Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|833
Gene name
LocationContig_13:10840..12281
Strand+
Gene length (bp)1441
Transcript length (bp)1377
Coding sequence length (bp)1377
Protein length (aa) 459

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03835 Rad4 Rad4 transglutaminase-like domain 3.7E-14 280 388
PF01841 Transglut_core Transglutaminase-like superfamily 2.0E-10 216 299

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8J2R3|PNG1_GIBMO Protein PNG1 OS=Gibberella moniliformis GN=PNG1 PE=3 SV=1 12 455 0.0E+00
sp|Q4IR87|PNG1_GIBZE Protein PNG1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PNG1 PE=3 SV=1 19 455 0.0E+00
sp|Q4WHW1|PNG1_ASPFU Protein png1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=png1 PE=3 SV=1 84 447 6.0E-162
sp|Q2UPS5|PNG1_ASPOR Protein png1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=png1 PE=3 SV=1 87 446 4.0E-157
sp|Q5B6P3|PNG1_EMENI Protein PNG1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=png1 PE=3 SV=1 89 424 4.0E-155
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8J2R3|PNG1_GIBMO Protein PNG1 OS=Gibberella moniliformis GN=PNG1 PE=3 SV=1 12 455 0.0E+00
sp|Q4IR87|PNG1_GIBZE Protein PNG1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PNG1 PE=3 SV=1 19 455 0.0E+00
sp|Q4WHW1|PNG1_ASPFU Protein png1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=png1 PE=3 SV=1 84 447 6.0E-162
sp|Q2UPS5|PNG1_ASPOR Protein png1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=png1 PE=3 SV=1 87 446 4.0E-157
sp|Q5B6P3|PNG1_EMENI Protein PNG1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=png1 PE=3 SV=1 89 424 4.0E-155
sp|Q7SI01|PNG1_NEUCR Protein png-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=un-7 PE=3 SV=2 93 399 7.0E-121
sp|O74739|PNG1_SCHPO Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=png1 PE=2 SV=2 109 410 3.0E-88
sp|Q6CAX5|PNG1_YARLI Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PNG1 PE=3 SV=1 81 391 5.0E-81
sp|Q02890|PNG1_YEAST Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PNG1 PE=1 SV=1 121 430 2.0E-65
sp|Q7F0R1|PNG1_ORYSJ Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Oryza sativa subsp. japonica GN=PNG1 PE=2 SV=1 123 416 1.0E-58
sp|Q503I8|NGLY1_DANRE Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Danio rerio GN=ngly1 PE=2 SV=1 123 377 3.0E-56
sp|Q75D29|PNG1_ASHGO Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PNG1 PE=3 SV=1 123 430 4.0E-56
sp|Q6FRU8|PNG1_CANGA Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PNG1 PE=3 SV=1 91 389 3.0E-55
sp|Q9FGY9|PNG1_ARATH Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Arabidopsis thaliana GN=PNG1 PE=2 SV=1 123 388 6.0E-54
sp|Q6CLZ6|PNG1_KLULA Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PNG1 PE=3 SV=1 122 384 6.0E-53
sp|Q9JI78|NGLY1_MOUSE Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Mus musculus GN=Ngly1 PE=1 SV=2 91 377 1.0E-52
sp|Q5XI55|NGLY1_RAT Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Rattus norvegicus GN=Ngly1 PE=2 SV=2 95 377 1.0E-50
sp|Q6BNI6|PNG1_DEBHA Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PNG1 PE=3 SV=2 103 341 1.0E-50
sp|Q96IV0|NGLY1_HUMAN Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Homo sapiens GN=NGLY1 PE=1 SV=1 123 366 1.0E-49
sp|Q4R6F3|NGLY1_MACFA Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Macaca fascicularis GN=NGLY1 PE=2 SV=1 54 366 1.0E-49
sp|Q5WNE3|NGLY1_CAEBR Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Caenorhabditis briggsae GN=png-1 PE=3 SV=1 173 376 3.0E-48
sp|Q5ZJM3|NGLY1_CHICK Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Gallus gallus GN=NGLY1 PE=2 SV=1 44 377 2.0E-46
sp|Q9TW67|NGLY1_CAEEL Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Caenorhabditis elegans GN=png-1 PE=1 SV=1 90 341 4.0E-46
sp|Q59Q38|PNG1_CANAL Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PNG1 PE=3 SV=1 107 337 3.0E-44
sp|Q7KRR5|NGLY1_DROME Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Drosophila melanogaster GN=Pngl PE=1 SV=1 111 384 2.0E-42
sp|Q28YQ7|NGLY1_DROPS Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Drosophila pseudoobscura pseudoobscura GN=PNGase PE=3 SV=2 60 384 1.0E-41
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup785
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5361
Ophiocordyceps australis map64 (Brazil) OphauB2|7847
Ophiocordyceps camponoti-floridani Ophcf2|02387
Ophiocordyceps camponoti-rufipedis Ophun1|833 (this protein)
Ophiocordyceps kimflemingae Ophio5|1144
Ophiocordyceps kimflemingae Ophio5|1955
Ophiocordyceps subramaniannii Hirsu2|3041

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|833
MAGRGIPPSPDQASSQARHGDEWAHDLRVRFEGLLRDKRMTDLRSSPRHLSPGLISRASSANLYGHAPVDHGRPA
TSHGQPTPPSYSCLRHLPKIPTPPAVSDKDSQKFRNLLISLSLTPTKYENPGLLDEALQTIPLDRIYSEAEEESQ
VLQAEAESMGDGRRPEWGYQDCVIRALLRWFKRSFFTWVNNPPCPVCLSPTFAHGMTAPTPEESACGALRVELYR
CSAHGCGAFERFPRYGDVWRLLQTRRGRVGEWANCFSMLCRAVGGRVRWVWNAEDHVWTEVYSEHRQRWVHVDAC
EESWDNPRLYSEGWGKKMSYCIAFSIEGATDVTRRYVRKSEFANERSRCPEEVLLYVMQEIKGLRRATMRKEERF
RLEKEDGREDQELRGYVVASIAQAVTDLVPGSSGSSPTRRSEAADVKVPAEQPGRQPTSAERLAAQQQARGRQPQ
PPRDPGRG*
Coding >Ophun1|833
ATGGCGGGACGAGGCATCCCTCCCAGCCCCGACCAAGCGTCCTCCCAGGCGCGCCATGGTGACGAGTGGGCTCAC
GACCTGCGTGTTCGCTTCGAGGGCCTGTTGCGTGACAAGCGCATGACAGACCTCCGATCTAGCCCTCGCCATCTC
TCTCCCGGCTTGATAAGCCGAGCTTCGAGCGCCAATCTGTACGGCCACGCCCCCGTCGATCATGGTCGTCCCGCC
ACGTCTCACGGCCAGCCGACGCCTCCGTCCTACTCGTGCCTCCGCCATCTGCCAAAGATTCCCACTCCTCCTGCC
GTCTCCGACAAGGACTCACAGAAATTCCGCAACCTCCTCATCAGCCTGTCTCTGACGCCCACCAAGTACGAGAAC
CCCGGCTTGCTGGATGAAGCCCTCCAGACCATACCCCTCGACCGCATCTACAGCGAAGCCGAGGAAGAGAGCCAG
GTGCTTCAGGCCGAGGCCGAGAGTATGGGCGACGGTCGCCGACCCGAGTGGGGATATCAGGACTGCGTCATCAGG
GCTCTTCTCCGCTGGTTCAAACGATCCTTCTTCACCTGGGTAAACAACCCGCCCTGCCCCGTCTGCCTGTCACCG
ACGTTTGCGCACGGCATGACGGCGCCGACGCCGGAAGAGAGCGCGTGCGGTGCCCTCCGAGTCGAGCTCTACCGC
TGCTCCGCCCACGGCTGCGGCGCGTTTGAGCGCTTCCCGCGCTATGGCGATGTGTGGCGACTGTTACAGACGCGC
AGAGGTCGGGTCGGAGAGTGGGCCAACTGCTTCAGCATGCTTTGCCGCGCTGTCGGCGGACGCGTGCGCTGGGTG
TGGAACGCCGAGGATCACGTCTGGACCGAGGTCTATTCCGAGCACCGACAGCGATGGGTCCACGTCGACGCCTGC
GAGGAGTCTTGGGACAACCCGCGCCTCTACAGCGAGGGATGGGGCAAGAAGATGTCCTACTGCATCGCCTTTTCT
ATCGAGGGGGCCACCGACGTGACGAGACGCTACGTGCGCAAAAGCGAGTTCGCCAACGAGCGCAGCCGATGCCCG
GAAGAGGTGCTGCTGTACGTCATGCAGGAGATCAAGGGCCTCCGCCGCGCCACGATGCGCAAGGAAGAGCGCTTC
CGTCTCGAGAAGGAGGACGGACGAGAGGATCAGGAGTTGCGGGGATACGTTGTCGCGTCCATCGCGCAAGCCGTG
ACGGACCTGGTTCCGGGCTCCTCGGGCTCGTCTCCCACCCGCCGCTCGGAGGCGGCCGACGTCAAGGTCCCCGCC
GAGCAGCCGGGCCGGCAGCCGACATCGGCCGAGCGGCTGGCGGCCCAGCAGCAGGCACGAGGTCGCCAGCCTCAG
CCGCCGCGTGACCCAGGCCGCGGCTGA
Transcript >Ophun1|833
ATGGCGGGACGAGGCATCCCTCCCAGCCCCGACCAAGCGTCCTCCCAGGCGCGCCATGGTGACGAGTGGGCTCAC
GACCTGCGTGTTCGCTTCGAGGGCCTGTTGCGTGACAAGCGCATGACAGACCTCCGATCTAGCCCTCGCCATCTC
TCTCCCGGCTTGATAAGCCGAGCTTCGAGCGCCAATCTGTACGGCCACGCCCCCGTCGATCATGGTCGTCCCGCC
ACGTCTCACGGCCAGCCGACGCCTCCGTCCTACTCGTGCCTCCGCCATCTGCCAAAGATTCCCACTCCTCCTGCC
GTCTCCGACAAGGACTCACAGAAATTCCGCAACCTCCTCATCAGCCTGTCTCTGACGCCCACCAAGTACGAGAAC
CCCGGCTTGCTGGATGAAGCCCTCCAGACCATACCCCTCGACCGCATCTACAGCGAAGCCGAGGAAGAGAGCCAG
GTGCTTCAGGCCGAGGCCGAGAGTATGGGCGACGGTCGCCGACCCGAGTGGGGATATCAGGACTGCGTCATCAGG
GCTCTTCTCCGCTGGTTCAAACGATCCTTCTTCACCTGGGTAAACAACCCGCCCTGCCCCGTCTGCCTGTCACCG
ACGTTTGCGCACGGCATGACGGCGCCGACGCCGGAAGAGAGCGCGTGCGGTGCCCTCCGAGTCGAGCTCTACCGC
TGCTCCGCCCACGGCTGCGGCGCGTTTGAGCGCTTCCCGCGCTATGGCGATGTGTGGCGACTGTTACAGACGCGC
AGAGGTCGGGTCGGAGAGTGGGCCAACTGCTTCAGCATGCTTTGCCGCGCTGTCGGCGGACGCGTGCGCTGGGTG
TGGAACGCCGAGGATCACGTCTGGACCGAGGTCTATTCCGAGCACCGACAGCGATGGGTCCACGTCGACGCCTGC
GAGGAGTCTTGGGACAACCCGCGCCTCTACAGCGAGGGATGGGGCAAGAAGATGTCCTACTGCATCGCCTTTTCT
ATCGAGGGGGCCACCGACGTGACGAGACGCTACGTGCGCAAAAGCGAGTTCGCCAACGAGCGCAGCCGATGCCCG
GAAGAGGTGCTGCTGTACGTCATGCAGGAGATCAAGGGCCTCCGCCGCGCCACGATGCGCAAGGAAGAGCGCTTC
CGTCTCGAGAAGGAGGACGGACGAGAGGATCAGGAGTTGCGGGGATACGTTGTCGCGTCCATCGCGCAAGCCGTG
ACGGACCTGGTTCCGGGCTCCTCGGGCTCGTCTCCCACCCGCCGCTCGGAGGCGGCCGACGTCAAGGTCCCCGCC
GAGCAGCCGGGCCGGCAGCCGACATCGGCCGAGCGGCTGGCGGCCCAGCAGCAGGCACGAGGTCGCCAGCCTCAG
CCGCCGCGTGACCCAGGCCGCGGCTGA
Gene >Ophun1|833
ATGGCGGGACGAGGCATCCCTCCCAGCCCCGACCAAGCGTCCTCCCAGGCGCGCCATGGTGACGAGTGGGCTCAC
GACCTGCGTGTTCGCTTCGAGGGCCTGTTGCGTGACAAGCGCATGACAGACCTCCGATCTAGCCCTCGCCATCTC
TCTCCCGGCTTGATAAGCCGAGCTTCGAGCGCCAATCTGTACGGCCACGCCCCCGTCGATCATGGTCGTCCCGCC
ACGTCTCACGGCCAGCCGACGCCTCCGTCCTACTCGTGCCTCCGCCATCTGCCAAAGATTCCCACTCCTCCTGCC
GTCTCCGACAAGGACTCACAGAAATTCCGCAACCTCCTCATCAGCCTGTCTCTGACGCCCACCAAGTACGAGAAC
CCCGGCTTGCTGGATGAAGCCCTCCAGACCATACCCCTCGACCGCATCTACAGCGAAGCCGAGGAAGAGAGCCAG
GTGCTTCAGGCCGAGGCCGAGAGTATGGGCGACGGTCGCCGACCCGAGTGGGGATATCAGGACTGCGTCATCAGG
GCTCTTCTCCGGTACGCTGCCCCTGTCGTTTCCAGTTGCATTGGAGCCTTGACTGATCTCTCTTGTTCTTCGTAG
CTGGTTCAAACGATCCTTCTTCACCTGGGTAAACAACCCGCCCTGCCCCGTCTGCCTGTCACCGACGTTTGCGCA
CGGCATGACGGCGCCGACGCCGGAAGAGAGCGCGTGCGGTGCCCTCCGAGTCGAGCTCTACCGCTGCTCCGCCCA
CGGCTGCGGCGCGTTTGAGCGCTTCCCGCGCTATGGCGATGTGTGGCGACTGTTACAGACGCGCAGAGGTCGGGT
CGGAGAGTGGGCCAACTGCTTCAGCATGCTTTGCCGCGCTGTCGGCGGACGCGTGCGCTGGGTGTGGAACGCCGA
GGATCACGTCTGGACCGAGGTCTATTCCGAGCACCGACAGCGATGGGTCCACGTCGACGCCTGCGAGGAGTCTTG
GGACAACCCGCGCCTCTACAGCGAGGGATGGGGCAAGAAGATGTCCTACTGCATCGCCTTTTCTATCGAGGGGGC
CACCGACGTGACGAGACGCTACGTGCGCAAAAGCGAGTTCGCCAACGAGCGCAGCCGATGCCCGGAAGAGGTGCT
GCTGTACGTCATGCAGGAGATCAAGGGCCTCCGCCGCGCCACGATGCGCAAGGAAGAGCGCTTCCGTCTCGAGAA
GGAGGACGGACGAGAGGATCAGGAGTTGCGGGGATACGTTGTCGCGTCCATCGCGCAAGCCGTGACGGACCTGGT
TCCGGGCTCCTCGGGCTCGTCTCCCACCCGCCGCTCGGAGGCGGCCGACGTCAAGGTCCCCGCCGAGCAGCCGGG
CCGGCAGCCGACATCGGCCGAGCGGCTGGCGGCCCAGCAGCAGGCACGAGGTCGCCAGCCTCAGCCGCCGCGTGA
CCCAGGCCGCGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail