Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|851
Gene name
LocationContig_13:49346..51366
Strand+
Gene length (bp)2020
Transcript length (bp)1884
Coding sequence length (bp)1884
Protein length (aa) 628

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.0E-31 136 532
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 2.5E-14 194 545

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 92 612 6.0E-76
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 115 545 1.0E-39
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 207 543 2.0E-37
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 207 543 2.0E-37
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 125 626 4.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 92 612 6.0E-76
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 115 545 1.0E-39
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 207 543 2.0E-37
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 207 543 2.0E-37
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 125 626 4.0E-37
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 103 626 2.0E-35
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 147 545 8.0E-31
sp|P50080|AZR1_YEAST Azole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZR1 PE=1 SV=1 86 555 5.0E-30
sp|P25594|VBA3_YEAST Vacuolar basic amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA3 PE=1 SV=1 214 545 3.0E-29
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 71 545 1.0E-27
sp|P33335|SGE1_YEAST Protein SGE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGE1 PE=1 SV=1 155 514 6.0E-25
sp|O59726|FNX2_SCHPO Vacuolar membrane amino acid uptake transporter fnx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx2 PE=3 SV=1 155 468 6.0E-23
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 136 570 1.0E-22
sp|P38358|VBA2_YEAST Vacuolar basic amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA2 PE=1 SV=1 164 608 4.0E-20
sp|Q09752|FNX1_SCHPO Multidrug resistance protein fnx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx1 PE=2 SV=2 111 549 5.0E-20
sp|Q04301|VBA1_YEAST Vacuolar basic amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA1 PE=1 SV=1 126 428 2.0E-19
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 194 544 2.0E-19
sp|P0AEJ0|EMRB_ECOLI Multidrug export protein EmrB OS=Escherichia coli (strain K12) GN=emrB PE=1 SV=1 200 560 2.0E-14
sp|P0AEJ1|EMRB_ECO57 Multidrug export protein EmrB OS=Escherichia coli O157:H7 GN=emrB PE=3 SV=1 200 560 2.0E-14
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 162 476 3.0E-14
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 162 476 5.0E-14
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 135 557 6.0E-14
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 135 557 6.0E-14
sp|P9WJY5|EFPA_MYCTU Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=efpA PE=1 SV=1 137 546 1.0E-13
sp|P9WJY4|EFPA_MYCTO Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=efpA PE=3 SV=1 137 546 1.0E-13
sp|P42670|PUR8_STRAD Puromycin resistance protein pur8 OS=Streptomyces alboniger GN=pur8 PE=3 SV=1 200 441 2.0E-11
sp|P9WG90|STP_MYCTO Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=stp PE=3 SV=1 130 433 9.0E-11
sp|Q00538|MMR_BACSU Methylenomycin A resistance protein OS=Bacillus subtilis (strain 168) GN=mmr PE=3 SV=1 151 442 4.0E-10
sp|P9WG91|STP_MYCTU Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=stp PE=1 SV=1 130 433 5.0E-10
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 136 452 7.0E-10
sp|P94422|YCNB_BACSU Uncharacterized MFS-type transporter YcnB OS=Bacillus subtilis (strain 168) GN=ycnB PE=3 SV=1 160 432 2.0E-09
sp|Q92EE1|LMRB_LISIN Lincomycin resistance protein LmrB OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lmrB PE=3 SV=1 161 573 3.0E-09
sp|P44927|EMRB_HAEIN Multidrug export protein EmrB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=emrB PE=3 SV=1 194 586 3.0E-09
sp|Q8Y9K8|LMRB_LISMO Lincomycin resistance protein LmrB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmrB PE=3 SV=1 161 573 4.0E-09
sp|B5XZP2|MDTL_KLEP3 Multidrug resistance protein MdtL OS=Klebsiella pneumoniae (strain 342) GN=mdtL PE=3 SV=1 199 310 8.0E-09
sp|A4WCC3|MDTD_ENT38 Putative multidrug resistance protein MdtD OS=Enterobacter sp. (strain 638) GN=mdtD PE=3 SV=1 190 438 9.0E-09
sp|O31563|YFIU_BACSU Uncharacterized MFS-type transporter YfiU OS=Bacillus subtilis (strain 168) GN=yfiU PE=3 SV=1 132 552 9.0E-09
sp|Q99S97|SDRM_STAAN Multidrug efflux pump SdrM OS=Staphylococcus aureus (strain N315) GN=sdrM PE=1 SV=1 181 283 1.0E-08
sp|A6TG19|MDTL_KLEP7 Multidrug resistance protein MdtL OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mdtL PE=3 SV=1 198 336 1.0E-08
sp|A8AEE4|MDTD_CITK8 Putative multidrug resistance protein MdtD OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mdtD PE=3 SV=1 190 438 2.0E-08
sp|B4TNI8|MDTD_SALSV Putative multidrug resistance protein MdtD OS=Salmonella schwarzengrund (strain CVM19633) GN=mdtD PE=3 SV=1 190 313 2.0E-08
sp|Q8Z5F5|MDTD_SALTI Putative multidrug resistance protein MdtD OS=Salmonella typhi GN=mdtD PE=3 SV=1 190 318 2.0E-08
sp|P76269|YEBQ_ECOLI Uncharacterized transporter YebQ OS=Escherichia coli (strain K12) GN=yebQ PE=3 SV=2 199 459 3.0E-08
sp|Q6D2A9|MDTD_PECAS Putative multidrug resistance protein MdtD OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=mdtD PE=3 SV=1 190 310 3.0E-08
sp|B5BP47|YP53_SCHPO Uncharacterized transporter C460.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.03 PE=3 SV=1 63 301 4.0E-08
sp|B4T9U3|MDTD_SALHS Putative multidrug resistance protein MdtD OS=Salmonella heidelberg (strain SL476) GN=mdtD PE=3 SV=1 190 313 4.0E-08
sp|A9N7L0|MDTD_SALPB Putative multidrug resistance protein MdtD OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mdtD PE=3 SV=1 190 318 4.0E-08
sp|B5FMU8|MDTD_SALDC Putative multidrug resistance protein MdtD OS=Salmonella dublin (strain CT_02021853) GN=mdtD PE=3 SV=1 190 313 5.0E-08
sp|B5EXV9|MDTD_SALA4 Putative multidrug resistance protein MdtD OS=Salmonella agona (strain SL483) GN=mdtD PE=3 SV=1 190 313 5.0E-08
sp|B5R0C2|MDTD_SALEP Putative multidrug resistance protein MdtD OS=Salmonella enteritidis PT4 (strain P125109) GN=mdtD PE=3 SV=1 190 313 5.0E-08
sp|Q5PDW9|MDTD_SALPA Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mdtD PE=3 SV=1 190 313 5.0E-08
sp|B5BF67|MDTD_SALPK Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain AKU_12601) GN=mdtD PE=3 SV=1 190 313 5.0E-08
sp|B4SXW2|MDTD_SALNS Putative multidrug resistance protein MdtD OS=Salmonella newport (strain SL254) GN=mdtD PE=3 SV=1 190 313 5.0E-08
sp|C6DBD0|MDTD_PECCP Putative multidrug resistance protein MdtD OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=mdtD PE=3 SV=1 190 310 7.0E-08
sp|Q8ZNQ0|MDTD_SALTY Putative multidrug resistance protein MdtD OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtD PE=3 SV=1 190 291 9.0E-08
sp|A6TBH6|MDTD_KLEP7 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mdtD PE=3 SV=1 195 318 1.0E-07
sp|P11545|MMR_STRCO Methylenomycin A resistance protein OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=mmr PE=3 SV=1 167 291 1.0E-07
sp|A8GHR1|MDTD_SERP5 Putative multidrug resistance protein MdtD OS=Serratia proteamaculans (strain 568) GN=mdtD PE=3 SV=1 195 438 1.0E-07
sp|B5XPB7|MDTD_KLEP3 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae (strain 342) GN=mdtD PE=3 SV=1 195 318 2.0E-07
sp|P31474|HSRA_ECOLI Probable transport protein HsrA OS=Escherichia coli (strain K12) GN=hsrA PE=1 SV=1 196 290 3.0E-07
sp|O35018|LMRB_BACSU Lincomycin resistance protein LmrB OS=Bacillus subtilis (strain 168) GN=lmrB PE=3 SV=1 151 432 6.0E-07
sp|A9MJT5|MDTL_SALAR Multidrug resistance protein MdtL OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=mdtL PE=3 SV=1 199 311 8.0E-07
sp|A8ACM0|MDTL_CITK8 Multidrug resistance protein MdtL OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mdtL PE=3 SV=1 199 310 9.0E-07
sp|A7FG15|MDTD_YERP3 Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=mdtD PE=3 SV=1 190 291 1.0E-06
sp|Q1C5L8|MDTD_YERPA Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=mdtD PE=3 SV=1 190 291 1.0E-06
sp|B2K9M2|MDTD_YERPB Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=mdtD PE=3 SV=1 190 291 1.0E-06
sp|Q7CJL1|MDTD_YERPE Putative multidrug resistance protein MdtD OS=Yersinia pestis GN=mdtD PE=3 SV=1 190 291 1.0E-06
sp|A9QZU7|MDTD_YERPG Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Angola) GN=mdtD PE=3 SV=1 190 291 1.0E-06
sp|Q1CK62|MDTD_YERPN Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=mdtD PE=3 SV=1 190 291 1.0E-06
sp|B1JSD2|MDTD_YERPY Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=mdtD PE=3 SV=1 190 291 1.0E-06
sp|Q668C4|MDTD_YERPS Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=mdtD PE=3 SV=1 190 291 1.0E-06
sp|P52600|EMRY_ECOLI Probable multidrug resistance protein EmrY OS=Escherichia coli (strain K12) GN=emrY PE=2 SV=1 130 582 1.0E-06
sp|P0A0J8|QACA_STAAM Antiseptic resistance protein OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=qacA PE=3 SV=1 135 309 1.0E-06
sp|P0A0J9|QACA_STAAU Antiseptic resistance protein OS=Staphylococcus aureus GN=qacA PE=1 SV=1 135 309 1.0E-06
sp|A4TMR4|MDTD_YERPP Putative multidrug resistance protein MdtD OS=Yersinia pestis (strain Pestoides F) GN=mdtD PE=3 SV=1 190 291 1.0E-06
sp|A1JKW8|MDTD_YERE8 Putative multidrug resistance protein MdtD OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=mdtD PE=3 SV=2 195 291 2.0E-06
sp|P44903|HSRA_HAEIN Probable transport protein HsrA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hsrA PE=3 SV=1 190 294 2.0E-06
sp|P9WJX3|Y1634_MYCTU Probable multidrug-efflux transporter Rv1634 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1634 PE=1 SV=1 182 303 2.0E-06
sp|P9WJX2|Y1634_MYCTO Probable multidrug-efflux transporter MT1670 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1670 PE=3 SV=1 182 303 2.0E-06
sp|Q8Z2N9|MDTL_SALTI Multidrug resistance protein MdtL OS=Salmonella typhi GN=mdtL PE=3 SV=1 199 311 3.0E-06
sp|B5BIM0|MDTL_SALPK Multidrug resistance protein MdtL OS=Salmonella paratyphi A (strain AKU_12601) GN=mdtL PE=3 SV=1 199 311 3.0E-06
sp|Q5PKV6|MDTL_SALPA Multidrug resistance protein MdtL OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mdtL PE=3 SV=1 199 311 3.0E-06
sp|B4TAV4|MDTL_SALHS Multidrug resistance protein MdtL OS=Salmonella heidelberg (strain SL476) GN=mdtL PE=3 SV=1 199 311 4.0E-06
sp|B4TN12|MDTL_SALSV Multidrug resistance protein MdtL OS=Salmonella schwarzengrund (strain CVM19633) GN=mdtL PE=3 SV=1 199 311 5.0E-06
sp|B5EYX7|MDTL_SALA4 Multidrug resistance protein MdtL OS=Salmonella agona (strain SL483) GN=mdtL PE=3 SV=1 199 311 5.0E-06
sp|A9MX86|MDTL_SALPB Multidrug resistance protein MdtL OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mdtL PE=3 SV=1 199 311 5.0E-06
sp|B4SYB3|MDTL_SALNS Multidrug resistance protein MdtL OS=Salmonella newport (strain SL254) GN=mdtL PE=3 SV=1 199 311 5.0E-06
sp|B7LK52|MDTL_ESCF3 Multidrug resistance protein MdtL OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mdtL PE=3 SV=1 198 336 5.0E-06
sp|A4TMJ0|NANT_YERPP Putative sialic acid transporter OS=Yersinia pestis (strain Pestoides F) GN=nanT PE=3 SV=1 145 310 6.0E-06
sp|Q668K2|NANT_YERPS Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=nanT PE=3 SV=1 145 310 6.0E-06
sp|A9QZJ2|NANT_YERPG Putative sialic acid transporter OS=Yersinia pestis bv. Antiqua (strain Angola) GN=nanT PE=3 SV=1 145 310 6.0E-06
sp|B2K942|NANT_YERPB Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=nanT PE=3 SV=1 145 310 6.0E-06
sp|A7FG99|NANT_YERP3 Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=nanT PE=3 SV=1 145 310 6.0E-06
sp|Q8ZCH3|NANT_YERPE Putative sialic acid transporter OS=Yersinia pestis GN=nanT PE=3 SV=1 145 310 8.0E-06
sp|Q1C5V2|NANT_YERPA Putative sialic acid transporter OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=nanT PE=3 SV=1 145 310 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 128 150 22
2 162 181 19
3 191 210 19
4 217 239 22
5 249 271 22
6 280 302 22
7 317 339 22
8 346 368 22
9 391 413 22
10 426 448 22
11 453 475 22
12 482 504 22
13 588 610 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|851
MPRPVREPPREGESTSRPISGILSPWRFSTIGSDELSVFSPLEETHITALDFVFPSRRVSWRQSVASNAELVTRF
PARAPTVAKIRQSTSSITESPVDVSATDAHSISSWNLHHGEDPSAAPELEPEYPTGFTLWIMIAALISSIFLIAL
DMANEFHGLQDVAWYSAIFFMTAGGFQSTWGKTYKSFPLKIGVLTAISIFEVGNLICGVAPSSSVFIVGRAIAGV
GAAGVGSGSYTLVAFIAEPKKRAAYTGLLGAIFGIGSVLGPLLGGVFSSRSTWRWCFYINLPIGVLPVITLVFFF
RPPATAKPQEVPLREKLLGMDPLGTCLLMGIIITYLMAVHYGGQILPWSSPLVIGLLVGSAGLALAFALCEYWQG
DRAIVIPRLLSQRRIGLSAVFTILQSGAFFSMIYYLPLYFQAIRGSDAVVSGVQNLPFILAAMLGALGAGIFISS
TGMSTLVMVAGTAFGTLGCGLCYMFDVNTSTGTWIGYQIIAGVSLGGALQIPVIVGQVSVQPEDLSSATSMMLCF
QTLGGAIWTSAAQSAFVNRMIATLPELAPGIDPMKVVATGAGQLRSVFGAGELHGVLAAYLEGIRTAFILSSVIG
GGACLLGVFLPWKRLDVVAVRENSGGA*
Coding >Ophun1|851
ATGCCTAGACCTGTCCGGGAACCTCCCCGGGAAGGGGAATCGACGTCCCGGCCCATCAGCGGCATTTTGTCGCCA
TGGCGCTTCTCAACCATCGGCTCCGACGAGCTTTCCGTCTTCAGCCCGCTCGAGGAGACGCACATTACGGCCCTC
GACTTTGTCTTTCCGTCACGACGCGTCAGCTGGCGCCAGTCCGTCGCCAGTAATGCAGAGCTTGTCACGCGCTTT
CCGGCGAGGGCTCCGACGGTCGCCAAGATACGTCAGTCGACGAGTTCGATTACTGAATCGCCCGTCGATGTATCG
GCTACGGACGCGCACTCCATAAGCTCCTGGAATCTCCATCATGGCGAGGATCCCTCTGCGGCGCCGGAGCTGGAA
CCCGAGTATCCTACCGGGTTCACGCTATGGATCATGATAGCAGCTCTCATCTCTAGCATCTTTCTCATCGCTCTG
GACATGGCAAACGAGTTCCACGGCCTCCAGGACGTAGCCTGGTACAGCGCCATCTTCTTCATGACCGCCGGCGGC
TTCCAGTCAACCTGGGGCAAGACGTACAAGTCCTTCCCCCTCAAGATCGGCGTCCTGACGGCCATCTCCATCTTT
GAAGTGGGCAACCTCATCTGCGGAGTGGCGCCCAGCTCGTCCGTCTTCATTGTCGGCCGTGCCATCGCAGGCGTC
GGAGCAGCGGGCGTTGGCTCCGGCTCGTACACCCTCGTTGCCTTTATCGCCGAGCCCAAGAAGAGGGCGGCCTAT
ACCGGTCTTCTCGGGGCTATCTTCGGTATTGGAAGTGTGCTGGGTCCGCTTCTGGGCGGTGTGTTTTCCAGTAGG
AGCACGTGGAGATGGTGCTTTTACATCAACCTCCCGATAGGTGTACTTCCCGTCATAACCCTAGTATTCTTCTTT
CGCCCTCCCGCAACGGCAAAGCCCCAAGAGGTGCCCTTGAGAGAGAAGCTACTAGGAATGGATCCGCTCGGCACA
TGTCTCCTGATGGGAATCATCATCACCTACCTGATGGCCGTCCATTACGGCGGTCAGATCTTGCCTTGGTCCTCG
CCGCTCGTCATCGGCCTCTTGGTTGGCTCGGCCGGACTGGCCCTCGCCTTCGCGCTGTGCGAGTACTGGCAAGGA
GACAGGGCCATCGTCATCCCTCGCCTCTTATCGCAGAGACGCATCGGCCTTTCGGCCGTCTTTACCATCCTTCAG
TCCGGCGCCTTCTTCTCCATGATCTACTACCTTCCGCTATACTTCCAGGCCATCAGGGGCAGCGACGCCGTGGTC
TCGGGTGTCCAGAACCTGCCATTTATTCTGGCTGCTATGCTGGGCGCCCTCGGGGCCGGCATCTTCATCTCCAGC
ACCGGCATGTCGACGCTCGTCATGGTAGCCGGGACAGCTTTTGGCACGCTGGGCTGCGGCCTCTGCTACATGTTT
GACGTCAACACGTCGACCGGCACCTGGATAGGCTACCAGATCATCGCAGGCGTAAGTCTCGGAGGCGCGCTTCAG
ATCCCCGTCATCGTTGGCCAGGTCAGCGTCCAGCCCGAAGACCTGTCATCGGCCACGTCCATGATGCTCTGCTTC
CAGACGCTCGGCGGCGCCATCTGGACCTCAGCCGCGCAGTCAGCCTTTGTCAACCGAATGATAGCGACGCTACCC
GAGTTGGCGCCTGGCATTGACCCGATGAAGGTCGTGGCTACGGGAGCTGGACAGTTGCGCAGCGTCTTTGGTGCG
GGAGAGCTACATGGGGTCTTGGCCGCTTACCTCGAGGGTATCAGGACGGCTTTTATTCTGTCCTCTGTCATCGGG
GGCGGGGCTTGTCTCTTGGGCGTGTTTCTGCCGTGGAAAAGGCTTGACGTGGTTGCGGTGAGGGAGAACTCGGGA
GGTGCGTAA
Transcript >Ophun1|851
ATGCCTAGACCTGTCCGGGAACCTCCCCGGGAAGGGGAATCGACGTCCCGGCCCATCAGCGGCATTTTGTCGCCA
TGGCGCTTCTCAACCATCGGCTCCGACGAGCTTTCCGTCTTCAGCCCGCTCGAGGAGACGCACATTACGGCCCTC
GACTTTGTCTTTCCGTCACGACGCGTCAGCTGGCGCCAGTCCGTCGCCAGTAATGCAGAGCTTGTCACGCGCTTT
CCGGCGAGGGCTCCGACGGTCGCCAAGATACGTCAGTCGACGAGTTCGATTACTGAATCGCCCGTCGATGTATCG
GCTACGGACGCGCACTCCATAAGCTCCTGGAATCTCCATCATGGCGAGGATCCCTCTGCGGCGCCGGAGCTGGAA
CCCGAGTATCCTACCGGGTTCACGCTATGGATCATGATAGCAGCTCTCATCTCTAGCATCTTTCTCATCGCTCTG
GACATGGCAAACGAGTTCCACGGCCTCCAGGACGTAGCCTGGTACAGCGCCATCTTCTTCATGACCGCCGGCGGC
TTCCAGTCAACCTGGGGCAAGACGTACAAGTCCTTCCCCCTCAAGATCGGCGTCCTGACGGCCATCTCCATCTTT
GAAGTGGGCAACCTCATCTGCGGAGTGGCGCCCAGCTCGTCCGTCTTCATTGTCGGCCGTGCCATCGCAGGCGTC
GGAGCAGCGGGCGTTGGCTCCGGCTCGTACACCCTCGTTGCCTTTATCGCCGAGCCCAAGAAGAGGGCGGCCTAT
ACCGGTCTTCTCGGGGCTATCTTCGGTATTGGAAGTGTGCTGGGTCCGCTTCTGGGCGGTGTGTTTTCCAGTAGG
AGCACGTGGAGATGGTGCTTTTACATCAACCTCCCGATAGGTGTACTTCCCGTCATAACCCTAGTATTCTTCTTT
CGCCCTCCCGCAACGGCAAAGCCCCAAGAGGTGCCCTTGAGAGAGAAGCTACTAGGAATGGATCCGCTCGGCACA
TGTCTCCTGATGGGAATCATCATCACCTACCTGATGGCCGTCCATTACGGCGGTCAGATCTTGCCTTGGTCCTCG
CCGCTCGTCATCGGCCTCTTGGTTGGCTCGGCCGGACTGGCCCTCGCCTTCGCGCTGTGCGAGTACTGGCAAGGA
GACAGGGCCATCGTCATCCCTCGCCTCTTATCGCAGAGACGCATCGGCCTTTCGGCCGTCTTTACCATCCTTCAG
TCCGGCGCCTTCTTCTCCATGATCTACTACCTTCCGCTATACTTCCAGGCCATCAGGGGCAGCGACGCCGTGGTC
TCGGGTGTCCAGAACCTGCCATTTATTCTGGCTGCTATGCTGGGCGCCCTCGGGGCCGGCATCTTCATCTCCAGC
ACCGGCATGTCGACGCTCGTCATGGTAGCCGGGACAGCTTTTGGCACGCTGGGCTGCGGCCTCTGCTACATGTTT
GACGTCAACACGTCGACCGGCACCTGGATAGGCTACCAGATCATCGCAGGCGTAAGTCTCGGAGGCGCGCTTCAG
ATCCCCGTCATCGTTGGCCAGGTCAGCGTCCAGCCCGAAGACCTGTCATCGGCCACGTCCATGATGCTCTGCTTC
CAGACGCTCGGCGGCGCCATCTGGACCTCAGCCGCGCAGTCAGCCTTTGTCAACCGAATGATAGCGACGCTACCC
GAGTTGGCGCCTGGCATTGACCCGATGAAGGTCGTGGCTACGGGAGCTGGACAGTTGCGCAGCGTCTTTGGTGCG
GGAGAGCTACATGGGGTCTTGGCCGCTTACCTCGAGGGTATCAGGACGGCTTTTATTCTGTCCTCTGTCATCGGG
GGCGGGGCTTGTCTCTTGGGCGTGTTTCTGCCGTGGAAAAGGCTTGACGTGGTTGCGGTGAGGGAGAACTCGGGA
GGTGCGTAA
Gene >Ophun1|851
ATGCCTAGACCTGTCCGGGAACCTCCCCGGGAAGGGGAATCGACGTCCCGGCCCATCAGCGGCATTTTGTCGCCA
TGGCGCTTCTCAACCATCGGCTCCGACGAGCTTTCCGTCTTCAGCCCGCTCGAGGAGACGCACATTACGGCCCTC
GACTTTGTCTTTCCGTCACGACGCGTCAGCTGGCGCCAGTCCGTCGCCAGTAATGCAGAGCTTGTCACGCGCTTT
CCGGCGAGGGCTCCGACGGTCGCCAAGATACGTCAGTCGACGAGTTCGATTACTGAATCGCCCGTCGATGTATCG
GCTACGGACGCGCACTCCATAAGCTCCTGGAATCTCCATCATGGCGAGGATCCCTCTGCGGCGCCGGAGCTGGAA
CCCGAGTATCCTACCGGGTTCACGCTATGGATCATGATAGCAGCTCTCATCTCTAGCATCTTTCTCATCGCTCTG
GACATGGCAAGTCGCAGCCTCGATACCCTAAACATCAGACCATATTCCTGACCTTCTATAGACCATCGTCGCCAC
GGCCGTTCCCGCCATCACAGACGAGTTCCACGGCCTCCAGGACGTAGCCTGGTACAGCGCCATCTTCTTCATGAC
CGCCGGCGGCTTCCAGTCAACCTGGGGCAAGACGTACAAGTCCTTCCCCCTCAAGATCGGCGTCCTGACGGCCAT
CTCCATCTTTGAAGTGGGCAACCTCATCTGCGGAGTGGCGCCCAGCTCGTCCGTCTTCATTGTCGGCCGTGCCAT
CGCAGGCGTCGGAGCAGCGGGCGTTGGCTCCGGCTCGTACACCCTCGTTGCCTTTATCGCCGAGCCCAAGAAGAG
GGCGGCCTATACCGGTCTTCTCGGGGCTATCTTCGGTATTGGAAGTGTGCTGGGTCCGCTTCTGGGCGGTGTGTT
TTCCAGTAGGAGCACGTGGAGATGGTGAGTGTCTTGATCGGATCTTCGAGAGAACTCAGAGCTCACTCCTTCAAG
GTGCTTTTACATCAACCTCCCGATAGGTGTACTTCCCGTCATAACCCTAGTATTCTTCTTTCGCCCTCCCGCAAC
GGCAAAGCCCCAAGAGGTGCCCTTGAGAGAGAAGCTACTAGGAATGGATCCGCTCGGCACATGTCTCCTGATGGG
AATCATCATCACCTACCTGATGGCCGTCCATTACGGCGGTCAGATCTTGCCTTGGTCCTCGCCGCTCGTCATCGG
CCTCTTGGTTGGCTCGGCCGGACTGGCCCTCGCCTTCGCGCTGTGCGAGTACTGGCAAGGAGACAGGGCCATCGT
CATCCCTCGCCTCTTATCGCAGAGACGCATCGGCCTTTCGGCCGTCTTTACCATCCTTCAGTCCGGCGCCTTCTT
CTCCATGATCTACTACCTTCCGCTATACTTCCAGGCCATCAGGGGCAGCGACGCCGTGGTCTCGGGTGTCCAGAA
CCTGCCATTTATTCTGGCTGCTATGCTGGGCGCCCTCGGGGCCGGCATCTTCATCTCCAGCACCGGCATGTCGAC
GCTCGTCATGGTAGCCGGGACAGCTTTTGGCACGCTGGGCTGCGGCCTCTGCTACATGTTTGACGTCAACACGTC
GACCGGCACCTGGATAGGCTACCAGATCATCGCAGGCGTAAGTCTCGGAGGCGCGCTTCAGATCCCCGTCATCGT
TGGCCAGGTCAGCGTCCAGCCCGAAGACCTGTCATCGGCCACGTCCATGATGCTCTGCTTCCAGACGCTCGGCGG
CGCCATCTGGACCTCAGCCGCGCAGTCAGCCTTTGTCAACCGAATGATAGCGACGCTACCCGAGTTGGCGCCTGG
CATTGACCCGATGAAGGTCGTGGCTACGGGAGCTGGACAGTTGCGCAGCGTCTTTGGTGCGGGAGAGCTACATGG
GGTCTTGGCCGCTTACCTCGAGGGTATCAGGACGGCTTTTATTCTGTCCTCTGTCATCGGGGGCGGGGCTTGTCT
CTTGGGCGTGTTTCTGCCGTGGAAAAGGCTTGACGTGGTTGCGGTGAGGGAGAACTCGGGAGGTGCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail