Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|842
Gene name
LocationContig_13:33299..34154
Strand-
Gene length (bp)855
Transcript length (bp)516
Coding sequence length (bp)516
Protein length (aa) 172

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 2.6E-16 5 78
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 2.8E-10 3 78

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09851|AYR1_SCHPO NADPH-dependent 1-acyldihydroxyacetone phosphate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ayr1 PE=3 SV=2 3 79 6.0E-19
sp|P40471|AYR1_YEAST NADPH-dependent 1-acyldihydroxyacetone phosphate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AYR1 PE=1 SV=1 3 169 9.0E-18
sp|O05730|VDLC_HELPY Probable short-chain type dehydrogenase/reductase VdlC OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=vdlC PE=3 SV=2 5 88 2.0E-09
sp|Q9ZKW1|VDLC_HELPJ Probable short-chain type dehydrogenase/reductase VdlC OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=vdlC PE=3 SV=1 5 88 3.0E-09
sp|Q5R6U1|DRS7B_PONAB Dehydrogenase/reductase SDR family member 7B OS=Pongo abelii GN=DHRS7B PE=2 SV=2 2 124 6.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09851|AYR1_SCHPO NADPH-dependent 1-acyldihydroxyacetone phosphate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ayr1 PE=3 SV=2 3 79 6.0E-19
sp|P40471|AYR1_YEAST NADPH-dependent 1-acyldihydroxyacetone phosphate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AYR1 PE=1 SV=1 3 169 9.0E-18
sp|O05730|VDLC_HELPY Probable short-chain type dehydrogenase/reductase VdlC OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=vdlC PE=3 SV=2 5 88 2.0E-09
sp|Q9ZKW1|VDLC_HELPJ Probable short-chain type dehydrogenase/reductase VdlC OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=vdlC PE=3 SV=1 5 88 3.0E-09
sp|Q5R6U1|DRS7B_PONAB Dehydrogenase/reductase SDR family member 7B OS=Pongo abelii GN=DHRS7B PE=2 SV=2 2 124 6.0E-08
sp|Q6IAN0|DRS7B_HUMAN Dehydrogenase/reductase SDR family member 7B OS=Homo sapiens GN=DHRS7B PE=1 SV=2 2 124 2.0E-07
sp|Q0VFE7|DRS7B_XENTR Dehydrogenase/reductase SDR family member 7B OS=Xenopus tropicalis GN=dhrs7b PE=2 SV=1 2 163 2.0E-07
sp|Q1DNC5|MKAR_COCIM Very-long-chain 3-oxoacyl-CoA reductase OS=Coccidioides immitis (strain RS) GN=CIMG_08188 PE=3 SV=2 4 80 4.0E-07
sp|P54554|YQJQ_BACSU Uncharacterized oxidoreductase YqjQ OS=Bacillus subtilis (strain 168) GN=yqjQ PE=3 SV=1 2 77 5.0E-07
sp|P51658|DHB2_MOUSE Estradiol 17-beta-dehydrogenase 2 OS=Mus musculus GN=Hsd17b2 PE=1 SV=2 12 76 5.0E-07
sp|O32291|YXNA_BACSU Uncharacterized oxidoreductase YxnA OS=Bacillus subtilis (strain 168) GN=yxnA PE=3 SV=2 3 77 6.0E-07
sp|P37059|DHB2_HUMAN Estradiol 17-beta-dehydrogenase 2 OS=Homo sapiens GN=HSD17B2 PE=1 SV=1 12 77 6.0E-07
sp|Q0IH28|DRS7B_XENLA Dehydrogenase/reductase SDR family member 7B OS=Xenopus laevis GN=dhrs7b PE=2 SV=1 2 88 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.5

Transmembrane Domains

Domain # Start End Length
1 32 54 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|842
MTAIDTDVNSVKRMFDVNLFGPMQMVHHFHDMIIRATGTIVNIGSIGGIVPYMYGSSYNASKAALHHWSNTLRLE
MSPFNHNRSLYSPLASEFKLHVQRTPETTNRFDYAAHVVAQSLKPSPTAWFWYGKATSIIRFFDTFAWRTFWDFV
FWREFKLGKVREAHFSRGKTD*
Coding >Ophun1|842
ATGACGGCAATCGACACCGATGTCAACTCAGTAAAACGCATGTTCGACGTAAACCTCTTCGGCCCGATGCAGATG
GTTCACCACTTCCACGACATGATAATCCGCGCCACAGGCACCATCGTGAACATTGGCTCTATCGGTGGAATCGTA
CCTTATATGTACGGATCCTCGTACAATGCGTCCAAGGCTGCTCTTCACCACTGGTCCAACACGCTACGTCTGGAG
ATGTCGCCGTTTAATCATAACAGATCACTTTACTCACCCCTCGCCTCCGAATTCAAACTCCACGTTCAAAGAACC
CCAGAAACAACAAACCGATTCGACTACGCCGCCCACGTCGTCGCGCAGTCCCTGAAGCCATCGCCAACCGCCTGG
TTCTGGTACGGCAAGGCGACGAGCATCATCCGCTTCTTCGACACGTTTGCGTGGCGGACCTTTTGGGACTTTGTG
TTTTGGAGGGAGTTTAAGCTGGGCAAGGTTCGGGAGGCGCATTTCTCTCGGGGGAAGACAGATTAG
Transcript >Ophun1|842
ATGACGGCAATCGACACCGATGTCAACTCAGTAAAACGCATGTTCGACGTAAACCTCTTCGGCCCGATGCAGATG
GTTCACCACTTCCACGACATGATAATCCGCGCCACAGGCACCATCGTGAACATTGGCTCTATCGGTGGAATCGTA
CCTTATATGTACGGATCCTCGTACAATGCGTCCAAGGCTGCTCTTCACCACTGGTCCAACACGCTACGTCTGGAG
ATGTCGCCGTTTAATCATAACAGATCACTTTACTCACCCCTCGCCTCCGAATTCAAACTCCACGTTCAAAGAACC
CCAGAAACAACAAACCGATTCGACTACGCCGCCCACGTCGTCGCGCAGTCCCTGAAGCCATCGCCAACCGCCTGG
TTCTGGTACGGCAAGGCGACGAGCATCATCCGCTTCTTCGACACGTTTGCGTGGCGGACCTTTTGGGACTTTGTG
TTTTGGAGGGAGTTTAAGCTGGGCAAGGTTCGGGAGGCGCATTTCTCTCGGGGGAAGACAGATTAG
Gene >Ophun1|842
ATGACGGCAATCGACACCGATGTCAACTCAGTAAAACGCATGTTCGACGTAAACCTCTTCGGCCCGATGCAGATG
GTTCACCACTTCCACGACATGATAATCCGCGCCACAGGCACCATCGTGAACATTGGCTCTATCGGTGGAATCGTA
CCTTATATGTACGGATGTAAGAGACTCGCACAGGCTCACCACGGCTCGCGTTGACACATTTTCAGCCTCGTACAA
TGCGTCCAAGGCTGCTCTTCACCACTGGTCCAACACGCTACGTCTGGAGATGTCGCCGTTTAAGTGCGTCTCAGC
CTGTGCAGAGAGATGGTCGGCTAACAATTGCTGTTATCTAGTGTGAAAGTCATAACAGTGAGTTGACTATGTGAA
CGGTATTATTGTTTACCTCTCCTTACGAGATGACAGGTGATTTCCGGGGAAGTCGGAACCAACATTCTGAAGAAC
GACGTAAATCGAGAATTGCCAAAAGGTCTACTTCATTGCATGACGCCTCTTGTTCTTCGCTAACAACAGTTCAGG
ATCACTTTACTCACCCCTCGCCTCCGAATTCAAACTCCACGTTCAAAGAACCCCAGGTCTGTCCAACACCACCTG
CCTCGCCCATAAGTATAACGGAACATACTGAGTCTTGCCGCAGAAACAACAAACCGATTCGACTACGCCGCCCAC
GTCGTCGCGCAGTCCCTGAAGCCATCGCCAACCGCCTGGTTCTGGTACGGCAAGGCGACGAGCATCATCCGCTTC
TTCGACACGTTTGCGTGGCGGACCTTTTGGGACTTTGTGTTTTGGAGGGAGTTTAAGCTGGGCAAGGTTCGGGAG
GCGCATTTCTCTCGGGGGAAGACAGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail