lupus familiaris GN=RAN PE=1 SV=3 348 528 1.0E-10
sp|Q3T054|RAN_BOVIN GTP-binding nuclear protein Ran OS=Bos taurus GN=RAN PE=2 SV=3 348 528 1.0E-10
sp|Q5BJQ5|RIT2_RAT GTP-binding protein Rit2 OS=Rattus norvegicus GN=Rit2 PE=2 SV=1 338 528 1.0E-10
sp|Q43463|RAB7_SOYBN Ras-related protein Rab7 OS=Glycine max PE=2 SV=1 355 537 1.0E-10
sp|P01120|RAS2_YEAST Ras-like protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAS2 PE=1 SV=4 341 529 1.0E-10
sp|P22278|RAS1_MUCCL Ras-like protein 1 OS=Mucor circinelloides f. lusitanicus GN=RAS1 PE=2 SV=1 347 540 2.0E-10
sp|P01123|YPT1_YEAST GTP-binding protein YPT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT1 PE=1 SV=2 355 528 2.0E-10
sp|Q95UJ0|RAB7A_PAROT Ras-related protein Rab-7a OS=Paramecium octaurelia GN=Rab7a PE=1 SV=2 355 451 2.0E-10
sp|Q6DHC1|RB18B_DANRE Ras-related protein Rab-18-B OS=Danio rerio GN=rab18b PE=2 SV=1 355 525 2.0E-10
sp|Q9LS94|RAG3F_ARATH Ras-related protein RABG3f OS=Arabidopsis thaliana GN=RABG3F PE=2 SV=1 355 536 2.0E-10
sp|P70425|RIT2_MOUSE GTP-binding protein Rit2 OS=Mus musculus GN=Rit2 PE=1 SV=1 338 528 2.0E-10
sp|Q6DUB4|RAB7B_PAROT Ras-related protein Rab-7b OS=Paramecium octaurelia GN=Rab7b PE=1 SV=1 355 451 2.0E-10
sp|Q39573|YPTC5_CHLRE GTP-binding protein YPTC5 OS=Chlamydomonas reinhardtii GN=YPTC5 PE=3 SV=1 355 536 2.0E-10
sp|Q8K586|RANT_RAT GTP-binding nuclear protein Ran, testis-specific isoform OS=Rattus norvegicus GN=Rasl2-9 PE=2 SV=1 348 471 2.0E-10
sp|Q55ET3|RABQ_DICDI Ras-related protein RabQ OS=Dictyostelium discoideum GN=rabQ PE=3 SV=1 355 472 2.0E-10
sp|Q54NU2|RAB1D_DICDI Ras-related protein Rab-1D OS=Dictyostelium discoideum GN=rab1D PE=1 SV=1 355 528 2.0E-10
sp|P28185|RAA1A_ARATH Ras-related protein RABA1a OS=Arabidopsis thaliana GN=RABA1A PE=1 SV=1 355 526 2.0E-10
sp|P32254|RASS_DICDI Ras-like protein rasS OS=Dictyostelium discoideum GN=rasS PE=2 SV=1 355 528 2.0E-10
sp|P32836|GSP2_YEAST GTP-binding nuclear protein GSP2/CNR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GSP2 PE=1 SV=1 355 528 2.0E-10
sp|P20791|RAB8B_DICDI Ras-related protein Rab-8B OS=Dictyostelium discoideum GN=rab8B PE=2 SV=1 355 528 2.0E-10
sp|Q39222|RAA1B_ARATH Ras-related protein RABA1b OS=Arabidopsis thaliana GN=RABA1B PE=2 SV=1 355 471 3.0E-10
sp|Q9YGC0|RAN_SALSA GTP-binding nuclear protein Ran OS=Salmo salar GN=ran PE=2 SV=1 348 528 3.0E-10
sp|Q01890|YPT1_PHYIN Ras-like GTP-binding protein YPT1 OS=Phytophthora infestans GN=YPT1 PE=3 SV=1 355 527 3.0E-10
sp|P33723|YPT1_NEUCR GTP-binding protein ypt1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ypt-1 PE=3 SV=1 355 528 3.0E-10
sp|Q55CB9|RASV_DICDI Ras-like protein rasV OS=Dictyostelium discoideum GN=rasV PE=3 SV=1 355 527 3.0E-10
sp|P52498|RSR1_CANAX Ras-related protein RSR1 OS=Candida albicans GN=RSR1 PE=3 SV=1 365 528 3.0E-10
sp|P35292|RAB17_MOUSE Ras-related protein Rab-17 OS=Mus musculus GN=Rab17 PE=1 SV=1 355 528 3.0E-10
sp|Q5U1Y1|RAB34_RAT Ras-related protein Rab-34 OS=Rattus norvegicus GN=Rab34 PE=2 SV=1 355 534 3.0E-10
sp|P01119|RAS1_YEAST Ras-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAS1 PE=1 SV=2 366 530 4.0E-10
sp|Q64008|RAB34_MOUSE Ras-related protein Rab-34 OS=Mus musculus GN=Rab34 PE=1 SV=2 355 534 4.0E-10
sp|O49841|RAC2A_ARATH Ras-related protein RABC2a OS=Arabidopsis thaliana GN=RABC2A PE=1 SV=1 355 527 4.0E-10
sp|Q9S810|RAA1I_ARATH Ras-related protein RABA1i OS=Arabidopsis thaliana GN=RABA1I PE=2 SV=1 355 525 4.0E-10
sp|Q55FU9|RAB24_DICDI Ras-related protein Rab-24 OS=Dictyostelium discoideum GN=rab24 PE=3 SV=1 355 541 4.0E-10
sp|O04157|RAG3B_ARATH Ras-related protein RABG3b OS=Arabidopsis thaliana GN=RABG3B PE=1 SV=1 355 532 4.0E-10
sp|P61294|RAB6B_MOUSE Ras-related protein Rab-6B OS=Mus musculus GN=Rab6b PE=1 SV=1 355 527 5.0E-10
sp|Q9NRW1|RAB6B_HUMAN Ras-related protein Rab-6B OS=Homo sapiens GN=RAB6B PE=1 SV=1 355 527 5.0E-10
sp|A6QR46|RAB6B_BOVIN Ras-related protein Rab-6B OS=Bos taurus GN=RAB6B PE=2 SV=1 355 527 5.0E-10
sp|P32835|GSP1_YEAST GTP-binding nuclear protein GSP1/CNR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GSP1 PE=1 SV=1 355 528 5.0E-10
sp|P36017|VPS21_YEAST Vacuolar protein sorting-associated protein 21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS21 PE=1 SV=1 355 523 6.0E-10
sp|P79735|RAN_DANRE GTP-binding nuclear protein Ran OS=Danio rerio GN=ran PE=2 SV=1 352 528 6.0E-10
sp|P32939|YPT7_YEAST GTP-binding protein YPT7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT7 PE=1 SV=1 355 539 6.0E-10
sp|P36863|YPTV4_VOLCA GTP-binding protein yptV4 OS=Volvox carteri GN=YPTV4 PE=3 SV=1 355 528 6.0E-10
sp|P34141|RABA_DICDI Ras-related protein RabA OS=Dictyostelium discoideum GN=rabA PE=2 SV=2 355 451 6.0E-10
sp|Q8TFK3|GSP1_YARLI GTP-binding nuclear protein GSP1/Ran OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GSP1 PE=3 SV=1 355 528 6.0E-10
sp|Q61820|RANT_MOUSE GTP-binding nuclear protein Ran, testis-specific isoform OS=Mus musculus GN=Rasl2-9 PE=2 SV=1 348 471 6.0E-10
sp|O17915|RAN_CAEEL GTP-binding nuclear protein ran-1 OS=Caenorhabditis elegans GN=ran-1 PE=1 SV=1 345 531 6.0E-10
sp|Q7ZZX9|RAN_CARAU GTP-binding nuclear protein Ran OS=Carassius auratus GN=ran PE=2 SV=1 352 528 7.0E-10
sp|P80236|RAC1_CAVPO Ras-related C3 botulinum toxin substrate 1 (Fragment) OS=Cavia porcellus GN=RAC1 PE=1 SV=2 445 528 7.0E-10
sp|P18262|RAS_ARTSA Ras-like protein (Fragment) OS=Artemia salina PE=3 SV=1 362 528 7.0E-10
sp|Q54DA7|RAB4_DICDI Ras-related protein Rab-4 OS=Dictyostelium discoideum GN=rab4 PE=3 SV=1 355 532 7.0E-10
sp|Q41640|RAB7_VIGAC Ras-related protein Rab7 OS=Vigna aconitifolia PE=2 SV=1 355 537 7.0E-10
sp|Q39570|YPTC4_CHLRE GTP-binding protein YPTC4 OS=Chlamydomonas reinhardtii GN=YPTC4 PE=3 SV=1 355 528 8.0E-10
sp|P34213|RAB6A_CAEEL Ras-related protein Rab-6.1 OS=Caenorhabditis elegans GN=rab-6.1 PE=3 SV=1 355 545 8.0E-10
sp|Q74ZA9|GSP1_ASHGO GTP-binding nuclear protein GSP1/Ran OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GSP1 PE=3 SV=1 355 528 8.0E-10
sp|Q40195|RB11E_LOTJA Ras-related protein Rab11E OS=Lotus japonicus GN=RAB11E PE=2 SV=1 355 471 8.0E-10
sp|Q7Z6P3|RAB44_HUMAN Ras-related protein Rab-44 OS=Homo sapiens GN=RAB44 PE=1 SV=3 356 528 8.0E-10
sp|P35284|RAB12_RAT Ras-related protein Rab-12 OS=Rattus norvegicus GN=Rab12 PE=1 SV=2 355 523 9.0E-10
sp|P35283|RAB12_MOUSE Ras-related protein Rab-12 OS=Mus musculus GN=Rab12 PE=1 SV=3 355 523 9.0E-10
sp|Q8TAI7|REBL1_HUMAN GTPase RhebL1 OS=Homo sapiens GN=RHEBL1 PE=1 SV=1 341 545 9.0E-10
sp|Q6IQ22|RAB12_HUMAN Ras-related protein Rab-12 OS=Homo sapiens GN=RAB12 PE=1 SV=3 355 523 9.0E-10
sp|Q921E2|RAB31_MOUSE Ras-related protein Rab-31 OS=Mus musculus GN=Rab31 PE=1 SV=1 355 474 1.0E-09
sp|P62071|RRAS2_MOUSE Ras-related protein R-Ras2 OS=Mus musculus GN=Rras2 PE=1 SV=1 366 542 1.0E-09
sp|P62070|RRAS2_HUMAN Ras-related protein R-Ras2 OS=Homo sapiens GN=RRAS2 PE=1 SV=1 366 542 1.0E-09
sp|A8XAD0|RHEB1_CAEBR GTP-binding protein Rheb homolog 1 OS=Caenorhabditis briggsae GN=rheb-1 PE=3 SV=1 351 523 1.0E-09
sp|O97572|RAB7A_RABIT Ras-related protein Rab-7a OS=Oryctolagus cuniculus GN=RAB7A PE=2 SV=1 350 460 1.0E-09
sp|O18334|RAB6_DROME Ras-related protein Rab6 OS=Drosophila melanogaster GN=Rab6 PE=1 SV=1 348 472 1.0E-09
sp|Q55FK2|RAB6_DICDI Ras-related protein Rab-6 OS=Dictyostelium discoideum GN=rab6 PE=3 SV=1 353 472 1.0E-09
sp|A4D1S5|RAB19_HUMAN Ras-related protein Rab-19 OS=Homo sapiens GN=RAB19 PE=2 SV=2 355 528 1.0E-09
sp|Q6GQP4|RAB31_RAT Ras-related protein Rab-31 OS=Rattus norvegicus GN=Rab31 PE=1 SV=2 355 474 1.0E-09
sp|Q948K8|RAG3A_ARATH Ras-related protein RABG3a OS=Arabidopsis thaliana GN=RABG3A PE=2 SV=1 355 537 1.0E-09
sp|O04486|RAA2A_ARATH Ras-related protein RABA2a OS=Arabidopsis thaliana GN=RABA2A PE=2 SV=1 355 471 1.0E-09
sp|Q9LH50|RAA4D_ARATH Ras-related protein RABA4d OS=Arabidopsis thaliana GN=RABA4D PE=1 SV=1 355 469 1.0E-09
sp|Q3ZC27|RAB19_BOVIN Ras-related protein Rab-19 OS=Bos taurus GN=RAB19 PE=2 SV=1 355 528 1.0E-09
sp|Q4UB16|RAB1_THEAN Ras-related protein Rab-1 OS=Theileria annulata GN=rab1 PE=3 SV=1 355 528 1.0E-09
sp|Q9WVB1|RAB6A_RAT Ras-related protein Rab-6A OS=Rattus norvegicus GN=Rab6a PE=1 SV=2 355 469 1.0E-09
sp|P35279|RAB6A_MOUSE Ras-related protein Rab-6A OS=Mus musculus GN=Rab6a PE=1 SV=4 355 469 1.0E-09
sp|P28188|RAD2A_ARATH Ras-related protein RABD2a OS=Arabidopsis thaliana GN=RABD2A PE=1 SV=3 355 523 1.0E-09
sp|Q9BZG1|RAB34_HUMAN Ras-related protein Rab-34 OS=Homo sapiens GN=RAB34 PE=1 SV=1 355 534 2.0E-09
sp|Q5R9Y4|RAB7A_PONAB Ras-related protein Rab-7a OS=Pongo abelii GN=RAB7A PE=2 SV=1 350 460 2.0E-09
sp|P09527|RAB7A_RAT Ras-related protein Rab-7a OS=Rattus norvegicus GN=Rab7a PE=1 SV=2 350 460 2.0E-09
sp|Q5RAV6|RAB6A_PONAB Ras-related protein Rab-6A OS=Pongo abelii GN=RAB6A PE=2 SV=3 355 469 2.0E-09
sp|P20340|RAB6A_HUMAN Ras-related protein Rab-6A OS=Homo sapiens GN=RAB6A PE=1 SV=3 355 469 2.0E-09
sp|P51150|RAB7A_MOUSE Ras-related protein Rab-7a OS=Mus musculus GN=Rab7a PE=1 SV=2 350 460 2.0E-09
sp|P51149|RAB7A_HUMAN Ras-related protein Rab-7a OS=Homo sapiens GN=RAB7A PE=1 SV=1 350 460 2.0E-09
sp|P10949|RAB3C_BOVIN Ras-related protein Rab-3C OS=Bos taurus GN=RAB3C PE=2 SV=3 355 523 2.0E-09
sp|P49104|RAB2B_MAIZE Ras-related protein Rab-2-B OS=Zea mays GN=RAB2B PE=2 SV=1 355 527 2.0E-09
sp|Q96E17|RAB3C_HUMAN Ras-related protein Rab-3C OS=Homo sapiens GN=RAB3C PE=2 SV=1 355 523 2.0E-09
sp|P08645|RAS3_DROME Ras-like protein 3 OS=Drosophila melanogaster GN=R PE=2 SV=2 353 528 2.0E-09
sp|Q22782|RAB6B_CAEEL Ras-related protein Rab-6.2 OS=Caenorhabditis elegans GN=rab-6.2 PE=3 SV=1 348 527 2.0E-09
sp|P18067|RAB7A_CANLF Ras-related protein Rab-7a OS=Canis lupus familiaris GN=RAB7A PE=2 SV=1 350 460 2.0E-09
sp|Q9C820|RAG3D_ARATH Ras-related protein RABG3d OS=Arabidopsis thaliana GN=RABG3D PE=2 SV=1 352 443 2.0E-09
sp|P04388|RAS2_DROME Ras-like protein 2 OS=Drosophila melanogaster GN=Ras64B PE=1 SV=2 366 545 2.0E-09
sp|P97950|RB33A_MOUSE Ras-related protein Rab-33A OS=Mus musculus GN=Rab33a PE=2 SV=1 355 472 2.0E-09
sp|Q40193|RB11C_LOTJA Ras-related protein Rab11C OS=Lotus japonicus GN=RAB11C PE=2 SV=1 355 523 2.0E-09
sp|Q9SMQ6|RAA4B_ARATH Ras-related protein RABA4b OS=Arabidopsis thaliana GN=RABA4B PE=1 SV=1 355 536 2.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0097159 organic cyclic compound binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:1901363 heterocyclic compound binding No
GO:0019001 guanyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0043167 ion binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0003674 molecular_function No
GO:0017111 nucleoside-triphosphatase activity No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0016462 pyrophosphatase activity No
GO:0016787 hydrolase activity No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|855
MGGGDLNLKKSFHPTLQRNQRAVYEEEQKALAERKRTQQRINEIKEERAKEDLQRQLEAAGGKKRVDRVDWMYQG
PTDGQAGATEEMEAYLLGKRRIDNIIKGTEHKKLEKSAGQDSFMALQNANSARDTAAKIRDDPLLAIKRQEQAAY
DAMLNDPIKRRQLLSSMGIDDEKNDEMMRNGIAEDEAERMRGGVTDDRAETTRNDIADDEAEKTRDDTTDEGAER
MRNGIIEDGAERMKNGITNDGAQRMRDGIMSDGAQTMKVGHVAAEMTRKGIAAAIDRDRVVHGGQAMGDRDRGGD
DADEVNDGRGSIDDEVMISETGQQQAATKTASSGVAAGHKMPLVLCGGSKTVQRKLVLLGDGACGKTSLLNVFTR
GYFPTVYEPTVFENYVHDIFVDSVHIELSLWDTAGQEEFDRLRSLSYDDTDLIMLCYSVDSKDSLENVESKWVGE
IADNCPGVKLVLVALKCDLREQSEDEDAPVPEDRREKGPLINYDQGLEVARRIGASRYLECSAMKNRGVNEAFTE
AARVALSVNKERKEKKCIVM*
Coding >Ophun1|855
ATGGGTGGCGGAGACCTCAACCTCAAAAAGTCGTTCCATCCGACTCTGCAGCGCAATCAACGAGCCGTCTATGAA
GAGGAGCAGAAGGCTCTCGCCGAGCGCAAACGCACGCAACAGCGCATCAATGAAATCAAGGAGGAGCGCGCAAAG
GAGGATCTCCAGCGGCAACTCGAGGCTGCGGGAGGCAAAAAGAGAGTGGATCGCGTCGACTGGATGTACCAGGGC
CCGACAGATGGTCAGGCCGGGGCGACAGAGGAGATGGAGGCCTATCTGCTGGGCAAGCGGAGGATAGACAACATC
ATCAAGGGCACCGAGCACAAGAAGTTGGAAAAGTCGGCGGGGCAAGACAGCTTCATGGCGTTGCAGAATGCCAAT
AGCGCGAGAGACACTGCCGCCAAGATTCGCGACGATCCGCTCTTGGCCATCAAGCGACAGGAGCAGGCGGCCTAC
GACGCCATGTTGAACGACCCGATCAAGCGGCGACAACTGCTCTCTTCAATGGGCATCGACGATGAGAAGAACGAC
GAGATGATGAGGAACGGCATCGCAGAAGACGAAGCAGAGAGGATGAGGGGCGGCGTCACCGACGACAGAGCAGAG
ACGACGAGGAACGACATCGCCGACGACGAAGCAGAGAAGACGAGGGACGACACCACAGACGAAGGAGCGGAGAGG
ATGAGGAACGGCATCATAGAAGACGGAGCAGAGAGGATGAAGAACGGCATCACAAACGACGGAGCGCAGAGGATG
AGAGACGGCATCATGAGCGACGGAGCACAGACGATGAAGGTCGGACACGTCGCAGCAGAGATGACGAGGAAGGGC
ATCGCCGCCGCTATCGATCGCGATCGCGTAGTCCACGGCGGTCAAGCGATGGGAGATAGGGACAGAGGCGGAGAT
GATGCTGATGAGGTCAATGATGGAAGGGGGAGCATCGATGACGAGGTTATGATTTCCGAGACCGGCCAGCAGCAG
GCAGCCACCAAGACAGCCTCGTCCGGCGTCGCGGCCGGCCACAAGATGCCCCTTGTTCTCTGCGGCGGATCCAAG
ACGGTCCAGCGCAAGCTGGTGCTGCTGGGAGACGGTGCCTGTGGCAAGACTTCGCTGCTCAACGTCTTTACCAGA
GGTTACTTCCCGACCGTCTACGAACCAACCGTCTTCGAAAACTACGTGCACGACATCTTCGTTGACAGCGTCCAC
ATCGAGCTGTCGCTATGGGACACGGCCGGACAGGAGGAGTTTGACCGGCTGCGGTCGCTGTCGTACGATGACACG
GACCTCATCATGCTGTGCTACTCGGTTGACAGCAAGGACTCGCTCGAAAACGTCGAATCCAAGTGGGTGGGCGAG
ATAGCCGACAACTGCCCCGGCGTCAAGCTGGTGCTCGTCGCGCTCAAGTGCGATCTGCGCGAGCAGAGCGAAGAC
GAAGACGCGCCCGTGCCCGAGGACCGTCGCGAAAAGGGCCCGCTCATCAACTACGATCAGGGTCTGGAGGTGGCC
CGTCGGATAGGCGCCTCTCGCTACCTCGAGTGCTCCGCCATGAAGAATCGGGGCGTCAACGAAGCCTTTACCGAG
GCTGCCCGCGTCGCTCTCAGCGTCAACAAGGAGCGCAAAGAGAAGAAGTGCATCGTCATGTGA
Transcript >Ophun1|855
ATGGGTGGCGGAGACCTCAACCTCAAAAAGTCGTTCCATCCGACTCTGCAGCGCAATCAACGAGCCGTCTATGAA
GAGGAGCAGAAGGCTCTCGCCGAGCGCAAACGCACGCAACAGCGCATCAATGAAATCAAGGAGGAGCGCGCAAAG
GAGGATCTCCAGCGGCAACTCGAGGCTGCGGGAGGCAAAAAGAGAGTGGATCGCGTCGACTGGATGTACCAGGGC
CCGACAGATGGTCAGGCCGGGGCGACAGAGGAGATGGAGGCCTATCTGCTGGGCAAGCGGAGGATAGACAACATC
ATCAAGGGCACCGAGCACAAGAAGTTGGAAAAGTCGGCGGGGCAAGACAGCTTCATGGCGTTGCAGAATGCCAAT
AGCGCGAGAGACACTGCCGCCAAGATTCGCGACGATCCGCTCTTGGCCATCAAGCGACAGGAGCAGGCGGCCTAC
GACGCCATGTTGAACGACCCGATCAAGCGGCGACAACTGCTCTCTTCAATGGGCATCGACGATGAGAAGAACGAC
GAGATGATGAGGAACGGCATCGCAGAAGACGAAGCAGAGAGGATGAGGGGCGGCGTCACCGACGACAGAGCAGAG
ACGACGAGGAACGACATCGCCGACGACGAAGCAGAGAAGACGAGGGACGACACCACAGACGAAGGAGCGGAGAGG
ATGAGGAACGGCATCATAGAAGACGGAGCAGAGAGGATGAAGAACGGCATCACAAACGACGGAGCGCAGAGGATG
AGAGACGGCATCATGAGCGACGGAGCACAGACGATGAAGGTCGGACACGTCGCAGCAGAGATGACGAGGAAGGGC
ATCGCCGCCGCTATCGATCGCGATCGCGTAGTCCACGGCGGTCAAGCGATGGGAGATAGGGACAGAGGCGGAGAT
GATGCTGATGAGGTCAATGATGGAAGGGGGAGCATCGATGACGAGGTTATGATTTCCGAGACCGGCCAGCAGCAG
GCAGCCACCAAGACAGCCTCGTCCGGCGTCGCGGCCGGCCACAAGATGCCCCTTGTTCTCTGCGGCGGATCCAAG
ACGGTCCAGCGCAAGCTGGTGCTGCTGGGAGACGGTGCCTGTGGCAAGACTTCGCTGCTCAACGTCTTTACCAGA
GGTTACTTCCCGACCGTCTACGAACCAACCGTCTTCGAAAACTACGTGCACGACATCTTCGTTGACAGCGTCCAC
ATCGAGCTGTCGCTATGGGACACGGCCGGACAGGAGGAGTTTGACCGGCTGCGGTCGCTGTCGTACGATGACACG
GACCTCATCATGCTGTGCTACTCGGTTGACAGCAAGGACTCGCTCGAAAACGTCGAATCCAAGTGGGTGGGCGAG
ATAGCCGACAACTGCCCCGGCGTCAAGCTGGTGCTCGTCGCGCTCAAGTGCGATCTGCGCGAGCAGAGCGAAGAC
GAAGACGCGCCCGTGCCCGAGGACCGTCGCGAAAAGGGCCCGCTCATCAACTACGATCAGGGTCTGGAGGTGGCC
CGTCGGATAGGCGCCTCTCGCTACCTCGAGTGCTCCGCCATGAAGAATCGGGGCGTCAACGAAGCCTTTACCGAG
GCTGCCCGCGTCGCTCTCAGCGTCAACAAGGAGCGCAAAGAGAAGAAGTGCATCGTCATGTGA
Gene >Ophun1|855
ATGGGTGGCGGAGACCTCAACCTCAAAAAGTCGTTCCATCCGACTCTGCAGCGCAATCAACGAGCCGTCTATGAA
GAGGAGCAGAAGGCTCTCGCCGAGCGCAAACGCACGCAACAGCGCATCAATGAAATCAAGGAGGAGCGCGCAAAG
GAGGATCTCCAGCGGCAACTCGAGGCTGCGGGAGGCAAAAAGAGAGTGGATCGCGTCGACTGGATGTACCAGGGC
CCGACAGATGGTCAGGCCGGGGCGACAGAGGAGATGGAGGCCTATCTGCTGGGCAAGCGGAGGATAGACAACATC
ATCAAGGGCACCGAGCACAAGAAGTTGGAAAAGTCGGCGGGGCAAGACAGCTTCATGGCGTTGCAGAATGCCAAT
AGCGCGAGAGACACTGCCGCCAAGATTCGCGACGATCCGCTCTTGGCCATCAAGCGACAGGAGCAGGCGGCCTAC
GACGCCATGTTGAACGACCCGATCAAGCGGCGACAACTGCTCTCTTCAATGGGCATCGACGATGAGAAGAGTCGC
AGACGGTCAGAGACGGAAAGCAGACATGGGCGCAGGCATCATAGACGACGAGATGATGAGGAACGGCATCGCAGA
AGACGAAGCAGAGAGGATGAGGGGCGGCGTCACCGACGACAGAGCAGAGACGACGAGGAACGACATCGCCGACGA
CGAAGCAGAGAAGACGAGGGACGACACCACAGACGAAGGAGCGGAGAGGATGAGGAACGGCATCATAGAAGACGG
AGCAGAGAGGATGAAGAACGGCATCACAAACGACGGAGCGCAGAGGATGAGAGACGGCATCATGAGCGACGGAGC
ACAGACGATGAAGGTCGGACACGTCGCAGCAGAGATGACGAGGAAGGGCATCGCCGCCGCTATCGATCGCGATCG
CGTAGTCCACGGCGGTCAAGCGATGGGAGATAGGGACAGAGGCGGAGATGATGCTGATGAGGTCAATGATGGAAG
GGGGAGCATCGATGACGAGGTTATGATTTCCGAGGTGGATGCGCGAGGAGGAGATGTACATGTCTTGCACGACAC
CTTCAAGTTGCAGCTCACAAGCAAGCCATCCAAGAGCTCTACAGCAATTGCAGGAAAATATCTATATAGATATCT
AGTAATTGAAGGCCTCCCTCGATATCCTCAGCCCGGATCAGGCGCTCCCTCCACTGTTTTTAGCTCGCGTGGTGC
GTAAAGCATGGCGCTGCGGAACCATGGATGGCCGGATAAGTACCTACCCGGTACCCCGTCAATCGATTCACCCTT
GGGACGCCCTTTTTGATCCTTGATTCATCCTTCTTCTGCCCATTTTTGTTGCGTCTGCCATCCGCGCTTCGCCTT
TCTTTGGCTCTGGCTCTTGAAATCAGGCTGAGGACGATAGAATACACTGTTTGCACCGCGTTCCTCGCCTCCTCC
TCCCCGTGACGCGACGACGAGTCAGACCGGCCAGCAGCAGGCAGCCACCAAGACAGCCTCGTCCGGCGTCGCGGC
CGGCCACAAGATGCCCCTTGTTCTCTGCGGCGGATCCAAGACGGTCCAGCGCAAGCTGGTGCTGCTGTACGTGGC
CCATGATTACCTACGGACACGCTGGCAAGATGCTGACGTGCAATCTGCAGGGGAGACGGTGCCTGTGGCAAGACT
TCGCTGCTCAACGTCTTTACCAGAGGGTACGCTGTCTCCGTCGACGGGATATCGGCTGCCATTGCTCACCTTGAT
GCTCAGTTACTTCCCGACCGTCTACGAACCAACCGTCTTCGAAAACTACGTGCACGGTACGAGGGCAACCAGCGG
CGGATGCCTGCCCCCTGGAGACGCGTCGCTAACGAGACAACGGCGGTAGACATCTTCGTTGACAGCGTCCACATC
GAGCTGTCGCTATGGGACACGGCCGGACAGGAGGAGTTTGACCGGCTGCGGTCGCTGTCGTACGGTACGTGGAGC
TCCCACGCAAGGCGAGACTCGGCTAACGCGCTCGACAGATGACACGGACCTCATCATGCTGTGCTACTCGGTTGA
CAGCAAGGACTCGCTCGAAAACGTCGAATCCAAGTGGGTGGGCGAGATAGCCGACAACTGCCCCGGCGTCAAGCT
GGTGCTCGTCGCGCTCAAGTGCGATCTGCGCGAGCAGAGCGAAGACGAAGACGCGCCCGTGCCCGAGGACCGTCG
CGAAAAGGGCCCGCTCATCAACTACGATCAGGGTCTGGAGGTGGCCCGTCGGATAGGCGCCTCTCGCTACCTCGA
GTGCTCCGCCATGAAGAATCGGGGCGTCAACGAAGCCTTTACCGAGGCTGCCCGCGTCGCTCTCAGCGTCAACAA
GGAGCGCAAAGAGAAGAAGTGCATCGTCATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail