Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|84
Gene name
LocationContig_10:65894..67595
Strand-
Gene length (bp)1701
Transcript length (bp)1629
Coding sequence length (bp)1629
Protein length (aa) 543

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 2.4E-69 60 521

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B8NHY4|ORDA_ASPFN O-methylsterigmatocystin oxidoreductase OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=ordA PE=2 SV=1 31 542 3.0E-102
sp|Q5VDD6|ORDA_ASPFL O-methylsterigmatocystin oxidoreductase OS=Aspergillus flavus GN=ordA PE=3 SV=2 31 542 3.0E-102
sp|O13345|ORDA_ASPPA O-methylsterigmatocystin oxidoreductase OS=Aspergillus parasiticus GN=ordA PE=1 SV=1 37 542 2.0E-100
sp|P79761|CP1A5_CHICK Cytochrome P450 1A5 OS=Gallus gallus GN=CYP1A5 PE=2 SV=1 60 509 4.0E-42
sp|Q64458|CP2CT_MOUSE Cytochrome P450 2C29 OS=Mus musculus GN=Cyp2c29 PE=1 SV=2 55 521 1.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B8NHY4|ORDA_ASPFN O-methylsterigmatocystin oxidoreductase OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=ordA PE=2 SV=1 31 542 3.0E-102
sp|Q5VDD6|ORDA_ASPFL O-methylsterigmatocystin oxidoreductase OS=Aspergillus flavus GN=ordA PE=3 SV=2 31 542 3.0E-102
sp|O13345|ORDA_ASPPA O-methylsterigmatocystin oxidoreductase OS=Aspergillus parasiticus GN=ordA PE=1 SV=1 37 542 2.0E-100
sp|P79761|CP1A5_CHICK Cytochrome P450 1A5 OS=Gallus gallus GN=CYP1A5 PE=2 SV=1 60 509 4.0E-42
sp|Q64458|CP2CT_MOUSE Cytochrome P450 2C29 OS=Mus musculus GN=Cyp2c29 PE=1 SV=2 55 521 1.0E-41
sp|P05179|CP2C7_RAT Cytochrome P450 2C7 OS=Rattus norvegicus GN=Cyp2c7 PE=1 SV=2 52 519 1.0E-41
sp|P24460|CP2BB_CANLF Cytochrome P450 2B11 OS=Canis lupus familiaris GN=CYP2B11 PE=2 SV=1 54 514 2.0E-41
sp|P79760|CP1A4_CHICK Cytochrome P450 1A4 OS=Gallus gallus GN=CYP1A4 PE=2 SV=1 60 524 2.0E-41
sp|Q4WAW8|FTME_ASPFU Fumitremorgin C synthase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-2 PE=3 SV=1 34 537 2.0E-40
sp|B9WZX4|FTME_ASPFM Fumitremorgin C synthase OS=Neosartorya fumigata GN=ftmP450-2 PE=1 SV=1 34 537 2.0E-40
sp|O18963|CP2E1_BOVIN Cytochrome P450 2E1 OS=Bos taurus GN=CYP2E1 PE=2 SV=1 58 531 6.0E-40
sp|P56654|CP237_MOUSE Cytochrome P450 2C37 OS=Mus musculus GN=Cyp2c37 PE=1 SV=2 33 519 2.0E-39
sp|O48956|C98A1_SORBI Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1 PE=2 SV=1 60 538 2.0E-39
sp|Q6GUQ4|CP2E1_MACMU Cytochrome P450 2E1 OS=Macaca mulatta GN=CYP2E1 PE=2 SV=1 58 530 2.0E-39
sp|Q92088|CP2M1_ONCMY Cytochrome P450 2M1 OS=Oncorhynchus mykiss GN=cyp2m1 PE=1 SV=1 29 532 2.0E-39
sp|O48922|C98A2_SOYBN Cytochrome P450 98A2 OS=Glycine max GN=CYP98A2 PE=2 SV=1 34 533 3.0E-39
sp|P51581|CP2E1_MESAU Cytochrome P450 2E1 OS=Mesocricetus auratus GN=CYP2E1 PE=2 SV=1 58 530 3.0E-39
sp|P05181|CP2E1_HUMAN Cytochrome P450 2E1 OS=Homo sapiens GN=CYP2E1 PE=1 SV=1 58 530 1.0E-38
sp|O18809|CP2F3_CAPHI Cytochrome P450 2F3 OS=Capra hircus GN=CYP2F3 PE=2 SV=1 54 529 1.0E-38
sp|Q6VVW9|CP2R1_MOUSE Vitamin D 25-hydroxylase OS=Mus musculus GN=Cyp2r1 PE=2 SV=1 53 529 2.0E-38
sp|P05182|CP2E1_RAT Cytochrome P450 2E1 OS=Rattus norvegicus GN=Cyp2e1 PE=1 SV=4 58 530 2.0E-38
sp|P33272|CP2BC_RAT Cytochrome P450 2B12 OS=Rattus norvegicus GN=Cyp2b12 PE=2 SV=1 59 521 2.0E-38
sp|Q9SD85|F3PH_ARATH Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1 29 529 2.0E-38
sp|Q64678|CP1B1_RAT Cytochrome P450 1B1 OS=Rattus norvegicus GN=Cyp1b1 PE=1 SV=1 36 490 5.0E-38
sp|P24461|CP2G1_RABIT Cytochrome P450 2G1 OS=Oryctolagus cuniculus GN=CYP2G1 PE=1 SV=1 53 494 6.0E-38
sp|P56594|CP2CL_CANLF Cytochrome P450 2C21 (Fragment) OS=Canis lupus familiaris GN=CYP2C21 PE=2 SV=2 37 509 7.0E-38
sp|O22203|C98A3_ARATH Cytochrome P450 98A3 OS=Arabidopsis thaliana GN=CYP98A3 PE=1 SV=1 37 529 9.0E-38
sp|P56655|CP238_MOUSE Cytochrome P450 2C38 OS=Mus musculus GN=Cyp2c38 PE=2 SV=2 52 519 1.0E-37
sp|P79383|CP2E1_PIG Cytochrome P450 2E1 OS=Sus scrofa GN=CYP2E1 PE=2 SV=1 58 531 2.0E-37
sp|O55071|CP2BJ_MOUSE Cytochrome P450 2B19 OS=Mus musculus GN=Cyp2b19 PE=2 SV=1 59 518 2.0E-37
sp|Q64429|CP1B1_MOUSE Cytochrome P450 1B1 OS=Mus musculus GN=Cyp1b1 PE=1 SV=3 36 490 3.0E-37
sp|Q7Z449|CP2U1_HUMAN Cytochrome P450 2U1 OS=Homo sapiens GN=CYP2U1 PE=1 SV=1 49 492 5.0E-37
sp|Q01361|CP2DE_BOVIN Cytochrome P450 2D14 OS=Bos taurus GN=CYP2D14 PE=2 SV=2 54 500 9.0E-37
sp|P33267|CP2F2_MOUSE Cytochrome P450 2F2 OS=Mus musculus GN=Cyp2f2 PE=1 SV=1 54 529 1.0E-36
sp|A1DA63|FTME_NEOFI Fumitremorgin C synthase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-2 PE=3 SV=1 69 537 1.0E-36
sp|P11509|CP2A6_HUMAN Cytochrome P450 2A6 OS=Homo sapiens GN=CYP2A6 PE=1 SV=3 34 529 2.0E-36
sp|Q9CA61|C98A8_ARATH Cytochrome P450 98A8 OS=Arabidopsis thaliana GN=CYP98A8 PE=1 SV=1 34 495 2.0E-36
sp|P00178|CP2B4_RABIT Cytochrome P450 2B4 OS=Oryctolagus cuniculus GN=CYP2B4 PE=1 SV=1 54 495 2.0E-36
sp|Q64583|CP2BF_RAT Cytochrome P450 2B15 OS=Rattus norvegicus GN=Cyp2b15 PE=3 SV=2 38 495 2.0E-36
sp|P15123|CP2CG_RABIT Cytochrome P450 2C16 OS=Oryctolagus cuniculus GN=CYP2C16 PE=2 SV=1 55 519 3.0E-36
sp|P15392|CP2A4_MOUSE Cytochrome P450 2A4 OS=Mus musculus GN=Cyp2a4 PE=2 SV=3 34 519 4.0E-36
sp|Q91X77|CY250_MOUSE Cytochrome P450 2C50 OS=Mus musculus GN=Cyp2c50 PE=1 SV=2 33 519 4.0E-36
sp|P08682|CP2E1_RABIT Cytochrome P450 2E1 OS=Oryctolagus cuniculus GN=CYP2E1 PE=2 SV=2 38 530 5.0E-36
sp|Q9CA60|C98A9_ARATH Cytochrome P450 98A9 OS=Arabidopsis thaliana GN=CYP98A9 PE=1 SV=1 35 509 5.0E-36
sp|P56656|CP239_MOUSE Cytochrome P450 2C39 OS=Mus musculus GN=Cyp2c39 PE=1 SV=2 55 529 5.0E-36
sp|O77809|CP1A2_MACFA Cytochrome P450 1A2 OS=Macaca fascicularis GN=CYP1A2 PE=1 SV=3 45 495 5.0E-36
sp|O77810|CP1A2_CALJA Cytochrome P450 1A2 OS=Callithrix jacchus GN=CYP1A2 PE=2 SV=3 60 495 5.0E-36
sp|P11371|CP2C4_RABIT Cytochrome P450 2C4 OS=Oryctolagus cuniculus GN=CYP2C4 PE=2 SV=1 55 519 5.0E-36
sp|Q29510|CP2CU_RABIT Cytochrome P450 2C30 OS=Oryctolagus cuniculus GN=CYP2C30 PE=2 SV=1 55 519 1.0E-35
sp|P12938|CP2D3_RAT Cytochrome P450 2D3 OS=Rattus norvegicus GN=Cyp2d3 PE=2 SV=2 34 500 1.0E-35
sp|O46658|CP2DP_PIG Vitamin D(3) 25-hydroxylase OS=Sus scrofa GN=CYP2D25 PE=1 SV=3 86 500 2.0E-35
sp|P00182|CP2C3_RABIT Cytochrome P450 2C3 OS=Oryctolagus cuniculus GN=CYP2C3 PE=1 SV=2 34 519 2.0E-35
sp|O35293|CP2F2_RAT Cytochrome P450 2F2 OS=Rattus norvegicus GN=Cyp2f2 PE=2 SV=1 55 529 2.0E-35
sp|P20852|CP2A5_MOUSE Cytochrome P450 2A5 OS=Mus musculus GN=Cyp2a5 PE=2 SV=1 34 519 4.0E-35
sp|Q4H4C3|CP1A2_MACFU Cytochrome P450 1A2 OS=Macaca fuscata fuscata GN=CYP1A2 PE=2 SV=3 45 495 6.0E-35
sp|P00179|CP2C5_RABIT Cytochrome P450 2C5 OS=Oryctolagus cuniculus GN=CYP2C5 PE=1 SV=2 55 519 8.0E-35
sp|P11712|CP2C9_HUMAN Cytochrome P450 2C9 OS=Homo sapiens GN=CYP2C9 PE=1 SV=3 55 519 8.0E-35
sp|Q9CX98|CP2U1_MOUSE Cytochrome P450 2U1 OS=Mus musculus GN=Cyp2u1 PE=2 SV=2 49 529 9.0E-35
sp|Q08078|CP2CP_MESAU Cytochrome P450 2C25 OS=Mesocricetus auratus GN=CYP2C25 PE=2 SV=1 39 519 1.0E-34
sp|Q16696|CP2AD_HUMAN Cytochrome P450 2A13 OS=Homo sapiens GN=CYP2A13 PE=1 SV=3 46 529 1.0E-34
sp|P05177|CP1A2_HUMAN Cytochrome P450 1A2 OS=Homo sapiens GN=CYP1A2 PE=1 SV=3 206 495 1.0E-34
sp|Q9LHA1|C8D11_ARATH Cytochrome P450 81D11 OS=Arabidopsis thaliana GN=CYP81D11 PE=2 SV=1 56 492 1.0E-34
sp|Q4V8D1|CP2U1_RAT Cytochrome P450 2U1 OS=Rattus norvegicus GN=Cyp2u1 PE=1 SV=1 49 529 1.0E-34
sp|Q91W64|CP270_MOUSE Cytochrome P450 2C70 OS=Mus musculus GN=Cyp2c70 PE=1 SV=2 54 516 2.0E-34
sp|P24453|CP1A2_MESAU Cytochrome P450 1A2 OS=Mesocricetus auratus GN=CYP1A2 PE=1 SV=4 60 495 2.0E-34
sp|Q5KQT6|CP1A2_FELCA Cytochrome P450 1A2 OS=Felis catus GN=CYP1A2 PE=2 SV=1 33 499 2.0E-34
sp|Q05555|CP2AA_RABIT Cytochrome P450 2A10 OS=Oryctolagus cuniculus GN=CYP2A10 PE=1 SV=1 58 529 2.0E-34
sp|P10610|CP2G1_RAT Cytochrome P450 2G1 OS=Rattus norvegicus GN=Cyp2g1 PE=2 SV=1 53 518 3.0E-34
sp|Q6R7M4|C15A1_DIPPU Methyl farnesoate epoxidase OS=Diploptera punctata GN=CYP15A1 PE=1 SV=1 38 509 3.0E-34
sp|Q6WNQ8|C81E8_MEDTR Cytochrome P450 81E8 OS=Medicago truncatula GN=CYP81E8 PE=2 SV=1 28 480 3.0E-34
sp|Q29473|CP2DF_CANLF Cytochrome P450 2D15 OS=Canis lupus familiaris GN=CYP2D15 PE=1 SV=3 30 529 3.0E-34
sp|P19225|CP270_RAT Cytochrome P450 2C70 OS=Rattus norvegicus GN=Cyp2c70 PE=2 SV=1 38 516 4.0E-34
sp|P48418|C75A1_PETHY Flavonoid 3',5'-hydroxylase 1 OS=Petunia hybrida GN=CYP75A1 PE=2 SV=1 37 529 4.0E-34
sp|P24454|CP2A8_MESAU Cytochrome P450 2A8 OS=Mesocricetus auratus GN=CYP2A8 PE=1 SV=1 34 510 5.0E-34
sp|P49264|C71B1_THLAR Cytochrome P450 71B1 OS=Thlaspi arvense GN=CYP71B1 PE=2 SV=1 37 520 6.0E-34
sp|Q05421|CP2E1_MOUSE Cytochrome P450 2E1 OS=Mus musculus GN=Cyp2e1 PE=1 SV=1 325 530 6.0E-34
sp|P56593|CP2AC_MOUSE Cytochrome P450 2A12 OS=Mus musculus GN=Cyp2a12 PE=1 SV=2 54 492 7.0E-34
sp|Q92116|CP1A1_STECH Cytochrome P450 1A1 OS=Stenotomus chrysops GN=cyp1a1 PE=2 SV=1 61 532 7.0E-34
sp|P56592|CP1A2_CANLF Cytochrome P450 1A2 OS=Canis lupus familiaris GN=CYP1A2 PE=1 SV=2 45 499 9.0E-34
sp|P48419|C75A3_PETHY Flavonoid 3',5'-hydroxylase 2 OS=Petunia hybrida GN=CYP75A3 PE=2 SV=1 52 529 1.0E-33
sp|P33262|CP2CK_MACFA Cytochrome P450 2C20 OS=Macaca fascicularis GN=CYP2C20 PE=2 SV=1 37 494 1.0E-33
sp|P00185|CP1A1_RAT Cytochrome P450 1A1 OS=Rattus norvegicus GN=Cyp1a1 PE=1 SV=1 28 513 1.0E-33
sp|P33261|CP2CJ_HUMAN Cytochrome P450 2C19 OS=Homo sapiens GN=CYP2C19 PE=1 SV=3 55 519 1.0E-33
sp|Q078T0|PHACB_EMEND 3-hydroxyphenylacetate 6-hydroxylase OS=Emericella nidulans GN=phacB PE=1 SV=1 62 494 2.0E-33
sp|P20812|CP2A3_RAT Cytochrome P450 2A3 OS=Rattus norvegicus GN=Cyp2a3 PE=2 SV=1 34 519 2.0E-33
sp|Q64391|CP1A2_CAVPO Cytochrome P450 1A2 OS=Cavia porcellus GN=CYP1A2 PE=2 SV=1 60 495 2.0E-33
sp|P00187|CP1A2_RABIT Cytochrome P450 1A2 OS=Oryctolagus cuniculus GN=CYP1A2 PE=1 SV=3 35 509 2.0E-33
sp|P24903|CP2F1_HUMAN Cytochrome P450 2F1 OS=Homo sapiens GN=CYP2F1 PE=1 SV=2 54 529 2.0E-33
sp|P37120|C75A2_SOLME Flavonoid 3',5'-hydroxylase OS=Solanum melongena GN=CYP75A2 PE=2 SV=1 47 529 2.0E-33
sp|Q0IIF9|CP2U1_BOVIN Cytochrome P450 2U1 OS=Bos taurus GN=CYP2U1 PE=2 SV=1 49 529 2.0E-33
sp|Q9ZU07|C71BC_ARATH Cytochrome P450 71B12 OS=Arabidopsis thaliana GN=CYP71B12 PE=2 SV=1 37 528 2.0E-33
sp|P00184|CP1A1_MOUSE Cytochrome P450 1A1 OS=Mus musculus GN=Cyp1a1 PE=1 SV=2 34 513 2.0E-33
sp|P48421|C83A1_ARATH Cytochrome P450 83A1 OS=Arabidopsis thaliana GN=CYP83A1 PE=1 SV=2 38 515 2.0E-33
sp|P04799|CP1A2_RAT Cytochrome P450 1A2 OS=Rattus norvegicus GN=Cyp1a2 PE=1 SV=2 60 485 3.0E-33
sp|P20814|CP2CD_RAT Cytochrome P450 2C13, male-specific OS=Rattus norvegicus GN=Cyp2c13 PE=1 SV=1 55 498 3.0E-33
sp|P00186|CP1A2_MOUSE Cytochrome P450 1A2 OS=Mus musculus GN=Cyp1a2 PE=1 SV=1 60 489 4.0E-33
sp|Q8VWZ7|C76B6_CATRO Geraniol 8-hydroxylase OS=Catharanthus roseus GN=CYP76B6 PE=1 SV=1 31 508 7.0E-33
sp|O73853|CP17A_ICTPU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ictalurus punctatus GN=cyp17a1 PE=2 SV=1 37 542 8.0E-33
sp|P08683|CP2CB_RAT Cytochrome P450 2C11 OS=Rattus norvegicus GN=Cyp2c11 PE=1 SV=1 55 511 8.0E-33
sp|P20853|CP2A7_HUMAN Cytochrome P450 2A7 OS=Homo sapiens GN=CYP2A7 PE=2 SV=2 46 529 1.0E-32
sp|Q92109|CP1A3_ONCMY Cytochrome P450 1A3 OS=Oncorhynchus mykiss GN=cyp1a3 PE=2 SV=2 35 513 1.0E-32
sp|Q6VVX0|CP2R1_HUMAN Vitamin D 25-hydroxylase OS=Homo sapiens GN=CYP2R1 PE=1 SV=1 71 529 1.0E-32
sp|O42231|CP1A1_LIZAU Cytochrome P450 1A1 OS=Liza aurata GN=cyp1a1 PE=2 SV=1 61 531 1.0E-32
sp|Q9MZY0|CP2E1_CANLF Cytochrome P450 2E1 OS=Canis lupus familiaris GN=CYP2E1 PE=2 SV=1 325 530 1.0E-32
sp|P58049|C71BB_ARATH Cytochrome P450 71B11 OS=Arabidopsis thaliana GN=CYP71B11 PE=2 SV=1 37 528 2.0E-32
sp|P33266|CP2E1_MACFA Cytochrome P450 2E1 (Fragment) OS=Macaca fascicularis GN=CYP2E1 PE=2 SV=1 325 530 2.0E-32
sp|P10632|CP2C8_HUMAN Cytochrome P450 2C8 OS=Homo sapiens GN=CYP2C8 PE=1 SV=2 37 494 2.0E-32
sp|P00181|CP2C2_RABIT Cytochrome P450 2C2 OS=Oryctolagus cuniculus GN=CYP2C2 PE=1 SV=2 55 492 2.0E-32
sp|Q3LFT9|CP1A2_BALAC Cytochrome P450 1A2 OS=Balaenoptera acutorostrata GN=CYP1A2 PE=2 SV=3 60 524 3.0E-32
sp|P12790|CP2B9_MOUSE Cytochrome P450 2B9 OS=Mus musculus GN=Cyp2b9 PE=1 SV=2 71 495 3.0E-32
sp|P56657|CP240_MOUSE Cytochrome P450 2C40 OS=Mus musculus GN=Cyp2c40 PE=1 SV=2 37 510 3.0E-32
sp|Q05556|CP2AB_RABIT Cytochrome P450 2A11 OS=Oryctolagus cuniculus GN=CYP2A11 PE=1 SV=1 58 529 3.0E-32
sp|Q16678|CP1B1_HUMAN Cytochrome P450 1B1 OS=Homo sapiens GN=CYP1B1 PE=1 SV=2 58 490 4.0E-32
sp|P27786|CP17A_MOUSE Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mus musculus GN=Cyp17a1 PE=1 SV=1 66 497 4.0E-32
sp|P33263|CP2CQ_MESAU Cytochrome P450 2C26 OS=Mesocricetus auratus GN=CYP2C26 PE=2 SV=1 37 519 4.0E-32
sp|Q29488|CP2DH_MACFA Cytochrome P450 2D17 OS=Macaca fascicularis GN=CYP2D17 PE=2 SV=1 93 529 5.0E-32
sp|Q5RBQ1|CP1A2_PONAB Cytochrome P450 1A2 OS=Pongo abelii GN=CYP1A2 PE=2 SV=3 222 495 5.0E-32
sp|H2DH18|C7A12_PANGI Cytochrome P450 CYP736A12 OS=Panax ginseng PE=2 SV=1 59 513 7.0E-32
sp|P11711|CP2A1_RAT Cytochrome P450 2A1 OS=Rattus norvegicus GN=Cyp2a1 PE=1 SV=2 34 492 9.0E-32
sp|P13108|CP2D4_RAT Cytochrome P450 2D4 OS=Rattus norvegicus GN=Cyp2d4 PE=2 SV=2 35 529 9.0E-32
sp|Q9W683|CP1A1_LIZSA Cytochrome P450 1A1 OS=Liza saliens GN=cyp1a1 PE=2 SV=1 61 513 1.0E-31
sp|P24455|CP2A9_MESAU Cytochrome P450 2A9 OS=Mesocricetus auratus GN=CYP2A9 PE=2 SV=2 34 494 2.0E-31
sp|Q92113|CP17A_SQUAC Steroid 17-alpha-hydroxylase/17,20 lyase OS=Squalus acanthias GN=CYP17A1 PE=2 SV=1 42 513 2.0E-31
sp|O42430|CP1A1_LIMLI Cytochrome P450 1A1 OS=Limanda limanda GN=cyp1a1 PE=2 SV=1 61 531 2.0E-31
sp|P00180|CP2C1_RABIT Cytochrome P450 2C1 OS=Oryctolagus cuniculus GN=CYP2C1 PE=1 SV=2 55 492 2.0E-31
sp|P00176|CP2B1_RAT Cytochrome P450 2B1 OS=Rattus norvegicus GN=Cyp2b1 PE=1 SV=1 333 499 2.0E-31
sp|O42457|CP1A1_SPAAU Cytochrome P450 1A1 OS=Sparus aurata GN=cyp1a1 PE=2 SV=1 61 513 2.0E-31
sp|Q9SBQ9|F3PH_PETHY Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1 37 529 2.0E-31
sp|O62671|CP241_CANLF Cytochrome P450 2C41 OS=Canis lupus familiaris GN=CYP2C41 PE=2 SV=1 53 509 2.0E-31
sp|P33260|CP2CI_HUMAN Cytochrome P450 2C18 OS=Homo sapiens GN=CYP2C18 PE=1 SV=3 55 509 2.0E-31
sp|O64636|C76C1_ARATH Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 27 507 3.0E-31
sp|P11715|CP17A_RAT Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rattus norvegicus GN=Cyp17a1 PE=1 SV=2 59 497 3.0E-31
sp|P20813|CP2B6_HUMAN Cytochrome P450 2B6 OS=Homo sapiens GN=CYP2B6 PE=1 SV=1 71 510 3.0E-31
sp|Q8WNE1|CP2F5_GORGO Cytochrome P450 2F5 OS=Gorilla gorilla gorilla GN=CYP2F5 PE=3 SV=2 93 529 3.0E-31
sp|P56590|CP1A1_CANLF Cytochrome P450 1A1 OS=Canis lupus familiaris GN=CYP1A1 PE=2 SV=1 45 509 4.0E-31
sp|Q6XVG2|CP254_MOUSE Cytochrome P450 2C54 OS=Mus musculus GN=Cyp2c54 PE=1 SV=1 34 519 5.0E-31
sp|Q92100|CP1A1_PLEPL Cytochrome P450 1A1 OS=Pleuronectes platessa GN=cyp1a1 PE=2 SV=1 61 531 5.0E-31
sp|Q64680|CP2DI_RAT Cytochrome P450 2D18 OS=Rattus norvegicus GN=Cyp2d18 PE=2 SV=1 35 529 5.0E-31
sp|Q92110|CP1A1_ONCMY Cytochrome P450 1A1 OS=Oncorhynchus mykiss GN=cyp1a1 PE=2 SV=2 61 513 6.0E-31
sp|Q9YH64|CP1A1_PLAFE Cytochrome P450 1A1 OS=Platichthys flesus GN=cyp1a1 PE=3 SV=1 61 531 7.0E-31
sp|Q00557|CP1A1_MESAU Cytochrome P450 1A1 OS=Mesocricetus auratus GN=CYP1A1 PE=2 SV=2 34 509 8.0E-31
sp|Q9ZNR0|C78A6_ARATH Cytochrome P450 78A6 OS=Arabidopsis thaliana GN=CYP78A6 PE=2 SV=1 61 529 1.0E-30
sp|Q06367|CP1A1_CAVPO Cytochrome P450 1A1 OS=Cavia porcellus GN=CYP1A1 PE=1 SV=1 45 499 1.0E-30
sp|Q8CIM7|CP2DQ_MOUSE Cytochrome P450 2D26 OS=Mus musculus GN=Cyp2d26 PE=1 SV=1 37 504 2.0E-30
sp|P11510|CP2CC_RAT Cytochrome P450 2C12, female-specific OS=Rattus norvegicus GN=Cyp2c12 PE=2 SV=1 55 516 2.0E-30
sp|O65790|C81F1_ARATH Cytochrome P450 81F1 OS=Arabidopsis thaliana GN=CYP81F1 PE=2 SV=2 37 537 2.0E-30
sp|Q6JZS3|CP1A1_ORYLA Cytochrome P450 1A1 OS=Oryzias latipes GN=cyp1a1 PE=3 SV=1 61 513 2.0E-30
sp|Q91Z85|CP17A_PERLE Steroid 17-alpha-hydroxylase/17,20 lyase OS=Peromyscus leucopus GN=Cyp17a1 PE=3 SV=1 66 505 3.0E-30
sp|P58050|C71BD_ARATH Cytochrome P450 71B13 OS=Arabidopsis thaliana GN=CYP71B13 PE=2 SV=1 40 528 4.0E-30
sp|P30437|CP17A_ONCMY Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oncorhynchus mykiss GN=cyp17a1 PE=2 SV=1 53 530 4.0E-30
sp|P56591|CP1A1_SHEEP Cytochrome P450 1A1 OS=Ovis aries GN=CYP1A1 PE=2 SV=1 192 505 5.0E-30
sp|Q9QYG6|CP2DR_MESAU Cytochrome P450 2D27 OS=Mesocricetus auratus GN=CYP2D27 PE=1 SV=1 88 500 7.0E-30
sp|S4UX02|CYPH1_SALMI Ferruginol synthase OS=Salvia miltiorrhiza GN=CYP76AH1 PE=1 SV=1 37 493 7.0E-30
sp|Q9FLC8|C79A2_ARATH Phenylalanine N-monooxygenase OS=Arabidopsis thaliana GN=CYP79A2 PE=1 SV=1 58 533 8.0E-30
sp|P79716|CP1A1_DICLA Cytochrome P450 1A1 OS=Dicentrarchus labrax GN=cyp1a1 PE=2 SV=1 61 513 9.0E-30
sp|Q9SXS3|C93C2_GLYEC 2-hydroxyisoflavanone synthase OS=Glycyrrhiza echinata GN=CYP93C2 PE=1 SV=1 60 512 9.0E-30
sp|P12791|CP2BA_MOUSE Cytochrome P450 2B10 OS=Mus musculus GN=Cyp2b10 PE=1 SV=1 192 495 9.0E-30
sp|P04167|CP2B2_RAT Cytochrome P450 2B2 OS=Rattus norvegicus GN=Cyp2b2 PE=1 SV=2 333 499 1.0E-29
sp|H2DH20|C7D13_PANGI Cytochrome P450 CYP71D313 OS=Panax ginseng PE=2 SV=1 33 509 1.0E-29
sp|P70085|CP17A_ORYLA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oryzias latipes GN=cyp17a1 PE=2 SV=1 51 495 2.0E-29
sp|P24456|CP2DA_MOUSE Cytochrome P450 2D10 OS=Mus musculus GN=Cyp2d10 PE=1 SV=2 34 504 2.0E-29
sp|P11714|CP2D9_MOUSE Cytochrome P450 2D9 OS=Mus musculus GN=Cyp2d9 PE=1 SV=2 34 504 2.0E-29
sp|Q8HYM9|CP17A_MACMU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca mulatta GN=CYP17A1 PE=2 SV=1 60 503 2.0E-29
sp|Q2XVA1|CP17A_MACFA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca fascicularis GN=CYP17A1 PE=2 SV=1 60 503 2.0E-29
sp|G4XV71|C93C2_GLYUR 2-hydroxyisoflavanone synthase OS=Glycyrrhiza uralensis GN=CYP93C2 PE=2 SV=2 34 512 2.0E-29
sp|Q8HYN0|CP17A_PAPCY Steroid 17-alpha-hydroxylase/17,20 lyase OS=Papio cynocephalus GN=CYP17A1 PE=2 SV=1 60 503 2.0E-29
sp|Q6GUR1|CP1A1_MACMU Cytochrome P450 1A1 OS=Macaca mulatta GN=CYP1A1 PE=2 SV=1 43 489 3.0E-29
sp|P04798|CP1A1_HUMAN Cytochrome P450 1A1 OS=Homo sapiens GN=CYP1A1 PE=1 SV=1 45 499 3.0E-29
sp|P33616|CP1A1_MACFA Cytochrome P450 1A1 OS=Macaca fascicularis GN=CYP1A1 PE=2 SV=1 43 489 3.0E-29
sp|P98181|CP1A1_PAGMA Cytochrome P450 1A1 OS=Pagrus major GN=cyp1a1 PE=2 SV=1 34 513 3.0E-29
sp|Q9QYG5|CP2DK_MESAU Cytochrome P450 2D20 OS=Mesocricetus auratus GN=CYP2D20 PE=2 SV=1 88 500 3.0E-29
sp|O65012|C78A4_PINRA Cytochrome P450 78A4 OS=Pinus radiata GN=CYP78A4 PE=2 SV=1 22 525 4.0E-29
sp|O65786|C71B4_ARATH Cytochrome P450 71B4 OS=Arabidopsis thaliana GN=CYP71B4 PE=2 SV=2 53 528 4.0E-29
sp|P58051|C71BE_ARATH Cytochrome P450 71B14 OS=Arabidopsis thaliana GN=CYP71B14 PE=2 SV=1 39 528 4.0E-29
sp|P93147|C81E1_GLYEC Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2 41 493 4.0E-29
sp|P10635|CP2D6_HUMAN Cytochrome P450 2D6 OS=Homo sapiens GN=CYP2D6 PE=1 SV=2 93 529 4.0E-29
sp|Q92095|CP1A1_OPSTA Cytochrome P450 1A1 OS=Opsanus tau GN=cyp1a1 PE=2 SV=1 61 513 5.0E-29
sp|Q5KQT7|CP1A1_FELCA Cytochrome P450 1A1 OS=Felis catus GN=CYP1A1 PE=2 SV=1 45 505 5.0E-29
sp|C0SPF7|C15C1_BOMMO Farnesoate epoxidase OS=Bombyx mori GN=CYP15C1 PE=1 SV=2 37 494 6.0E-29
sp|Q42798|C93A1_SOYBN 3,9-dihydroxypterocarpan 6A-monooxygenase OS=Glycine max GN=CYP93A1 PE=1 SV=1 36 529 6.0E-29
sp|Q9QUJ1|CP2DS_MESAU Cytochrome P450 2D28 OS=Mesocricetus auratus GN=CYP2D28A PE=2 SV=1 88 529 6.0E-29
sp|P17666|CP2CE_RABIT Cytochrome P450 2C14 OS=Oryctolagus cuniculus GN=CYP2C14 PE=2 SV=1 55 509 7.0E-29
sp|Q2XNC8|CP2D6_PANTR Cytochrome P450 2D6 OS=Pan troglodytes GN=CYP2D6 PE=3 SV=1 93 529 7.0E-29
sp|Q92039|CP1A1_CHACA Cytochrome P450 1A1 OS=Chaetodon capistratus GN=cyp1a1 PE=2 SV=1 61 532 7.0E-29
sp|O23976|C76B1_HELTU 7-ethoxycoumarin O-deethylase OS=Helianthus tuberosus GN=CYP76B1 PE=1 SV=1 35 526 8.0E-29
sp|Q2XNC9|CP2D6_PANPA Cytochrome P450 2D6 OS=Pan paniscus GN=CYP2D6 PE=3 SV=1 93 529 8.0E-29
sp|O54750|CP2J6_MOUSE Cytochrome P450 2J6 OS=Mus musculus GN=Cyp2j6 PE=2 SV=2 35 504 1.0E-28
sp|Q27712|CP2L1_PANAR Cytochrome P450 2L1 OS=Panulirus argus GN=CYP2L1 PE=1 SV=1 56 530 1.0E-28
sp|Q92090|CP2K1_ONCMY Cytochrome P450 2K1 OS=Oncorhynchus mykiss GN=cyp2k1 PE=2 SV=1 325 521 1.0E-28
sp|P05176|CP1A1_RABIT Cytochrome P450 1A1 OS=Oryctolagus cuniculus GN=CYP1A1 PE=2 SV=1 45 509 1.0E-28
sp|Q95078|CP18A_DROME Cytochrome P450 18a1 OS=Drosophila melanogaster GN=Cyp18a1 PE=2 SV=2 58 505 2.0E-28
sp|Q6WNR0|C81E7_MEDTR Isoflavone 2'-hydroxylase OS=Medicago truncatula GN=CYP81E7 PE=1 SV=1 38 493 2.0E-28
sp|Q9GLD2|CP17A_PAPHU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Papio hamadryas ursinus GN=CYP17A1 PE=1 SV=1 60 503 2.0E-28
sp|P51590|CP2J3_RAT Cytochrome P450 2J3 OS=Rattus norvegicus GN=Cyp2j3 PE=2 SV=1 38 494 2.0E-28
sp|Q9LTM6|C71BH_ARATH Cytochrome P450 71B17 OS=Arabidopsis thaliana GN=CYP71B17 PE=3 SV=1 35 480 2.0E-28
sp|O64635|C76C4_ARATH Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=3 SV=1 40 507 2.0E-28
sp|P58048|C71B8_ARATH Cytochrome P450 71B8 OS=Arabidopsis thaliana GN=CYP71B8 PE=3 SV=1 56 528 3.0E-28
sp|Q9LTL2|C71BP_ARATH Cytochrome P450 71B25 OS=Arabidopsis thaliana GN=CYP71B25 PE=2 SV=1 53 493 3.0E-28
sp|Q8HYN1|CP17A_PANTR Steroid 17-alpha-hydroxylase/17,20 lyase OS=Pan troglodytes GN=CYP17A1 PE=2 SV=1 60 503 3.0E-28
sp|O57525|CP17A_RANDY Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rana dybowskii GN=CYP17A1 PE=2 SV=1 66 529 4.0E-28
sp|Q556M5|C5081_DICDI Probable cytochrome P450 508A1 OS=Dictyostelium discoideum GN=cyp508A1-1 PE=3 SV=1 62 520 4.0E-28
sp|O81970|C71A9_SOYBN Cytochrome P450 71A9 OS=Glycine max GN=CYP71A9 PE=2 SV=1 59 508 5.0E-28
sp|P12394|CP17A_CHICK Steroid 17-alpha-hydroxylase/17,20 lyase OS=Gallus gallus GN=CYP17A1 PE=2 SV=1 55 494 6.0E-28
sp|Q501D8|C79B3_ARATH Tryptophan N-monooxygenase 2 OS=Arabidopsis thaliana GN=CYP79B3 PE=1 SV=1 1 493 6.0E-28
sp|P24470|CP2CN_RAT Cytochrome P450 2C23 OS=Rattus norvegicus GN=Cyp2c23 PE=2 SV=2 27 529 6.0E-28
sp|P05093|CP17A_HUMAN Steroid 17-alpha-hydroxylase/17,20 lyase OS=Homo sapiens GN=CYP17A1 PE=1 SV=1 60 503 6.0E-28
sp|O04790|C75A7_EUSER Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A7 PE=2 SV=1 34 477 7.0E-28
sp|P24457|CP2DB_MOUSE Cytochrome P450 2D11 OS=Mus musculus GN=Cyp2d11 PE=2 SV=2 34 504 8.0E-28
sp|P15149|CP2A2_RAT Cytochrome P450 2A2 OS=Rattus norvegicus GN=Cyp2a2 PE=1 SV=1 34 492 8.0E-28
sp|P12789|CP2B5_RABIT Cytochrome P450 2B5 OS=Oryctolagus cuniculus GN=CYP2B5 PE=2 SV=1 71 495 9.0E-28
sp|O81974|C71D8_SOYBN Cytochrome P450 71D8 OS=Glycine max GN=CYP71D8 PE=2 SV=1 34 493 1.0E-27
sp|P93149|C93B1_GLYEC Licodione synthase OS=Glycyrrhiza echinata GN=CYP93B1 PE=1 SV=2 37 494 1.0E-27
sp|O48958|C71E1_SORBI 4-hydroxyphenylacetaldehyde oxime monooxygenase OS=Sorghum bicolor GN=CYP71E1 PE=2 SV=1 55 533 1.0E-27
sp|C0SJS4|C71AJ_APIGR Psoralen synthase (Fragment) OS=Apium graveolens GN=CYP71AJ2 PE=1 SV=1 58 507 1.0E-27
sp|Q92148|CP1A1_MICTO Cytochrome P450 1A1 OS=Microgadus tomcod GN=cyp1a1 PE=2 SV=1 61 513 1.0E-27
sp|P79402|CP242_PIG Cytochrome P450 2C42 (Fragment) OS=Sus scrofa GN=CYP2C42 PE=2 SV=1 332 519 2.0E-27
sp|P33273|CP255_RAT Cytochrome P450 2C55 OS=Rattus norvegicus GN=Cyp2c55 PE=2 SV=2 55 509 2.0E-27
sp|Q3LFU0|CP1A1_BALAC Cytochrome P450 1A1 OS=Balaenoptera acutorostrata GN=CYP1A1 PE=2 SV=1 45 505 2.0E-27
sp|O65788|C71B2_ARATH Cytochrome P450 71B2 OS=Arabidopsis thaliana GN=CYP71B2 PE=2 SV=2 34 528 2.0E-27
sp|Q9VG17|CP304_DROME Probable cytochrome P450 304a1 OS=Drosophila melanogaster GN=Cyp304a1 PE=2 SV=2 37 494 2.0E-27
sp|P10634|CP2DQ_RAT Cytochrome P450 2D26 OS=Rattus norvegicus GN=Cyp2d26 PE=1 SV=2 88 499 3.0E-27
sp|P12939|CP2DA_RAT Cytochrome P450 2D10 OS=Rattus norvegicus GN=Cyp2d10 PE=1 SV=1 34 500 4.0E-27
sp|Q8TAV3|CP2W1_HUMAN Cytochrome P450 2W1 OS=Homo sapiens GN=CYP2W1 PE=1 SV=2 60 529 5.0E-27
sp|Q96581|C75A4_GENTR Flavonoid 3',5'-hydroxylase OS=Gentiana triflora GN=CYP75A4 PE=2 SV=1 42 533 7.0E-27
sp|Q9LTM7|C71BG_ARATH Cytochrome P450 71B16 OS=Arabidopsis thaliana GN=CYP71B16 PE=3 SV=1 35 528 8.0E-27
sp|P13107|CP2B3_RAT Cytochrome P450 2B3 OS=Rattus norvegicus GN=Cyp2b3 PE=2 SV=1 337 510 8.0E-27
sp|P05178|CP2C6_RAT Cytochrome P450 2C6 OS=Rattus norvegicus GN=Cyp2c6 PE=2 SV=2 91 519 9.0E-27
sp|H2KYS3|DAF9_CAEEL Cytochrome P450 daf-9 OS=Caenorhabditis elegans GN=daf-9 PE=1 SV=1 60 527 9.0E-27
sp|O18992|CP2DJ_CALJA Cytochrome P450 2D19 OS=Callithrix jacchus GN=CYP2D19 PE=2 SV=1 93 529 1.0E-26
sp|A6YIH8|C7D55_HYOMU Premnaspirodiene oxygenase OS=Hyoscyamus muticus GN=CYP71D55 PE=1 SV=1 59 507 1.0E-26
sp|Q6YV88|C71Z7_ORYSJ Ent-cassadiene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z7 PE=1 SV=1 35 508 1.0E-26
sp|Q64403|CP2DG_CAVPO Cytochrome P450 2D16 OS=Cavia porcellus GN=CYP2D16 PE=1 SV=1 87 504 2.0E-26
sp|Q9DBX6|CP2S1_MOUSE Cytochrome P450 2S1 OS=Mus musculus GN=Cyp2s1 PE=1 SV=1 82 494 2.0E-26
sp|Q9D816|CP255_MOUSE Cytochrome P450 2C55 OS=Mus musculus GN=Cyp2c55 PE=1 SV=1 55 509 2.0E-26
sp|O64899|C80B1_ESCCA (S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (Fragment) OS=Eschscholzia californica GN=CYP80B1 PE=2 SV=1 52 530 2.0E-26
sp|O04773|C75A6_CAMME Flavonoid 3',5'-hydroxylase OS=Campanula medium GN=CYP75A6 PE=2 SV=1 36 529 2.0E-26
sp|P37123|C77A1_SOLME Cytochrome P450 77A1 (Fragment) OS=Solanum melongena GN=CYP77A1 PE=2 SV=1 57 492 2.0E-26
sp|Q96514|C71B7_ARATH Cytochrome P450 71B7 OS=Arabidopsis thaliana GN=CYP71B7 PE=1 SV=1 34 508 3.0E-26
sp|G3GBK0|C7BL3_CICIN Costunolide synthase OS=Cichorium intybus GN=CYP71BL3 PE=1 SV=1 35 507 3.0E-26
sp|Q9LTM0|C71BN_ARATH Cytochrome P450 71B23 OS=Arabidopsis thaliana GN=CYP71B23 PE=2 SV=1 68 510 3.0E-26
sp|Q6XQ14|C71E7_MANES 2-methylbutanal oxime monooxygenase OS=Manihot esculenta GN=CYP71E7 PE=1 SV=1 58 489 3.0E-26
sp|P70687|CP17A_MESAU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mesocricetus auratus GN=CYP17A1 PE=2 SV=1 51 526 3.0E-26
sp|Q96418|C75A5_EUSER Flavonoid 3',5'-hydroxylase OS=Eustoma exaltatum subsp. russellianum GN=CYP75A5 PE=2 SV=1 59 477 3.0E-26
sp|O65782|C83B1_ARATH Cytochrome P450 83B1 OS=Arabidopsis thaliana GN=CYP83B1 PE=1 SV=1 38 520 4.0E-26
sp|Q29478|CP2CV_CAPHE Cytochrome P450 2C31 (Fragment) OS=Capra hircus aegagrus GN=CYP2C31 PE=2 SV=1 251 519 4.0E-26
sp|P33264|CP2CR_MESAU Cytochrome P450 2C27 OS=Mesocricetus auratus GN=CYP2C27 PE=2 SV=1 91 516 4.0E-26
sp|Q9XHE6|C71DF_MENPI Cytochrome P450 71D15 OS=Mentha piperita GN=CYP71D15 PE=1 SV=1 34 507 6.0E-26
sp|P52786|CP2J1_RABIT Cytochrome P450 2J1 OS=Oryctolagus cuniculus GN=CYP2J1 PE=1 SV=2 41 495 7.0E-26
sp|P51589|CP2J2_HUMAN Cytochrome P450 2J2 OS=Homo sapiens GN=CYP2J2 PE=1 SV=2 41 494 7.0E-26
sp|Q9N0U7|CP17A_CAPHI Steroid 17-alpha-hydroxylase/17,20 lyase OS=Capra hircus GN=CYP17A1 PE=2 SV=1 41 539 8.0E-26
sp|P00191|CP21A_BOVIN Steroid 21-hydroxylase OS=Bos taurus GN=CYP21 PE=1 SV=2 85 494 8.0E-26
sp|O54749|CP2J5_MOUSE Cytochrome P450 2J5 OS=Mus musculus GN=Cyp2j5 PE=1 SV=1 37 494 8.0E-26
sp|Q9FG65|C81D1_ARATH Cytochrome P450 81D1 OS=Arabidopsis thaliana GN=CYP81D1 PE=2 SV=1 27 492 8.0E-26
sp|Q42797|TCMO_SOYBN Trans-cinnamate 4-monooxygenase OS=Glycine max GN=CYP73A11 PE=2 SV=1 35 494 8.0E-26
sp|O81346|C79B2_ARATH Tryptophan N-monooxygenase 1 OS=Arabidopsis thaliana GN=CYP79B2 PE=1 SV=2 1 493 8.0E-26
sp|Q96SQ9|CP2S1_HUMAN Cytochrome P450 2S1 OS=Homo sapiens GN=CYP2S1 PE=1 SV=2 337 528 2.0E-25
sp|Q9SCN2|C71BU_ARATH Cytochrome P450 71B31 OS=Arabidopsis thaliana GN=CYP71B31 PE=2 SV=1 56 528 2.0E-25
sp|O64900|C80B2_ESCCA (S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 OS=Eschscholzia californica GN=CYP80B2 PE=2 SV=1 35 530 2.0E-25
sp|Q9LW27|C71BF_ARATH Bifunctional dihydrocamalexate synthase/camalexin synthase OS=Arabidopsis thaliana GN=CYP71B15 PE=1 SV=1 37 493 2.0E-25
sp|P93531|C71D7_SOLCH Cytochrome P450 71D7 OS=Solanum chacoense GN=CYP71D7 PE=3 SV=1 50 507 2.0E-25
sp|Q50EK4|C75A1_PINTA Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1 59 529 3.0E-25
sp|Q9SAE3|C71BS_ARATH Cytochrome P450 71B28 OS=Arabidopsis thaliana GN=CYP71B28 PE=2 SV=1 56 493 3.0E-25
sp|Q96423|TCMO_GLYEC Trans-cinnamate 4-monooxygenase OS=Glycyrrhiza echinata GN=CYP73A14 PE=2 SV=1 52 494 3.0E-25
sp|Q9LTM4|C71BJ_ARATH Cytochrome P450 71B19 OS=Arabidopsis thaliana GN=CYP71B19 PE=2 SV=1 35 528 5.0E-25
sp|Q54SK0|C508B_DICDI Probable cytochrome P450 508B1 OS=Dictyostelium discoideum GN=cyp508B1 PE=3 SV=1 62 530 5.0E-25
sp|C0SJS2|C71AJ_PASSA Psoralen synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ3 PE=1 SV=1 40 515 5.0E-25
sp|Q42799|C93A2_SOYBN Cytochrome P450 93A2 OS=Glycine max GN=CYP93A2 PE=2 SV=1 36 529 5.0E-25
sp|P10633|CP2D1_RAT Cytochrome P450 2D1 OS=Rattus norvegicus GN=Cyp2d1 PE=2 SV=1 34 500 6.0E-25
sp|E9Q816|CP2W1_MOUSE Cytochrome P450 2W1 OS=Mus musculus GN=Cyp2w1 PE=2 SV=1 57 530 7.0E-25
sp|F8S1H3|C7BL1_HELAN Cytochrome P450 71BL1 OS=Helianthus annuus GN=CYP71BL1 PE=2 SV=1 34 489 7.0E-25
sp|Q64410|CP17A_CAVPO Steroid 17-alpha-hydroxylase/17,20 lyase OS=Cavia porcellus GN=CYP17A1 PE=1 SV=1 40 528 7.0E-25
sp|P05185|CP17A_BOVIN Steroid 17-alpha-hydroxylase/17,20 lyase OS=Bos taurus GN=CYP17A1 PE=2 SV=1 66 539 8.0E-25
sp|H2DH22|C7A10_PANGI Cytochrome P450 CYP73A100 OS=Panax ginseng PE=2 SV=1 30 510 8.0E-25
sp|O81345|C79B1_SINAL Cytochrome P450 79B1 OS=Sinapis alba GN=CYP79B1 PE=2 SV=1 1 492 8.0E-25
sp|P48522|TCMO_CATRO Trans-cinnamate 4-monooxygenase OS=Catharanthus roseus GN=CYP73A4 PE=2 SV=1 44 494 8.0E-25
sp|I3V6B1|C80BX_PAPSO (S)-N-methylcoclaurine 3'-hydroxylase-like protein OS=Papaver somniferum GN=CYP80BX PE=2 SV=1 38 473 9.0E-25
sp|F8S1I0|C7BL2_LACSA Costunolide synthase OS=Lactuca sativa GN=CYP71BL2 PE=1 SV=1 35 507 1.0E-24
sp|Q29497|CP17A_SHEEP Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ovis aries GN=CYP17A1 PE=2 SV=2 37 539 1.0E-24
sp|Q9GMC7|CP17A_BISBI Steroid 17-alpha-hydroxylase/17,20 lyase OS=Bison bison GN=CYP17A1 PE=2 SV=1 66 539 1.0E-24
sp|Q9AR74|TCMO_RUTGR Trans-cinnamate 4-monooxygenase OS=Ruta graveolens GN=CYP73A2 PE=2 SV=1 52 494 2.0E-24
sp|A3A871|C71Z6_ORYSJ Ent-isokaurene C2-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP71Z6 PE=1 SV=1 34 507 2.0E-24
sp|Q9SWR5|C93C1_SOYBN 2-hydroxyisoflavanone synthase OS=Glycine max GN=IFS2 PE=2 SV=1 60 512 2.0E-24
sp|D5JBX1|GAO_BARSP Germacrene A oxidase OS=Barnadesia spinosa PE=1 SV=1 35 493 3.0E-24
sp|Q9LJY7|C75AK_ARATH Cytochrome P450 705A20 OS=Arabidopsis thaliana GN=CYP705A20 PE=2 SV=1 41 531 3.0E-24
sp|O65784|C71B5_ARATH Cytochrome P450 71B5 OS=Arabidopsis thaliana GN=CYP71B5 PE=2 SV=1 56 510 3.0E-24
sp|P37115|TCMO_VIGRR Trans-cinnamate 4-monooxygenase OS=Vigna radiata var. radiata GN=CYP73A2 PE=1 SV=1 42 494 3.0E-24
sp|P48420|C78A1_MAIZE Cytochrome P450 78A1 OS=Zea mays GN=CYP78A1 PE=2 SV=1 207 506 4.0E-24
sp|P08686|CP21A_HUMAN Steroid 21-hydroxylase OS=Homo sapiens GN=CYP21A2 PE=1 SV=1 93 529 5.0E-24
sp|D1MI46|C76BA_SWEMU Geraniol 8-hydroxylase OS=Swertia mussotii GN=CYP76B10 PE=1 SV=1 69 528 7.0E-24
sp|Q9SAB6|C71AI_ARATH Cytochrome P450 71A18 OS=Arabidopsis thaliana GN=CYP71A18 PE=2 SV=2 56 522 8.0E-24
sp|O48928|C77A3_SOYBN Cytochrome P450 77A3 OS=Glycine max GN=CYP77A3 PE=2 SV=1 34 492 9.0E-24
sp|Q6J541|C79D3_LOTJA Isoleucine N-monooxygenase 1 OS=Lotus japonicus GN=CYP79D3 PE=1 SV=1 26 529 1.0E-23
sp|Q54SV9|C515B_DICDI Probable cytochrome P450 515B1 OS=Dictyostelium discoideum GN=cyp515B1 PE=2 SV=1 35 496 1.0E-23
sp|Q95328|CP17A_HORSE Steroid 17-alpha-hydroxylase/17,20 lyase OS=Equus caballus GN=CYP17A1 PE=2 SV=1 66 503 2.0E-23
sp|O93297|CP2K4_ONCMY Cytochrome P450 2K4 OS=Oncorhynchus mykiss GN=cyp2k4 PE=2 SV=1 93 521 2.0E-23
sp|Q43240|TCMO_ZINVI Trans-cinnamate 4-monooxygenase OS=Zinnia violacea GN=CYP73A12 PE=2 SV=1 28 501 2.0E-23
sp|A0A087X1C5|CP2D7_HUMAN Putative cytochrome P450 2D7 OS=Homo sapiens GN=CYP2D7 PE=5 SV=1 93 529 2.0E-23
sp|P37117|C71A4_SOLME Cytochrome P450 71A4 OS=Solanum melongena GN=CYP71A4 PE=2 SV=1 59 530 2.0E-23
sp|Q9LTM3|C71BK_ARATH Cytochrome P450 71B20 OS=Arabidopsis thaliana GN=CYP71B20 PE=2 SV=1 35 528 2.0E-23
sp|Q6QNI4|C71AJ_AMMMJ Psoralen synthase OS=Ammi majus GN=CYP71AJ1 PE=1 SV=1 35 507 2.0E-23
sp|Q04468|TCMO_HELTU Trans-cinnamate 4-monooxygenase OS=Helianthus tuberosus GN=CYP73A1 PE=1 SV=1 34 494 2.0E-23
sp|Q9SLP1|C78A9_ARATH Cytochrome P450 78A9 OS=Arabidopsis thaliana GN=CYP78A9 PE=2 SV=1 50 529 3.0E-23
sp|Q6J540|C79D4_LOTJA Isoleucine N-monooxygenase 2 OS=Lotus japonicus GN=CYP79D4 PE=1 SV=1 34 529 3.0E-23
sp|Q9XHC6|C93E1_SOYBN Beta-amyrin 24-hydroxylase OS=Glycine max GN=CYP93E1 PE=1 SV=1 59 523 3.0E-23
sp|P15540|CP21A_PIG Steroid 21-hydroxylase OS=Sus scrofa GN=CYP21 PE=1 SV=2 94 509 3.0E-23
sp|Q7X7X4|C99A2_ORYSJ Cytochrome P450 99A2 OS=Oryza sativa subsp. japonica GN=CYP99A2 PE=2 SV=2 56 520 3.0E-23
sp|Q9FUY7|C79F2_ARATH Hexahomomethionine N-hydroxylase OS=Arabidopsis thaliana GN=CYP79F2 PE=1 SV=2 34 529 4.0E-23
sp|O48923|C71DA_SOYBN Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 PE=2 SV=1 27 493 4.0E-23
sp|C0SJS3|ANGS_PASSA Angelicin synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ4 PE=1 SV=1 58 507 4.0E-23
sp|Q43033|TCMO_PETCR Trans-cinnamate 4-monooxygenase OS=Petroselinum crispum GN=CYP73A10 PE=2 SV=1 42 494 4.0E-23
sp|Q9LTM1|C71BM_ARATH Cytochrome P450 71B22 OS=Arabidopsis thaliana GN=CYP71B22 PE=2 SV=1 56 528 5.0E-23
sp|P37114|TCMO_MEDSA Trans-cinnamate 4-monooxygenase OS=Medicago sativa GN=CYP73A3 PE=2 SV=1 52 473 5.0E-23
sp|P24465|C71A1_PERAE Cytochrome P450 71A1 OS=Persea americana GN=CYP71A1 PE=1 SV=2 35 493 5.0E-23
sp|Q9LSF8|C82G1_ARATH Cytochrome P450 82G1 OS=Arabidopsis thaliana GN=CYP82G1 PE=1 SV=1 28 529 5.0E-23
sp|Q9LXM3|C71BZ_ARATH Cytochrome P450 71B38 OS=Arabidopsis thaliana GN=CYP71B38 PE=2 SV=2 56 526 5.0E-23
sp|Q9LTM2|C71BL_ARATH Cytochrome P450 71B21 OS=Arabidopsis thaliana GN=CYP71B21 PE=3 SV=1 56 528 5.0E-23
sp|Q9Y7G5|PHACA_EMEND Phenylacetate 2-hydroxylase OS=Emericella nidulans GN=phacA PE=1 SV=1 54 529 6.0E-23
sp|P11372|CP2CF_RABIT Cytochrome P450 2C15 (Fragment) OS=Oryctolagus cuniculus GN=CYP2C15 PE=2 SV=1 251 519 7.0E-23
sp|Q9T0K2|C71AK_ARATH Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=CYP71A20 PE=2 SV=2 58 493 7.0E-23
sp|O65785|C71B3_ARATH Cytochrome P450 71B3 OS=Arabidopsis thaliana GN=CYP71B3 PE=2 SV=2 39 528 8.0E-23
sp|D5JBW8|GAO_CICIN Germacrene A oxidase OS=Cichorium intybus PE=1 SV=1 38 507 1.0E-22
sp|Q9SZ46|C82C4_ARATH Cytochrome P450 82C4 OS=Arabidopsis thaliana GN=CYP82C4 PE=2 SV=1 319 537 1.0E-22
sp|Q27589|CP4D2_DROME Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2 50 494 1.0E-22
sp|Q9SAE4|C71BT_ARATH Cytochrome P450 71B29 OS=Arabidopsis thaliana GN=CYP71B29 PE=3 SV=1 68 493 1.0E-22
sp|O49340|C71AC_ARATH Cytochrome P450 71A12 OS=Arabidopsis thaliana GN=CYP71A12 PE=2 SV=1 56 507 1.0E-22
sp|E1B2Z9|C7AV8_CICIN Cytochrome P450 71AV8 OS=Cichorium intybus GN=CYP71AV8 PE=2 SV=1 35 507 1.0E-22
sp|Q7Y1V5|C78AB_ORYSJ Cytochrome P450 78A11 OS=Oryza sativa subsp. japonica GN=CYP78A11 PE=1 SV=2 152 493 1.0E-22
sp|P98183|C71DC_CATRO Tabersonine 16-hydroxylase (Fragment) OS=Catharanthus roseus GN=CYP71D12 PE=1 SV=1 41 493 2.0E-22
sp|Q54WB9|C513D_DICDI Probable cytochrome P450 513D1 OS=Dictyostelium discoideum GN=cyp513D1 PE=3 SV=1 61 506 2.0E-22
sp|Q2LA59|CP21A_LYNLY Steroid 21-hydroxylase OS=Lynx lynx GN=CYP21 PE=3 SV=1 94 529 2.0E-22
sp|Q9LIP6|C71BV_ARATH Cytochrome P450 71B34 OS=Arabidopsis thaliana GN=CYP71B34 PE=2 SV=1 34 493 2.0E-22
sp|Q949U1|C79F1_ARATH Dihomomethionine N-hydroxylase OS=Arabidopsis thaliana GN=CYP79F1 PE=1 SV=1 34 529 2.0E-22
sp|Q9LIP5|C71BW_ARATH Cytochrome P450 71B35 OS=Arabidopsis thaliana GN=CYP71B35 PE=2 SV=1 33 508 2.0E-22
sp|O65787|C71B6_ARATH Cytochrome P450 71B6 OS=Arabidopsis thaliana GN=CYP71B6 PE=2 SV=1 54 493 2.0E-22
sp|Q9GMC8|CP17A_FELCA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Felis catus GN=CYP17A1 PE=2 SV=1 40 503 3.0E-22
sp|Q2LCM1|CP21A_CANLU Steroid 21-hydroxylase OS=Canis lupus GN=CYP21 PE=3 SV=1 85 529 3.0E-22
sp|Q8WNW0|CP21A_CANLF Steroid 21-hydroxylase OS=Canis lupus familiaris GN=CYP21 PE=3 SV=1 85 529 3.0E-22
sp|O49396|C82C3_ARATH Cytochrome P450 82C3 OS=Arabidopsis thaliana GN=CYP82C3 PE=2 SV=3 319 537 3.0E-22
sp|Q6YTF5|C76M5_ORYSJ Cytochrome P450 76M5 OS=Oryza sativa subsp. japonica GN=CYP76M5 PE=1 SV=1 69 507 3.0E-22
sp|Q9FXW4|C80B2_COPJA Probable (S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 OS=Coptis japonica GN=CYP80B2 PE=2 SV=1 53 530 3.0E-22
sp|P47195|C80A1_BERST Berbamunine synthase OS=Berberis stolonifera GN=CYP80A1 PE=1 SV=1 58 508 3.0E-22
sp|O81971|C71D9_SOYBN Cytochrome P450 71D9 OS=Glycine max GN=CYP71D9 PE=2 SV=1 37 493 3.0E-22
sp|P37122|C76A2_SOLME Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1 59 502 4.0E-22
sp|Q55AJ4|C516B_DICDI Probable cytochrome P450 516B1 OS=Dictyostelium discoideum GN=cyp516B1 PE=3 SV=1 38 495 4.0E-22
sp|P93530|C71D6_SOLCH Cytochrome P450 71D6 OS=Solanum chacoense GN=CYP71D6 PE=2 SV=1 58 507 4.0E-22
sp|Q556M4|C5082_DICDI Probable cytochrome P450 508A2 OS=Dictyostelium discoideum GN=cyp508A2-1 PE=3 SV=1 37 529 5.0E-22
sp|Q50LH4|C7193_ESCCA (S)-stylopine synthase 2 OS=Eschscholzia californica GN=CYP719A3 PE=1 SV=1 53 530 6.0E-22
sp|Q9FIB0|C78A7_ARATH Cytochrome P450 78A7 OS=Arabidopsis thaliana GN=CYP78A7 PE=2 SV=1 26 512 6.0E-22
sp|D5JBW9|GAO_SAUCO Germacrene A oxidase OS=Saussurea costus PE=1 SV=1 54 507 7.0E-22
sp|O64637|C76C2_ARATH Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1 83 507 7.0E-22
sp|P05180|CP2H1_CHICK Cytochrome P450 2H1 OS=Gallus gallus GN=CYP2H1 PE=2 SV=1 333 529 8.0E-22
sp|F4JW83|C84A4_ARATH Cytochrome P450 84A4 OS=Arabidopsis thaliana GN=CYP84A4 PE=1 SV=1 60 530 8.0E-22
sp|Q2LA60|CP21A_FELCA Steroid 21-hydroxylase OS=Felis catus GN=CYP21 PE=3 SV=1 94 529 9.0E-22
sp|Q94FM7|C71DK_TOBAC 5-epiaristolochene 1,3-dihydroxylase OS=Nicotiana tabacum GN=CYP71D20 PE=1 SV=2 59 493 9.0E-22
sp|P90771|C36A1_CAEEL Probable cytochrome P450 CYP36A1 OS=Caenorhabditis elegans GN=cyp-36A1 PE=3 SV=2 35 507 1.0E-21
sp|Q9LTL0|C71BQ_ARATH Cytochrome P450 71B26 OS=Arabidopsis thaliana GN=CYP71B26 PE=2 SV=1 55 493 1.0E-21
sp|O49394|C82C2_ARATH Cytochrome P450 82C2 OS=Arabidopsis thaliana GN=CYP82C2 PE=2 SV=2 259 529 1.0E-21
sp|Q9SP06|C80B3_PAPSO (S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (Fragment) OS=Papaver somniferum GN=CYP80B3 PE=1 SV=1 67 530 1.0E-21
sp|Q1PS23|AMO_ARTAN Amorpha-4,11-diene 12-monooxygenase OS=Artemisia annua GN=CYP71AV1 PE=1 SV=1 38 493 1.0E-21
sp|Q9LVD2|C71BA_ARATH Cytochrome P450 71B10 OS=Arabidopsis thaliana GN=CYP71B10 PE=3 SV=1 60 493 2.0E-21
sp|D5J9U8|GAO_LACSA Germacrene A oxidase OS=Lactuca sativa GN=GAO1 PE=1 SV=1 38 507 2.0E-21
sp|O48927|C78A3_SOYBN Cytochrome P450 78A3 OS=Glycine max GN=CYP78A3 PE=2 SV=1 338 529 2.0E-21
sp|Q9LIP4|C71BX_ARATH Cytochrome P450 71B36 OS=Arabidopsis thaliana GN=CYP71B36 PE=3 SV=1 39 508 2.0E-21
sp|Q42716|C71A8_MENPI Cytochrome P450 71A8 OS=Mentha piperita GN=CYP71A8 PE=3 SV=1 27 507 4.0E-21
sp|O49342|C71AD_ARATH Indoleacetaldoxime dehydratase OS=Arabidopsis thaliana GN=CYP71A13 PE=1 SV=1 56 507 4.0E-21
sp|Q42600|C84A1_ARATH Cytochrome P450 84A1 OS=Arabidopsis thaliana GN=CYP84A1 PE=1 SV=1 324 507 4.0E-21
sp|P03940|CP21A_MOUSE Steroid 21-hydroxylase OS=Mus musculus GN=Cyp21 PE=2 SV=3 337 494 4.0E-21
sp|Q9VWR5|CP306_DROME Cytochrome P450 306a1 OS=Drosophila melanogaster GN=phm PE=1 SV=1 29 495 5.0E-21
sp|Q9LIP3|C71BY_ARATH Cytochrome P450 71B37 OS=Arabidopsis thaliana GN=CYP71B37 PE=3 SV=2 60 493 5.0E-21
sp|P37121|C76A1_SOLME Cytochrome P450 76A1 (Fragment) OS=Solanum melongena GN=CYP76A1 PE=2 SV=1 227 520 5.0E-21
sp|Q9FI39|THAD_ARATH Cytochrome P450 705A5 OS=Arabidopsis thaliana GN=CYP705A5 PE=2 SV=1 82 477 6.0E-21
sp|Q9WVK8|CP46A_MOUSE Cholesterol 24-hydroxylase OS=Mus musculus GN=Cyp46a1 PE=1 SV=1 47 529 6.0E-21
sp|P20678|CP2H2_CHICK Cytochrome P450 2H2 OS=Gallus gallus GN=CYP2H2 PE=1 SV=1 333 509 7.0E-21
sp|P37118|C71A2_SOLME Cytochrome P450 71A2 OS=Solanum melongena GN=CYP71A2 PE=2 SV=1 59 528 7.0E-21
sp|O81972|C82A2_SOYBN Cytochrome P450 82A2 OS=Glycine max GN=CYP82A2 PE=2 SV=1 93 529 8.0E-21
sp|Q55BU9|C5133_DICDI Probable cytochrome P450 513A3 OS=Dictyostelium discoideum GN=cyp513A3 PE=3 SV=1 38 489 8.0E-21
sp|Q6WKY9|C7D95_MENGR Cytochrome P450 71D95 OS=Mentha gracilis GN=CYP71D95 PE=1 SV=1 93 507 8.0E-21
sp|Q64562|CP21A_RAT Steroid 21-hydroxylase OS=Rattus norvegicus GN=Cyp21 PE=2 SV=1 334 494 9.0E-21
sp|Q6WNQ9|C81E9_MEDTR Isoflavone 3'-hydroxylase (Fragment) OS=Medicago truncatula GN=CYP81E9 PE=1 SV=1 82 523 9.0E-21
sp|Q6IV13|C7D95_MENSP Cytochrome P450 71D95 OS=Mentha spicata GN=CYP71D95 PE=1 SV=1 93 507 1.0E-20
sp|Q1ZXL7|C5083_DICDI Probable cytochrome P450 508A3 OS=Dictyostelium discoideum GN=cyp508A3-1 PE=3 SV=1 62 506 1.0E-20
sp|O93299|CP2K3_ONCMY Cytochrome P450 2K3 OS=Oncorhynchus mykiss GN=cyp2k3 PE=2 SV=1 323 521 1.0E-20
sp|D5JBX0|GAO_HELAN Germacrene A oxidase OS=Helianthus annuus PE=1 SV=1 61 507 1.0E-20
sp|Q9LZ31|C77A4_ARATH Cytochrome P450 77A4 OS=Arabidopsis thaliana GN=CYP77A4 PE=2 SV=1 71 529 1.0E-20
sp|Q9Y6A2|CP46A_HUMAN Cholesterol 24-hydroxylase OS=Homo sapiens GN=CYP46A1 PE=1 SV=1 47 529 2.0E-20
sp|Q9JMA7|CP341_MOUSE Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=1 SV=2 61 529 2.0E-20
sp|Q6YTF1|C76M8_ORYSJ Oryzalexin D synthase OS=Oryza sativa subsp. japonica GN=CYP76M8 PE=1 SV=1 337 527 2.0E-20
sp|O81928|TCMO_CICAR Trans-cinnamate 4-monooxygenase OS=Cicer arietinum GN=CYP73A19 PE=2 SV=2 52 494 2.0E-20
sp|Q43068|C82A1_PEA Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2 337 528 3.0E-20
sp|L7X3S1|MSH_PAPSO Methyltetrahydroprotoberberine 14-monooxygenase OS=Papaver somniferum GN=CYP82N4 PE=1 SV=1 337 531 3.0E-20
sp|P33265|CP2CS_MESAU Cytochrome P450 2C28 OS=Mesocricetus auratus GN=CYP2C28 PE=2 SV=1 91 509 4.0E-20
sp|Q64417|CP3AE_CAVPO Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14 PE=2 SV=2 61 494 4.0E-20
sp|Q9XHE7|C71DD_MENPI Cytochrome P450 71D13 OS=Mentha piperita GN=CYP71D13 PE=1 SV=1 93 507 5.0E-20
sp|I3PFJ5|C76AD_BETVU Cytochrome P450 76AD1 OS=Beta vulgaris GN=CYP76AD1 PE=2 SV=1 327 529 5.0E-20
sp|O49858|C82A3_SOYBN Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=2 SV=1 259 529 6.0E-20
sp|Q9LTL8|C71BO_ARATH Cytochrome P450 71B24 OS=Arabidopsis thaliana GN=CYP71B24 PE=2 SV=1 58 528 8.0E-20
sp|Q9XHE8|C71DI_MENSP Cytochrome P450 71D18 OS=Mentha spicata GN=CYP71D18 PE=1 SV=1 27 507 1.0E-19
sp|Q6WKZ1|C71DI_MENGR Cytochrome P450 71D18 OS=Mentha gracilis GN=CYP71D18 PE=1 SV=1 27 507 1.0E-19
sp|P19100|CP17A_PIG Steroid 17-alpha-hydroxylase/17,20 lyase OS=Sus scrofa GN=CYP17A1 PE=2 SV=3 66 503 2.0E-19
sp|Q947B7|MFS_MENPI (+)-menthofuran synthase OS=Mentha piperita PE=1 SV=1 79 529 2.0E-19
sp|Q69X58|C76M7_ORYSJ Ent-cassadiene C11-alpha-hydroxylase 1 OS=Oryza sativa subsp. japonica GN=CYP76M7 PE=1 SV=1 337 527 2.0E-19
sp|P24462|CP3A7_HUMAN Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1 SV=2 61 531 3.0E-19
sp|O65438|C71AR_ARATH Cytochrome P450 71A27 OS=Arabidopsis thaliana GN=CYP71A27 PE=3 SV=3 56 528 3.0E-19
sp|Q64406|CP3AF_CAVPO Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 61 494 4.0E-19
sp|Q64459|CP3AB_MOUSE Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 61 529 4.0E-19
sp|O49859|C82A4_SOYBN Cytochrome P450 82A4 OS=Glycine max GN=CYP82A4 PE=2 SV=1 62 507 5.0E-19
sp|Q9T0K0|C71AJ_ARATH Cytochrome P450 71A19 OS=Arabidopsis thaliana GN=CYP71A19 PE=2 SV=1 58 493 6.0E-19
sp|Q9STK8|C71AP_ARATH Cytochrome P450 71A25 OS=Arabidopsis thaliana GN=CYP71A25 PE=2 SV=1 34 473 6.0E-19
sp|P05183|CP3A2_RAT Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2 PE=1 SV=2 61 494 6.0E-19
sp|Q948Y1|C719A_COPJA (S)-canadine synthase OS=Coptis japonica GN=CYP719A1 PE=1 SV=1 60 495 7.0E-19
sp|Q93ZB2|KO1_ARATH Ent-kaurene oxidase, chloroplastic OS=Arabidopsis thaliana GN=KO PE=1 SV=2 57 529 8.0E-19
sp|O64638|C76C3_ARATH Cytochrome P450 76C3 OS=Arabidopsis thaliana GN=CYP76C3 PE=2 SV=2 315 493 1.0E-18
sp|Q9M7B8|C79D1_MANES Valine N-monooxygenase 1 OS=Manihot esculenta GN=CYP79D1 PE=1 SV=1 115 496 1.0E-18
sp|Q64409|CP3AH_CAVPO Cytochrome P450 3A17 OS=Cavia porcellus GN=CYP3A17 PE=2 SV=1 61 494 1.0E-18
sp|B1NF20|C719E_ARGME Cheilanthifoline synthase OS=Argemone mexicana GN=CYP719A14 PE=1 SV=1 60 510 2.0E-18
sp|P20815|CP3A5_HUMAN Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1 SV=1 61 529 2.0E-18
sp|O64718|C71B9_ARATH Cytochrome P450 71B9 OS=Arabidopsis thaliana GN=CYP71B9 PE=2 SV=3 31 493 2.0E-18
sp|O22307|C71DB_LOTJA Cytochrome P450 71D11 (Fragment) OS=Lotus japonicus GN=CYP71D11 PE=2 SV=1 57 526 2.0E-18
sp|P37124|C77A2_SOLME Cytochrome P450 77A2 OS=Solanum melongena GN=CYP77A2 PE=2 SV=1 71 492 3.0E-18
sp|P92994|TCMO_ARATH Trans-cinnamate 4-monooxygenase OS=Arabidopsis thaliana GN=CYP73A5 PE=2 SV=1 308 494 3.0E-18
sp|O09158|CP3AP_MOUSE Cytochrome P450 3A25 OS=Mus musculus GN=Cyp3a25 PE=1 SV=1 61 494 3.0E-18
sp|O24312|TCMO_POPTM Trans-cinnamate 4-monooxygenase OS=Populus tremuloides GN=CYP73A13 PE=2 SV=1 87 494 4.0E-18
sp|Q9DBW0|CP4V2_MOUSE Cytochrome P450 4V2 OS=Mus musculus GN=Cyp4v2 PE=1 SV=1 324 491 4.0E-18
sp|Q54CS3|C508C_DICDI Probable cytochrome P450 508C1 OS=Dictyostelium discoideum GN=cyp508C1 PE=3 SV=1 315 489 5.0E-18
sp|H2DH24|C7D47_PANGI Cytochrome P450 CYP82D47 OS=Panax ginseng PE=2 SV=1 334 492 5.0E-18
sp|Q5Z5R4|C7016_ORYSJ Ent-kaurene oxidase 2 OS=Oryza sativa subsp. japonica GN=CYP701A6 PE=1 SV=1 54 492 5.0E-18
sp|B5UAQ8|C7195_ESCCA Cheilanthifoline synthase OS=Eschscholzia californica GN=CYP719A5 PE=1 SV=1 60 531 5.0E-18
sp|L7X0L7|P6H_PAPSO Protopine 6-monooxygenase OS=Papaver somniferum GN=CYP82N3 PE=2 SV=1 83 501 6.0E-18
sp|Q54KV0|C513B_DICDI Probable cytochrome P450 513B1 OS=Dictyostelium discoideum GN=cyp513B1 PE=3 SV=1 37 489 6.0E-18
sp|Q43067|TCMO_PEA Trans-cinnamate 4-monooxygenase OS=Pisum sativum GN=CYP73A9 PE=2 SV=2 104 494 7.0E-18
sp|Q54Q53|C519B_DICDI Probable cytochrome P450 519B1 OS=Dictyostelium discoideum GN=cyp519B1 PE=3 SV=1 34 495 8.0E-18
sp|P08684|CP3A4_HUMAN Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4 61 529 8.0E-18
sp|F2Z9C1|P6H_ESCCA Protopine 6-monooxygenase OS=Eschscholzia californica GN=CYP82N2v2 PE=1 SV=1 337 529 1.0E-17
sp|Q64481|CP3AG_MOUSE Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=2 61 529 1.0E-17
sp|Q1ZXG6|C5131_DICDI Probable cytochrome P450 513A1 OS=Dictyostelium discoideum GN=cyp513A1 PE=3 SV=1 61 489 1.0E-17
sp|Q64581|CP3AI_RAT Cytochrome P450 3A18 OS=Rattus norvegicus GN=Cyp3a18 PE=2 SV=1 41 494 2.0E-17
sp|P11707|CP3A6_RABIT Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 61 495 2.0E-17
sp|Q9FMA5|C85A1_ARATH Cytochrome P450 85A1 OS=Arabidopsis thaliana GN=CYP85A1 PE=2 SV=1 53 477 2.0E-17
sp|P04800|CP3A1_RAT Cytochrome P450 3A1 OS=Rattus norvegicus GN=Cyp3a1 PE=1 SV=1 61 531 2.0E-17
sp|P24463|CP3AC_CANLF Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 337 529 2.0E-17
sp|O81973|C93A3_SOYBN Cytochrome P450 93A3 OS=Glycine max GN=CYP93A3 PE=2 SV=1 317 525 2.0E-17
sp|Q9V399|CP303_DROME Probable cytochrome P450 303a1 OS=Drosophila melanogaster GN=Cyp303a1 PE=2 SV=1 337 494 2.0E-17
sp|E3W9C4|C71A1_ZINZE Alpha-humulene 10-hydroxylase OS=Zingiber zerumbet GN=CYP71BA1 PE=1 SV=1 41 526 3.0E-17
sp|Q1ZXA1|C521A_DICDI Probable cytochrome P450 521A1 OS=Dictyostelium discoideum GN=cyp521A1 PE=3 SV=1 323 495 3.0E-17
sp|Q43054|TCMO_POPKI Trans-cinnamate 4-monooxygenase OS=Populus kitakamiensis GN=CYP73A16 PE=2 SV=1 87 494 3.0E-17
sp|H2DH19|C7D31_PANGI Cytochrome P450 CYP71D312 OS=Panax ginseng PE=2 SV=1 79 526 3.0E-17
sp|O70537|CP3AV_MESAU Cytochrome P450 3A31 OS=Mesocricetus auratus GN=CYP3A31 PE=2 SV=1 61 494 4.0E-17
sp|B1NF18|C719B_PAPSO Salutaridine synthase OS=Papaver somniferum GN=CYP719B1 PE=1 SV=1 34 492 4.0E-17
sp|Q43135|C79A1_SORBI Tyrosine N-monooxygenase OS=Sorghum bicolor GN=CYP79A1 PE=1 SV=3 248 533 4.0E-17
sp|Q43255|C71C2_MAIZE indolin-2-one monooxygenase OS=Zea mays GN=CYP71C2 PE=1 SV=1 325 493 4.0E-17
sp|P48416|CP10_LYMST Cytochrome P450 10 OS=Lymnaea stagnalis GN=CYP10 PE=2 SV=1 337 529 4.0E-17
sp|Q9PUB4|CP26A_CHICK Cytochrome P450 26A1 OS=Gallus gallus GN=CYP26A1 PE=2 SV=1 59 519 4.0E-17
sp|A2RRT9|CP4V2_RAT Cytochrome P450 4V2 OS=Rattus norvegicus GN=Cyp4v2 PE=2 SV=1 338 497 6.0E-17
sp|O35132|CP27B_RAT 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27b1 PE=2 SV=2 276 494 6.0E-17
sp|Q1ZXA4|C508D_DICDI Probable cytochrome P450 508D1 OS=Dictyostelium discoideum GN=cyp508D1 PE=3 SV=1 62 529 7.0E-17
sp|P51538|CP3A9_RAT Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 61 494 7.0E-17
sp|Q7KR10|CCD1D_DROME Probable cytochrome P450 12d1 distal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-d PE=2 SV=1 337 494 9.0E-17
sp|Q64464|CP3AD_MOUSE Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 61 494 1.0E-16
sp|Q9STK7|C71AQ_ARATH Cytochrome P450 71A26 OS=Arabidopsis thaliana GN=CYP71A26 PE=3 SV=1 53 473 1.0E-16
sp|Q1ZXF5|C5084_DICDI Probable cytochrome P450 508A4 OS=Dictyostelium discoideum GN=cyp508A4 PE=3 SV=1 34 520 1.0E-16
sp|Q54DT2|C516A_DICDI Probable cytochrome P450 516A1 OS=Dictyostelium discoideum GN=cyp516A1 PE=3 SV=2 59 508 1.0E-16
sp|Q50LH3|C7192_ESCCA (S)-stylopine synthase 1 OS=Eschscholzia californica GN=CYP719A2 PE=1 SV=1 34 516 1.0E-16
sp|P33268|CP3A8_MACFA Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1 61 529 2.0E-16
sp|P79401|CP3AT_PIG Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1 61 529 2.0E-16
sp|Q6WKZ0|C7D94_MENGR Cytochrome P450 71D94 OS=Mentha gracilis GN=CYP71D94 PE=2 SV=1 63 493 2.0E-16
sp|Q9M7B7|C79D2_MANES Valine N-monooxygenase 2 OS=Manihot esculenta GN=CYP79D2 PE=1 SV=1 68 492 2.0E-16
sp|B1NF19|C719D_ARGME (S)-stylopine synthase OS=Argemone mexicana GN=CYP719A13 PE=1 SV=1 47 529 2.0E-16
sp|Q54LT7|C519E_DICDI Probable cytochrome P450 519E1 OS=Dictyostelium discoideum GN=cyp519E1 PE=3 SV=1 60 529 2.0E-16
sp|Q9FH66|C71AG_ARATH Cytochrome P450 71A16 OS=Arabidopsis thaliana GN=CYP71A16 PE=2 SV=1 28 530 2.0E-16
sp|Q6Z5I7|C76M6_ORYSJ Oryzalexin E synthase OS=Oryza sativa subsp. japonica GN=CYP76M6 PE=1 SV=1 69 493 2.0E-16
sp|Q9DBG1|CP27A_MOUSE Sterol 26-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27a1 PE=1 SV=1 277 499 2.0E-16
sp|Q6NT55|CP4FN_HUMAN Cytochrome P450 4F22 OS=Homo sapiens GN=CYP4F22 PE=2 SV=1 201 523 2.0E-16
sp|P82712|CCD1P_DROME Probable cytochrome P450 12d1 proximal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-p PE=2 SV=3 273 494 3.0E-16
sp|O18993|CP3AL_CALJA Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3A21 PE=2 SV=1 61 529 3.0E-16
sp|A2Z212|ABAH3_ORYSI Abscisic acid 8'-hydroxylase 3 OS=Oryza sativa subsp. indica GN=CYP707A7 PE=3 SV=1 59 489 3.0E-16
sp|Q5Z5R7|C701S_ORYSJ Ent-kaurene oxidase-like 3 OS=Oryza sativa subsp. japonica GN=CYP701A19 PE=2 SV=1 66 492 3.0E-16
sp|Q9VXY0|CP4S3_DROME Probable cytochrome P450 4s3 OS=Drosophila melanogaster GN=Cyp4s3 PE=3 SV=1 61 505 4.0E-16
sp|P17178|CP27A_RAT Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27a1 PE=1 SV=1 331 499 4.0E-16
sp|Q01741|CP1A2_CHICK Cytochrome P450 1A2 (Fragment) OS=Gallus gallus GN=CYP1A2 PE=2 SV=1 306 452 4.0E-16
sp|Q9VW43|CP305_DROME Probable cytochrome P450 305a1 OS=Drosophila melanogaster GN=Cyp305a1 PE=2 SV=1 35 521 4.0E-16
sp|O46051|C4D14_DROME Probable cytochrome P450 4d14 OS=Drosophila melanogaster GN=Cyp4d14 PE=3 SV=1 35 529 5.0E-16
sp|Q29496|CP3AO_SHEEP Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 62 531 5.0E-16
sp|Q9VVR9|C12C1_DROME Probable cytochrome P450 12c1, mitochondrial OS=Drosophila melanogaster GN=Cyp12c1 PE=2 SV=2 278 494 6.0E-16
sp|Q9STL0|C71AN_ARATH Cytochrome P450 71A23 OS=Arabidopsis thaliana GN=CYP71A23 PE=2 SV=1 61 473 6.0E-16
sp|Q27606|CP4E2_DROME Cytochrome P450 4e2 OS=Drosophila melanogaster GN=Cyp4e2 PE=2 SV=2 34 494 8.0E-16
sp|O04164|C71A6_NEPRA Cytochrome P450 71A6 (Fragment) OS=Nepeta racemosa GN=CYP71A6 PE=2 SV=1 68 507 8.0E-16
sp|Q54LA8|C555A_DICDI Probable cytochrome P450 555A1 OS=Dictyostelium discoideum GN=cyp555A1 PE=3 SV=1 37 484 8.0E-16
sp|Q9V5L3|C49A1_DROME Probable cytochrome P450 49a1 OS=Drosophila melanogaster GN=Cyp49a1 PE=2 SV=3 338 500 9.0E-16
sp|Q4G0S4|C27C1_HUMAN Cytochrome P450 27C1 OS=Homo sapiens GN=CYP27C1 PE=2 SV=2 337 497 9.0E-16
sp|Q09128|CP24A_RAT 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp24a1 PE=1 SV=1 297 529 1.0E-15
sp|Q0J185|ABAH3_ORYSJ Abscisic acid 8'-hydroxylase 3 OS=Oryza sativa subsp. japonica GN=CYP707A7 PE=2 SV=1 59 489 1.0E-15
sp|Q5RCN6|CP4V2_PONAB Cytochrome P450 4V2 OS=Pongo abelii GN=CYP4V2 PE=2 SV=1 338 503 1.0E-15
sp|Q54NY3|C554A_DICDI Probable cytochrome P450 554A1 OS=Dictyostelium discoideum GN=cyp554A1 PE=3 SV=1 319 489 1.0E-15
sp|Q64441|CP24A_MOUSE 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp24a1 PE=2 SV=1 297 529 1.0E-15
sp|Q6ZWL3|CP4V2_HUMAN Cytochrome P450 4V2 OS=Homo sapiens GN=CYP4V2 PE=1 SV=2 338 503 2.0E-15
sp|Q9LMX7|C78A5_ARATH Cytochrome P450 78A5 OS=Arabidopsis thaliana GN=CYP78A5 PE=2 SV=1 338 530 2.0E-15
sp|O44220|C12B1_DROAC Cytochrome P450 12b1, mitochondrial OS=Drosophila acanthoptera GN=Cyp12b1 PE=2 SV=1 337 495 2.0E-15
sp|Q54F47|C513C_DICDI Probable cytochrome P450 513C1 OS=Dictyostelium discoideum GN=cyp513C1 PE=3 SV=1 34 495 2.0E-15
sp|Q64148|CP3AA_MESAU Lithocholate 6-beta-hydroxylase OS=Mesocricetus auratus GN=CYP3A10 PE=1 SV=2 37 522 2.0E-15
sp|O35084|CP27B_MOUSE 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27b1 PE=2 SV=2 252 494 2.0E-15
[Show less]

GO

GO Term Description Terminal node
GO:0005506 iron ion binding Yes
GO:0004497 monooxygenase activity Yes
GO:0020037 heme binding Yes
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0097159 organic cyclic compound binding No
GO:0046872 metal ion binding No
GO:0046906 tetrapyrrole binding No
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016491 oxidoreductase activity No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043169 cation binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

Gene cluster ID Type of secondary metabolism gene
Cluster 2 Decorating

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup9
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|490
Ophiocordyceps australis 1348a (Ghana) OphauG2|3573
Ophiocordyceps australis 1348a (Ghana) OphauG2|4985
Ophiocordyceps australis 1348a (Ghana) OphauG2|6472
Ophiocordyceps australis 1348a (Ghana) OphauG2|7423
Ophiocordyceps australis map64 (Brazil) OphauB2|3108
Ophiocordyceps australis map64 (Brazil) OphauB2|5639
Ophiocordyceps australis map64 (Brazil) OphauB2|628
Ophiocordyceps australis map64 (Brazil) OphauB2|6422
Ophiocordyceps australis map64 (Brazil) OphauB2|853
Ophiocordyceps camponoti-floridani Ophcf2|06974
Ophiocordyceps camponoti-floridani Ophcf2|02539
Ophiocordyceps camponoti-floridani Ophcf2|00830
Ophiocordyceps camponoti-floridani Ophcf2|03223
Ophiocordyceps camponoti-floridani Ophcf2|00829
Ophiocordyceps camponoti-rufipedis Ophun1|3123
Ophiocordyceps camponoti-rufipedis Ophun1|4430
Ophiocordyceps camponoti-rufipedis Ophun1|383
Ophiocordyceps camponoti-rufipedis Ophun1|5525
Ophiocordyceps camponoti-rufipedis Ophun1|2010
Ophiocordyceps camponoti-rufipedis Ophun1|84 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6846
Ophiocordyceps kimflemingae Ophio5|4726
Ophiocordyceps kimflemingae Ophio5|4727
Ophiocordyceps kimflemingae Ophio5|5518
Ophiocordyceps kimflemingae Ophio5|7260
Ophiocordyceps kimflemingae Ophio5|98
Ophiocordyceps kimflemingae Ophio5|4349
Ophiocordyceps kimflemingae Ophio5|3093
Ophiocordyceps kimflemingae Ophio5|4369
Ophiocordyceps subramaniannii Hirsu2|7868
Ophiocordyceps subramaniannii Hirsu2|30
Ophiocordyceps subramaniannii Hirsu2|10608

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|84
MDSATSPSVGILNTTCLALGTHESNHELTTYRPILQVLAILLLGFMTAAYVGRRGKPSLPPGPRPLPLVGNLRDM
PPKGALLHEHWLKHKELYGPVTSVTVLGQTVIVLHDRAAANYILETNSIKTANRACFSHASVAVGATKLFVMGND
DERQRKYRKLLQHEIGSATAMVKYHALLEDEADRLLVAMLQDPSRVFESIRTMANANIMGIAYGYQIERNKADPL
LELFESVPTIVEESVSPFASPVDYLPWLQHLPNWFPGTGYRQKFKARAHSLLQSIDQPFLFTRQQMNQGINQPSV
LSNLIARSGRPNGSNDFDLTPDQQDSIKWMFGSLHGAGSDTTSSAVASFIIAMMLFPDVQRKAQQEIDRVVGPHR
LPNLEDRANLPYIQAVIKELGRWYTIVPMGFFHTVTEDLLYDGYLIPKGAHVLPAAWGMNHDASVYKDPDEFKPE
RFSQGEPEPRSSVFGYGRRVCPGQKMGEASLFCAVSKILAVFNISKSLGHDGQPLDVKPEMELGFISRPKPVPCV
IEPRSEKHELLVRGLRT*
Coding >Ophun1|84
ATGGACTCCGCCACCAGTCCCAGCGTCGGCATCTTGAACACGACGTGTCTCGCCCTGGGCACCCACGAATCCAAC
CATGAACTCACCACGTATCGTCCCATCTTGCAAGTCCTGGCCATTCTCCTGCTCGGCTTCATGACAGCCGCATAC
GTCGGCAGACGAGGGAAGCCCAGTCTACCGCCCGGTCCCAGACCTCTGCCCCTGGTGGGCAATCTTCGCGACATG
CCGCCGAAAGGAGCGCTGCTACACGAGCACTGGCTTAAACACAAGGAGCTGTACGGGCCCGTCACCTCCGTCACA
GTCCTGGGCCAGACCGTCATCGTCCTTCACGACAGGGCGGCTGCCAACTACATACTGGAGACCAACTCGATCAAG
ACGGCCAACCGGGCATGCTTCAGCCACGCTTCGGTGGCGGTTGGGGCCACCAAGCTGTTCGTCATGGGGAATGAC
GATGAGCGTCAGCGGAAGTATCGGAAGCTGCTGCAGCATGAGATTGGCTCGGCGACGGCCATGGTCAAGTATCAT
GCCCTTCTGGAGGATGAAGCCGATAGGTTGCTTGTGGCGATGCTGCAGGATCCATCGCGGGTGTTTGAGTCGATC
AGAACCATGGCCAACGCCAACATCATGGGCATCGCATACGGCTACCAGATTGAGAGAAACAAGGCAGACCCCCTA
CTGGAACTCTTCGAAAGCGTGCCTACCATCGTCGAAGAGTCGGTATCCCCCTTCGCTTCGCCAGTTGACTACCTG
CCATGGCTCCAACACCTCCCCAACTGGTTCCCCGGAACGGGATACCGACAAAAGTTCAAAGCCAGGGCCCATAGC
CTGCTGCAGTCCATCGACCAGCCCTTCCTCTTCACTCGGCAGCAGATGAACCAGGGCATCAACCAGCCGTCCGTC
CTGTCGAATCTCATCGCCAGATCCGGTCGTCCCAACGGCAGCAATGACTTCGACTTGACCCCTGATCAGCAAGAC
TCCATCAAGTGGATGTTCGGAAGCCTCCACGGCGCAGGATCCGATACCACGTCGTCGGCGGTAGCCTCCTTCATC
ATCGCCATGATGCTCTTCCCGGACGTACAGCGGAAAGCTCAGCAGGAGATCGACCGGGTAGTTGGTCCCCATCGG
CTGCCCAACCTCGAGGACCGCGCCAACCTGCCCTACATCCAGGCCGTAATCAAGGAGCTTGGCCGATGGTATACC
ATTGTGCCCATGGGCTTCTTCCACACAGTCACCGAGGATCTCCTCTACGACGGCTACCTCATCCCCAAGGGCGCC
CACGTGCTCCCCGCCGCCTGGGGGATGAACCACGACGCAAGCGTCTACAAGGACCCGGACGAATTCAAGCCAGAG
CGCTTCTCCCAAGGCGAGCCCGAACCAAGATCATCCGTCTTCGGCTACGGCCGCAGGGTGTGTCCCGGCCAAAAG
ATGGGTGAGGCCTCCCTCTTCTGCGCCGTCTCCAAGATACTGGCCGTCTTCAACATCAGCAAGTCGCTCGGCCAC
GACGGGCAGCCCCTTGACGTCAAGCCCGAGATGGAGCTTGGATTCATATCTCGTCCAAAGCCTGTGCCTTGTGTT
ATCGAGCCTAGGAGTGAGAAGCATGAGCTTCTGGTTAGGGGCTTGCGGACTTGA
Transcript >Ophun1|84
ATGGACTCCGCCACCAGTCCCAGCGTCGGCATCTTGAACACGACGTGTCTCGCCCTGGGCACCCACGAATCCAAC
CATGAACTCACCACGTATCGTCCCATCTTGCAAGTCCTGGCCATTCTCCTGCTCGGCTTCATGACAGCCGCATAC
GTCGGCAGACGAGGGAAGCCCAGTCTACCGCCCGGTCCCAGACCTCTGCCCCTGGTGGGCAATCTTCGCGACATG
CCGCCGAAAGGAGCGCTGCTACACGAGCACTGGCTTAAACACAAGGAGCTGTACGGGCCCGTCACCTCCGTCACA
GTCCTGGGCCAGACCGTCATCGTCCTTCACGACAGGGCGGCTGCCAACTACATACTGGAGACCAACTCGATCAAG
ACGGCCAACCGGGCATGCTTCAGCCACGCTTCGGTGGCGGTTGGGGCCACCAAGCTGTTCGTCATGGGGAATGAC
GATGAGCGTCAGCGGAAGTATCGGAAGCTGCTGCAGCATGAGATTGGCTCGGCGACGGCCATGGTCAAGTATCAT
GCCCTTCTGGAGGATGAAGCCGATAGGTTGCTTGTGGCGATGCTGCAGGATCCATCGCGGGTGTTTGAGTCGATC
AGAACCATGGCCAACGCCAACATCATGGGCATCGCATACGGCTACCAGATTGAGAGAAACAAGGCAGACCCCCTA
CTGGAACTCTTCGAAAGCGTGCCTACCATCGTCGAAGAGTCGGTATCCCCCTTCGCTTCGCCAGTTGACTACCTG
CCATGGCTCCAACACCTCCCCAACTGGTTCCCCGGAACGGGATACCGACAAAAGTTCAAAGCCAGGGCCCATAGC
CTGCTGCAGTCCATCGACCAGCCCTTCCTCTTCACTCGGCAGCAGATGAACCAGGGCATCAACCAGCCGTCCGTC
CTGTCGAATCTCATCGCCAGATCCGGTCGTCCCAACGGCAGCAATGACTTCGACTTGACCCCTGATCAGCAAGAC
TCCATCAAGTGGATGTTCGGAAGCCTCCACGGCGCAGGATCCGATACCACGTCGTCGGCGGTAGCCTCCTTCATC
ATCGCCATGATGCTCTTCCCGGACGTACAGCGGAAAGCTCAGCAGGAGATCGACCGGGTAGTTGGTCCCCATCGG
CTGCCCAACCTCGAGGACCGCGCCAACCTGCCCTACATCCAGGCCGTAATCAAGGAGCTTGGCCGATGGTATACC
ATTGTGCCCATGGGCTTCTTCCACACAGTCACCGAGGATCTCCTCTACGACGGCTACCTCATCCCCAAGGGCGCC
CACGTGCTCCCCGCCGCCTGGGGGATGAACCACGACGCAAGCGTCTACAAGGACCCGGACGAATTCAAGCCAGAG
CGCTTCTCCCAAGGCGAGCCCGAACCAAGATCATCCGTCTTCGGCTACGGCCGCAGGGTGTGTCCCGGCCAAAAG
ATGGGTGAGGCCTCCCTCTTCTGCGCCGTCTCCAAGATACTGGCCGTCTTCAACATCAGCAAGTCGCTCGGCCAC
GACGGGCAGCCCCTTGACGTCAAGCCCGAGATGGAGCTTGGATTCATATCTCGTCCAAAGCCTGTGCCTTGTGTT
ATCGAGCCTAGGAGTGAGAAGCATGAGCTTCTGGTTAGGGGCTTGCGGACTTGA
Gene >Ophun1|84
ATGGACTCCGCCACCAGTCCCAGCGTCGGCATCTTGAACACGACGTGTCTCGCCCTGGGCACCCACGAATCCAAC
CATGAACTCACCACGTATCGTCCCATCTTGCAAGTCCTGGCCATTCTCCTGCTCGGCTTCATGACAGCCGCATAC
GTCGGCAGACGAGGGAAGCCCAGTCTACCGCCCGGTCCCAGACCTCTGCCCCTGGTGGGCAATCTTCGCGACATG
CCGCCGAAAGGAGCGCTGCTACACGAGCACTGGCTTAAACACAAGGAGCTGTACGGGCCCGTCACCTCCGTCACA
GTCCTGGGCCAGACCGTCATCGTCCTTCACGACAGGGCGGCTGCCAACTACATACTGGAGACCAACTCGATCAAG
ACGGCCAACCGGGCATGCTTCAGCCACGCTTCGGTGGCGGTTGGGGCCACCAAGCTGTTCGTCATGGGGAATGAC
GATGAGCGTCAGCGGAAGTATCGGAAGCTGCTGCAGCATGAGATTGGCTCGGCGACGGCCATGGTCAAGTATCAT
GCCCTTCTGGAGGATGAAGCCGATAGGTTGCTTGTGGCGATGCTGCAGGATCCATCGCGGGTGTTTGAGTCGATC
AGAACGTAAGAGTTCAGGAACCAAACCATACGAACGGAATCGGTTCCATGAGGCTAATCTTGCTCTTTACATGAC
AGCATGGCCAACGCCAACATCATGGGCATCGCATACGGCTACCAGATTGAGAGAAACAAGGCAGACCCCCTACTG
GAACTCTTCGAAAGCGTGCCTACCATCGTCGAAGAGTCGGTATCCCCCTTCGCTTCGCCAGTTGACTACCTGCCA
TGGCTCCAACACCTCCCCAACTGGTTCCCCGGAACGGGATACCGACAAAAGTTCAAAGCCAGGGCCCATAGCCTG
CTGCAGTCCATCGACCAGCCCTTCCTCTTCACTCGGCAGCAGATGAACCAGGGCATCAACCAGCCGTCCGTCCTG
TCGAATCTCATCGCCAGATCCGGTCGTCCCAACGGCAGCAATGACTTCGACTTGACCCCTGATCAGCAAGACTCC
ATCAAGTGGATGTTCGGAAGCCTCCACGGCGCAGGATCCGATACCACGTCGTCGGCGGTAGCCTCCTTCATCATC
GCCATGATGCTCTTCCCGGACGTACAGCGGAAAGCTCAGCAGGAGATCGACCGGGTAGTTGGTCCCCATCGGCTG
CCCAACCTCGAGGACCGCGCCAACCTGCCCTACATCCAGGCCGTAATCAAGGAGCTTGGCCGATGGTATACCATT
GTGCCCATGGGCTTCTTCCACACAGTCACCGAGGATCTCCTCTACGACGGCTACCTCATCCCCAAGGGCGCCCAC
GTGCTCCCCGCCGCCTGGGGGATGAACCACGACGCAAGCGTCTACAAGGACCCGGACGAATTCAAGCCAGAGCGC
TTCTCCCAAGGCGAGCCCGAACCAAGATCATCCGTCTTCGGCTACGGCCGCAGGGTGTGTCCCGGCCAAAAGATG
GGTGAGGCCTCCCTCTTCTGCGCCGTCTCCAAGATACTGGCCGTCTTCAACATCAGCAAGTCGCTCGGCCACGAC
GGGCAGCCCCTTGACGTCAAGCCCGAGATGGAGCTTGGATTCATATCTCGTCCAAAGCCTGTGCCTTGTGTTATC
GAGCCTAGGAGTGAGAAGCATGAGCTTCTGGTTAGGGGCTTGCGGACTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail