Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|843
Gene name
LocationContig_13:34284..34694
Strand-
Gene length (bp)410
Transcript length (bp)291
Coding sequence length (bp)291
Protein length (aa) 97

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 1.2E-10 16 96
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 2.9E-07 26 96

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09851|AYR1_SCHPO NADPH-dependent 1-acyldihydroxyacetone phosphate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ayr1 PE=3 SV=2 15 96 5.0E-16
sp|P50170|RDH2_RAT Retinol dehydrogenase 2 OS=Rattus norvegicus GN=Rdh2 PE=1 SV=1 16 96 6.0E-06
sp|O88451|RDH7_MOUSE Retinol dehydrogenase 7 OS=Mus musculus GN=Rdh7 PE=1 SV=1 16 96 7.0E-06
sp|P42317|YXJF_BACSU Uncharacterized oxidoreductase YxjF OS=Bacillus subtilis (strain 168) GN=yxjF PE=3 SV=2 15 96 8.0E-06
sp|P55006|RDH7_RAT Retinol dehydrogenase 7 OS=Rattus norvegicus GN=Rdh7 PE=2 SV=1 16 96 8.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09851|AYR1_SCHPO NADPH-dependent 1-acyldihydroxyacetone phosphate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ayr1 PE=3 SV=2 15 96 5.0E-16
sp|P50170|RDH2_RAT Retinol dehydrogenase 2 OS=Rattus norvegicus GN=Rdh2 PE=1 SV=1 16 96 6.0E-06
sp|O88451|RDH7_MOUSE Retinol dehydrogenase 7 OS=Mus musculus GN=Rdh7 PE=1 SV=1 16 96 7.0E-06
sp|P42317|YXJF_BACSU Uncharacterized oxidoreductase YxjF OS=Bacillus subtilis (strain 168) GN=yxjF PE=3 SV=2 15 96 8.0E-06
sp|P55006|RDH7_RAT Retinol dehydrogenase 7 OS=Rattus norvegicus GN=Rdh7 PE=2 SV=1 16 96 8.0E-06
sp|P50169|RDH3_RAT Retinol dehydrogenase 3 OS=Rattus norvegicus GN=Rdh3 PE=1 SV=1 16 96 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|843
MLCLCSSLDAMSRDKKFALVTGCGQGGIGEALVQEFTRRGLHAIATVLPSENDEHLTRDGITCFPLDVTKEESVV
KLKEAVVKLTGGFLDVLVNNA*
Coding >Ophun1|843
ATGCTCTGCCTCTGTTCCAGCCTCGACGCCATGTCTCGCGACAAGAAGTTTGCCTTGGTGACTGGCTGCGGTCAG
GGCGGCATCGGTGAGGCTCTTGTCCAGGAGTTCACTCGCCGCGGTCTTCATGCCATTGCCACTGTCCTCCCATCG
GAGAACGACGAGCACCTAACGAGAGATGGAATTACTTGCTTTCCCCTGGATGTAACCAAGGAGGAGTCGGTCGTC
AAGTTGAAGGAGGCTGTTGTGAAGCTTACAGGGGGGTTCTTGGACGTCTTGGTAAACAACGCGTGA
Transcript >Ophun1|843
ATGCTCTGCCTCTGTTCCAGCCTCGACGCCATGTCTCGCGACAAGAAGTTTGCCTTGGTGACTGGCTGCGGTCAG
GGCGGCATCGGTGAGGCTCTTGTCCAGGAGTTCACTCGCCGCGGTCTTCATGCCATTGCCACTGTCCTCCCATCG
GAGAACGACGAGCACCTAACGAGAGATGGAATTACTTGCTTTCCCCTGGATGTAACCAAGGAGGAGTCGGTCGTC
AAGTTGAAGGAGGCTGTTGTGAAGCTTACAGGGGGGTTCTTGGACGTCTTGGTAAACAACGCGTGA
Gene >Ophun1|843
ATGCTCTGCCTCTGTTCCGTGAGTAAAGTCCAAGCACGGTTCCTTTCCAGTATCTCGCAGGCCCCAGGCTAACGC
AACAGAGCCTCGACGCCATGTCTCGCGACAAGAAGTTTGCCTTGGTGACTGGGTAAGTTGGCCTGTGTAAATGGT
CAATTGTTGAAAGAAAGTTGACTGATCTTTACAGCTGCGGTCAGGGCGGCATCGGTGAGGCTCTTGTCCAGGAGT
TCACTCGCCGCGGTCTTCATGCCATTGCCACTGTCCTCCCATCGGAGAACGACGAGCACCTAACGAGAGATGGAA
TTACTTGCTTTCCCCTGGATGTAACCAAGGAGGAGTCGGTCGTCAAGTTGAAGGAGGCTGTTGTGAAGCTTACAG
GGGGGTTCTTGGACGTCTTGGTAAACAACGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail