Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|831
Gene name
LocationContig_13:4607..6094
Strand-
Gene length (bp)1487
Transcript length (bp)1437
Coding sequence length (bp)1437
Protein length (aa) 479

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04095 NAPRTase Nicotinate phosphoribosyltransferase (NAPRTase) family 1.4E-42 179 456
PF17767 NAPRTase_N Nicotinate phosphoribosyltransferase (NAPRTase) N-terminal domain 1.1E-39 17 145

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P39683|NPT1_YEAST Nicotinate phosphoribosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NPT1 PE=1 SV=3 10 470 9.0E-120
sp|Q9UTK3|NPT1_SCHPO Probable nicotinate phosphoribosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1486.06 PE=3 SV=1 12 454 3.0E-116
sp|Q8PSJ3|PNCB_METMA Nicotinate phosphoribosyltransferase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=pncB PE=3 SV=1 13 447 2.0E-79
sp|Q8TMW6|PNCB_METAC Nicotinate phosphoribosyltransferase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=pncB PE=3 SV=1 13 447 5.0E-76
sp|Q12Z05|PNCB_METBU Nicotinate phosphoribosyltransferase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=pncB PE=3 SV=1 13 447 2.0E-68
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P39683|NPT1_YEAST Nicotinate phosphoribosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NPT1 PE=1 SV=3 10 470 9.0E-120
sp|Q9UTK3|NPT1_SCHPO Probable nicotinate phosphoribosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1486.06 PE=3 SV=1 12 454 3.0E-116
sp|Q8PSJ3|PNCB_METMA Nicotinate phosphoribosyltransferase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=pncB PE=3 SV=1 13 447 2.0E-79
sp|Q8TMW6|PNCB_METAC Nicotinate phosphoribosyltransferase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=pncB PE=3 SV=1 13 447 5.0E-76
sp|Q12Z05|PNCB_METBU Nicotinate phosphoribosyltransferase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=pncB PE=3 SV=1 13 447 2.0E-68
sp|Q1QZ10|PNCB_CHRSD Nicotinate phosphoribosyltransferase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=pncB PE=3 SV=1 15 459 3.0E-67
sp|B4EVC0|PNCB_PROMH Nicotinate phosphoribosyltransferase OS=Proteus mirabilis (strain HI4320) GN=pncB PE=3 SV=1 9 421 9.0E-59
sp|P18133|PNCB_ECOLI Nicotinate phosphoribosyltransferase OS=Escherichia coli (strain K12) GN=pncB PE=1 SV=3 9 421 3.0E-58
sp|B1X8N5|PNCB_ECODH Nicotinate phosphoribosyltransferase OS=Escherichia coli (strain K12 / DH10B) GN=pncB PE=3 SV=1 9 421 3.0E-58
sp|C4ZQ57|PNCB_ECOBW Nicotinate phosphoribosyltransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=pncB PE=3 SV=1 9 421 3.0E-58
sp|B1LJT2|PNCB_ECOSM Nicotinate phosphoribosyltransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=pncB PE=3 SV=1 9 421 3.0E-58
sp|B7NM43|PNCB_ECO7I Nicotinate phosphoribosyltransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=pncB PE=3 SV=1 9 421 3.0E-58
sp|Q3Z3I9|PNCB_SHISS Nicotinate phosphoribosyltransferase OS=Shigella sonnei (strain Ss046) GN=pncB PE=3 SV=1 9 421 4.0E-58
sp|Q83LN3|PNCB_SHIFL Nicotinate phosphoribosyltransferase OS=Shigella flexneri GN=pncB PE=3 SV=4 9 421 4.0E-58
sp|Q31YR6|PNCB_SHIBS Nicotinate phosphoribosyltransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=pncB PE=3 SV=1 9 421 4.0E-58
sp|B6I904|PNCB_ECOSE Nicotinate phosphoribosyltransferase OS=Escherichia coli (strain SE11) GN=pncB PE=3 SV=1 9 421 4.0E-58
sp|A7ZYN4|PNCB_ECOHS Nicotinate phosphoribosyltransferase OS=Escherichia coli O9:H4 (strain HS) GN=pncB PE=3 SV=1 9 421 4.0E-58
sp|B7M860|PNCB_ECO8A Nicotinate phosphoribosyltransferase OS=Escherichia coli O8 (strain IAI1) GN=pncB PE=3 SV=1 9 421 4.0E-58
sp|B7LE31|PNCB_ECO55 Nicotinate phosphoribosyltransferase OS=Escherichia coli (strain 55989 / EAEC) GN=pncB PE=3 SV=1 9 421 4.0E-58
sp|A7ZK22|PNCB_ECO24 Nicotinate phosphoribosyltransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=pncB PE=3 SV=1 9 421 4.0E-58
sp|B7MS49|PNCB_ECO81 Nicotinate phosphoribosyltransferase OS=Escherichia coli O81 (strain ED1a) GN=pncB PE=3 SV=1 9 421 4.0E-58
sp|B7MHP0|PNCB_ECO45 Nicotinate phosphoribosyltransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=pncB PE=3 SV=1 9 421 4.0E-58
sp|Q8FJ98|PNCB_ECOL6 Nicotinate phosphoribosyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=pncB PE=3 SV=2 9 421 4.0E-58
sp|B7UN17|PNCB_ECO27 Nicotinate phosphoribosyltransferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=pncB PE=3 SV=1 9 421 4.0E-58
sp|C0QFM5|PNCB_DESAH Nicotinate phosphoribosyltransferase OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=pncB PE=3 SV=1 13 445 5.0E-58
sp|B7N398|PNCB_ECOLU Nicotinate phosphoribosyltransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=pncB PE=3 SV=1 9 421 6.0E-58
sp|B2TUE4|PNCB_SHIB3 Nicotinate phosphoribosyltransferase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=pncB PE=3 SV=1 9 421 8.0E-58
sp|Q32E52|PNCB_SHIDS Nicotinate phosphoribosyltransferase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=pncB PE=3 SV=1 9 415 1.0E-57
sp|A4W8V0|PNCB_ENT38 Nicotinate phosphoribosyltransferase OS=Enterobacter sp. (strain 638) GN=pncB PE=3 SV=1 9 421 3.0E-57
sp|A1W8S8|PNCB_ACISJ Nicotinate phosphoribosyltransferase OS=Acidovorax sp. (strain JS42) GN=pncB PE=3 SV=1 13 422 4.0E-57
sp|B9MHC7|PNCB_ACIET Nicotinate phosphoribosyltransferase OS=Acidovorax ebreus (strain TPSY) GN=pncB PE=3 SV=1 13 422 4.0E-57
sp|B5YT65|PNCB_ECO5E Nicotinate phosphoribosyltransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=pncB PE=3 SV=1 9 421 5.0E-57
sp|Q8XDE8|PNCB_ECO57 Nicotinate phosphoribosyltransferase OS=Escherichia coli O157:H7 GN=pncB PE=3 SV=3 9 421 5.0E-57
sp|Q6D454|PNCB_PECAS Nicotinate phosphoribosyltransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=pncB PE=3 SV=1 9 421 1.0E-56
sp|A8AIE5|PNCB_CITK8 Nicotinate phosphoribosyltransferase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=pncB PE=3 SV=1 9 421 2.0E-56
sp|Q7N621|PNCB_PHOLL Nicotinate phosphoribosyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=pncB PE=3 SV=1 9 421 8.0E-56
sp|B0RVE9|PNCB_XANCB Nicotinate phosphoribosyltransferase OS=Xanthomonas campestris pv. campestris (strain B100) GN=pncB PE=3 SV=1 13 421 8.0E-56
sp|A1WJL0|PNCB_VEREI Nicotinate phosphoribosyltransferase OS=Verminephrobacter eiseniae (strain EF01-2) GN=pncB PE=3 SV=1 13 421 2.0E-55
sp|Q8Z7Y9|PNCB_SALTI Nicotinate phosphoribosyltransferase OS=Salmonella typhi GN=pncB PE=3 SV=3 9 421 3.0E-55
sp|Q3BPD5|PNCB_XANC5 Nicotinate phosphoribosyltransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=pncB PE=3 SV=1 13 421 4.0E-55
sp|B4TRW6|PNCB_SALSV Nicotinate phosphoribosyltransferase OS=Salmonella schwarzengrund (strain CVM19633) GN=pncB PE=3 SV=1 9 421 4.0E-55
sp|B5BBM4|PNCB_SALPK Nicotinate phosphoribosyltransferase OS=Salmonella paratyphi A (strain AKU_12601) GN=pncB PE=3 SV=1 9 421 5.0E-55
sp|A9N6Y6|PNCB_SALPB Nicotinate phosphoribosyltransferase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=pncB PE=3 SV=1 9 421 5.0E-55
sp|Q5PGD8|PNCB_SALPA Nicotinate phosphoribosyltransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=pncB PE=3 SV=1 9 421 5.0E-55
sp|B4T172|PNCB_SALNS Nicotinate phosphoribosyltransferase OS=Salmonella newport (strain SL254) GN=pncB PE=3 SV=1 9 421 5.0E-55
sp|A9MHU8|PNCB_SALAR Nicotinate phosphoribosyltransferase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=pncB PE=3 SV=1 9 421 5.0E-55
sp|Q8PGU5|PNCB_XANAC Nicotinate phosphoribosyltransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=pncB PE=3 SV=1 13 421 6.0E-55
sp|B7LNU8|PNCB_ESCF3 Nicotinate phosphoribosyltransferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=pncB PE=3 SV=1 9 421 7.0E-55
sp|C6DFB8|PNCB_PECCP Nicotinate phosphoribosyltransferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=pncB PE=3 SV=1 9 421 8.0E-55
sp|Q57QZ3|PNCB_SALCH Nicotinate phosphoribosyltransferase OS=Salmonella choleraesuis (strain SC-B67) GN=pncB PE=3 SV=2 9 421 8.0E-55
sp|B4TDS5|PNCB_SALHS Nicotinate phosphoribosyltransferase OS=Salmonella heidelberg (strain SL476) GN=pncB PE=3 SV=1 9 421 9.0E-55
sp|C0PXX2|PNCB_SALPC Nicotinate phosphoribosyltransferase OS=Salmonella paratyphi C (strain RKS4594) GN=pncB PE=3 SV=1 9 421 1.0E-54
sp|B5R8M1|PNCB_SALG2 Nicotinate phosphoribosyltransferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=pncB PE=3 SV=1 9 421 1.0E-54
sp|B5QZD8|PNCB_SALEP Nicotinate phosphoribosyltransferase OS=Salmonella enteritidis PT4 (strain P125109) GN=pncB PE=3 SV=1 9 421 1.0E-54
sp|B5FQ81|PNCB_SALDC Nicotinate phosphoribosyltransferase OS=Salmonella dublin (strain CT_02021853) GN=pncB PE=3 SV=1 9 421 1.0E-54
sp|Q8PCP3|PNCB_XANCP Nicotinate phosphoribosyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=pncB PE=3 SV=1 13 421 1.0E-54
sp|Q4UQS8|PNCB_XANC8 Nicotinate phosphoribosyltransferase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=pncB PE=3 SV=1 13 421 1.0E-54
sp|B5F1U0|PNCB_SALA4 Nicotinate phosphoribosyltransferase OS=Salmonella agona (strain SL483) GN=pncB PE=3 SV=1 9 421 1.0E-54
sp|Q9HUP4|PNCB1_PSEAE Nicotinate phosphoribosyltransferase 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pncB1 PE=3 SV=1 13 421 3.0E-54
sp|A4XS60|PNCB_PSEMY Nicotinate phosphoribosyltransferase OS=Pseudomonas mendocina (strain ymp) GN=pncB PE=3 SV=1 13 421 4.0E-54
sp|P22253|PNCB_SALTY Nicotinate phosphoribosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pncB PE=1 SV=2 9 421 4.0E-54
sp|Q8Y0L2|PNCB_RALSO Nicotinate phosphoribosyltransferase OS=Ralstonia solanacearum (strain GMI1000) GN=pncB PE=3 SV=2 13 418 6.0E-54
sp|Q0BH38|PNCB_BURCM Nicotinate phosphoribosyltransferase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=pncB PE=3 SV=1 13 421 3.0E-53
sp|Q63S63|PNCB_BURPS Nicotinate phosphoribosyltransferase OS=Burkholderia pseudomallei (strain K96243) GN=pncB PE=3 SV=1 13 421 3.0E-53
sp|Q62LW1|PNCB_BURMA Nicotinate phosphoribosyltransferase OS=Burkholderia mallei (strain ATCC 23344) GN=pncB PE=3 SV=1 13 421 3.0E-53
sp|B1YVJ0|PNCB_BURA4 Nicotinate phosphoribosyltransferase OS=Burkholderia ambifaria (strain MC40-6) GN=pncB PE=3 SV=1 13 421 3.0E-53
sp|Q128P8|PNCB_POLSJ Nicotinate phosphoribosyltransferase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=pncB PE=3 SV=1 13 415 4.0E-53
sp|Q87JE4|PNCB_VIBPA Nicotinate phosphoribosyltransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=pncB PE=3 SV=1 13 415 5.0E-53
sp|Q66CG6|PNCB_YERPS Nicotinate phosphoribosyltransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=pncB PE=3 SV=1 9 421 7.0E-53
sp|Q8ZG93|PNCB_YERPE Nicotinate phosphoribosyltransferase OS=Yersinia pestis GN=pncB PE=1 SV=1 9 421 7.0E-53
sp|A7FJU4|PNCB_YERP3 Nicotinate phosphoribosyltransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=pncB PE=3 SV=1 9 421 7.0E-53
sp|Q9HW26|PNCB2_PSEAE Nicotinate phosphoribosyltransferase 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pncB2 PE=1 SV=1 13 421 7.0E-53
sp|B2VC92|PNCB_ERWT9 Nicotinate phosphoribosyltransferase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=pncB PE=3 SV=1 9 421 9.0E-53
sp|Q0K8J9|PNCB_CUPNH Nicotinate phosphoribosyltransferase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=pncB PE=3 SV=1 13 415 9.0E-53
sp|C3LUC2|PNCB_VIBCM Nicotinate phosphoribosyltransferase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=pncB PE=3 SV=1 9 415 1.0E-52
sp|Q9KN67|PNCB_VIBCH Nicotinate phosphoribosyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=pncB PE=1 SV=1 9 415 1.0E-52
sp|A5F1F1|PNCB_VIBC3 Nicotinate phosphoribosyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=pncB PE=3 SV=1 9 415 1.0E-52
sp|Q48NY1|PNCB_PSE14 Nicotinate phosphoribosyltransferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=pncB PE=3 SV=1 13 421 2.0E-52
sp|A1JMP2|PNCB_YERE8 Nicotinate phosphoribosyltransferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=pncB PE=3 SV=1 9 421 3.0E-52
sp|A0K5S6|PNCB_BURCH Nicotinate phosphoribosyltransferase OS=Burkholderia cenocepacia (strain HI2424) GN=pncB PE=3 SV=1 13 421 3.0E-52
sp|Q1BXX4|PNCB_BURCA Nicotinate phosphoribosyltransferase OS=Burkholderia cenocepacia (strain AU 1054) GN=pncB PE=3 SV=1 13 421 3.0E-52
sp|Q3KIW4|PNCB_PSEPF Nicotinate phosphoribosyltransferase OS=Pseudomonas fluorescens (strain Pf0-1) GN=pncB PE=3 SV=1 13 421 5.0E-52
sp|Q4ZYV7|PNCB_PSEU2 Nicotinate phosphoribosyltransferase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=pncB PE=3 SV=1 13 421 5.0E-52
sp|B1JY80|PNCB_BURCC Nicotinate phosphoribosyltransferase OS=Burkholderia cenocepacia (strain MC0-3) GN=pncB PE=3 SV=1 13 421 7.0E-52
sp|Q8DA38|PNCB_VIBVU Nicotinate phosphoribosyltransferase OS=Vibrio vulnificus (strain CMCP6) GN=pncB PE=3 SV=1 10 415 8.0E-52
sp|Q87VL5|PNCB_PSESM Nicotinate phosphoribosyltransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=pncB PE=3 SV=1 13 421 1.0E-51
sp|A7MEW8|PNCB_CROS8 Nicotinate phosphoribosyltransferase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=pncB PE=3 SV=1 9 421 1.0E-51
sp|Q7MK41|PNCB_VIBVY Nicotinate phosphoribosyltransferase OS=Vibrio vulnificus (strain YJ016) GN=pncB PE=3 SV=1 10 415 3.0E-51
sp|B2U8V2|PNCB_RALPJ Nicotinate phosphoribosyltransferase OS=Ralstonia pickettii (strain 12J) GN=pncB PE=3 SV=1 13 418 3.0E-51
sp|A3MA25|PNCB_ACIBT Nicotinate phosphoribosyltransferase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=pncB PE=3 SV=2 9 421 6.0E-51
sp|B2I1P1|PNCB_ACIBC Nicotinate phosphoribosyltransferase OS=Acinetobacter baumannii (strain ACICU) GN=pncB PE=3 SV=1 9 421 7.0E-51
sp|A7N4I5|PNCB_VIBCB Nicotinate phosphoribosyltransferase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=pncB PE=3 SV=1 13 415 2.0E-50
sp|A4JCM8|PNCB_BURVG Nicotinate phosphoribosyltransferase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=pncB PE=3 SV=1 13 421 6.0E-50
sp|Q87EC4|PNCB_XYLFT Nicotinate phosphoribosyltransferase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=pncB PE=3 SV=1 13 421 8.0E-50
sp|Q6F6W1|PNCB_ACIAD Nicotinate phosphoribosyltransferase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pncB PE=3 SV=1 7 421 2.0E-49
sp|Q9PED1|PNCB_XYLFA Nicotinate phosphoribosyltransferase OS=Xylella fastidiosa (strain 9a5c) GN=pncB PE=3 SV=1 13 421 4.0E-49
sp|Q2NU84|PNCB_SODGM Nicotinate phosphoribosyltransferase OS=Sodalis glossinidius (strain morsitans) GN=pncB PE=3 SV=1 5 421 7.0E-49
sp|C5BD56|PNCB_EDWI9 Nicotinate phosphoribosyltransferase OS=Edwardsiella ictaluri (strain 93-146) GN=pncB PE=3 SV=1 9 421 2.0E-48
sp|B4RL23|PNCB_NEIG2 Nicotinate phosphoribosyltransferase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=pncB PE=3 SV=1 13 421 3.0E-48
sp|Q5F836|PNCB_NEIG1 Nicotinate phosphoribosyltransferase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=pncB PE=3 SV=2 13 421 3.0E-48
sp|Q8K9I6|PNCB_BUCAP Nicotinate phosphoribosyltransferase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=pncB PE=3 SV=1 13 421 3.0E-48
sp|Q9JYM9|PNCB_NEIMB Nicotinate phosphoribosyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=pncB PE=3 SV=1 13 421 3.0E-48
sp|Q9JTM8|PNCB_NEIMA Nicotinate phosphoribosyltransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=pncB PE=3 SV=2 13 421 7.0E-48
sp|B8D7P8|PNCB_BUCAT Nicotinate phosphoribosyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=pncB PE=3 SV=1 13 421 1.0E-47
sp|P57442|PNCB_BUCAI Nicotinate phosphoribosyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=pncB PE=3 SV=1 13 421 1.0E-47
sp|B8D9E6|PNCB_BUCA5 Nicotinate phosphoribosyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=pncB PE=3 SV=1 13 421 1.0E-47
sp|A9M0T9|PNCB_NEIM0 Nicotinate phosphoribosyltransferase OS=Neisseria meningitidis serogroup C (strain 053442) GN=pncB PE=3 SV=1 13 421 3.0E-47
sp|A9IIC5|PNCB_BORPD Nicotinate phosphoribosyltransferase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=pncB PE=3 SV=1 13 418 8.0E-47
sp|A8GCJ6|PNCB_SERP5 Nicotinate phosphoribosyltransferase OS=Serratia proteamaculans (strain 568) GN=pncB PE=3 SV=1 9 421 4.0E-46
sp|Q7NSK2|PNCB_CHRVO Nicotinate phosphoribosyltransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=pncB PE=3 SV=1 9 421 3.0E-45
sp|Q7W5G3|PNCB_BORPA Nicotinate phosphoribosyltransferase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=pncB PE=3 SV=1 13 418 3.0E-45
sp|Q7VTF7|PNCB_BORPE Nicotinate phosphoribosyltransferase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=pncB PE=3 SV=1 13 418 4.0E-45
sp|Q7WCZ8|PNCB_BORBR Nicotinate phosphoribosyltransferase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=pncB PE=3 SV=1 13 418 4.0E-45
sp|Q6LRA6|PNCB_PHOPR Nicotinate phosphoribosyltransferase OS=Photobacterium profundum GN=pncB PE=3 SV=1 13 432 6.0E-44
sp|Q88DF7|PNCB_PSEPK Nicotinate phosphoribosyltransferase OS=Pseudomonas putida (strain KT2440) GN=pncB PE=3 SV=2 13 415 7.0E-43
sp|A5W9Q6|PNCB_PSEP1 Nicotinate phosphoribosyltransferase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=pncB PE=3 SV=1 13 415 7.0E-42
sp|A1SVJ9|PNCB_PSYIN Nicotinate phosphoribosyltransferase OS=Psychromonas ingrahamii (strain 37) GN=pncB PE=3 SV=1 13 421 1.0E-40
sp|B5ZWU4|PNCB_RHILW Nicotinate phosphoribosyltransferase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=pncB PE=3 SV=1 13 459 2.0E-40
sp|B0KKX3|PNCB_PSEPG Nicotinate phosphoribosyltransferase OS=Pseudomonas putida (strain GB-1) GN=pncB PE=3 SV=1 13 415 5.0E-40
sp|B9J6S5|PNCB_AGRRK Nicotinate phosphoribosyltransferase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=pncB PE=3 SV=1 13 459 6.0E-40
sp|Q2KDT0|PNCB_RHIEC Nicotinate phosphoribosyltransferase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=pncB PE=3 SV=1 13 459 6.0E-40
sp|C3MFW1|PNCB_RHISN Nicotinate phosphoribosyltransferase OS=Rhizobium sp. (strain NGR234) GN=pncB PE=3 SV=1 13 458 1.0E-39
sp|B3PXL5|PNCB_RHIE6 Nicotinate phosphoribosyltransferase OS=Rhizobium etli (strain CIAT 652) GN=pncB PE=3 SV=1 13 459 3.0E-39
sp|A4YK54|PNCB_BRASO Nicotinate phosphoribosyltransferase OS=Bradyrhizobium sp. (strain ORS278) GN=pncB PE=3 SV=1 13 455 4.0E-39
sp|B9JYR4|PNCB_AGRVS Nicotinate phosphoribosyltransferase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=pncB PE=3 SV=1 13 459 5.0E-39
sp|A6U5X9|PNCB_SINMW Nicotinate phosphoribosyltransferase OS=Sinorhizobium medicae (strain WSM419) GN=pncB PE=3 SV=1 13 458 5.0E-39
sp|Q92S49|PNCB_RHIME Nicotinate phosphoribosyltransferase OS=Rhizobium meliloti (strain 1021) GN=pncB PE=3 SV=1 13 458 5.0E-39
sp|Q6G5H6|PNCB_BARHE Nicotinate phosphoribosyltransferase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=pncB PE=3 SV=1 13 459 6.0E-39
sp|Q8UIS9|PNCB_AGRFC Nicotinate phosphoribosyltransferase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=pncB PE=1 SV=2 13 463 7.0E-39
sp|Q98D24|PNCB_RHILO Nicotinate phosphoribosyltransferase OS=Rhizobium loti (strain MAFF303099) GN=pncB PE=3 SV=1 13 459 2.0E-38
sp|A9ILN1|PNCB_BART1 Nicotinate phosphoribosyltransferase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=pncB PE=3 SV=1 13 459 2.0E-38
sp|Q6G0X7|PNCB_BARQU Nicotinate phosphoribosyltransferase OS=Bartonella quintana (strain Toulouse) GN=pncB PE=3 SV=1 13 458 7.0E-38
sp|A4G168|PNCB_HERAR Nicotinate phosphoribosyltransferase OS=Herminiimonas arsenicoxydans GN=pncB PE=3 SV=1 10 421 6.0E-37
sp|A5E8V7|PNCB_BRASB Nicotinate phosphoribosyltransferase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=pncB PE=3 SV=1 13 455 2.0E-36
sp|Q8G340|PNCB_BRUSU Nicotinate phosphoribosyltransferase OS=Brucella suis biovar 1 (strain 1330) GN=pncB PE=3 SV=1 13 459 3.0E-36
sp|B0CIM5|PNCB_BRUSI Nicotinate phosphoribosyltransferase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=pncB PE=3 SV=1 13 459 3.0E-36
sp|C0RGH3|PNCB_BRUMB Nicotinate phosphoribosyltransferase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=pncB PE=3 SV=1 13 459 3.0E-36
sp|Q57FQ9|PNCB_BRUAB Nicotinate phosphoribosyltransferase OS=Brucella abortus biovar 1 (strain 9-941) GN=pncB PE=3 SV=1 13 459 3.0E-36
sp|Q2YNV6|PNCB_BRUA2 Nicotinate phosphoribosyltransferase OS=Brucella abortus (strain 2308) GN=pncB PE=3 SV=1 13 459 3.0E-36
sp|B2S8A9|PNCB_BRUA1 Nicotinate phosphoribosyltransferase OS=Brucella abortus (strain S19) GN=pncB PE=3 SV=1 13 459 3.0E-36
sp|A9M757|PNCB_BRUC2 Nicotinate phosphoribosyltransferase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=pncB PE=3 SV=1 13 459 4.0E-36
sp|A1UUA2|PNCB_BARBK Nicotinate phosphoribosyltransferase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=pncB PE=3 SV=1 13 415 7.0E-36
sp|A6WV52|PNCB_OCHA4 Nicotinate phosphoribosyltransferase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=pncB PE=3 SV=1 13 459 1.0E-35
sp|Q1QI14|PNCB_NITHX Nicotinate phosphoribosyltransferase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=pncB PE=3 SV=1 13 455 4.0E-35
sp|Q8YEP2|PNCB_BRUME Nicotinate phosphoribosyltransferase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=pncB PE=3 SV=1 13 459 4.0E-35
sp|Q11HJ2|PNCB_CHESB Nicotinate phosphoribosyltransferase OS=Chelativorans sp. (strain BNC1) GN=pncB PE=3 SV=1 15 459 1.0E-34
sp|Q89SS3|PNCB_BRADU Nicotinate phosphoribosyltransferase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=pncB PE=3 SV=1 13 455 1.0E-34
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|831
MDSDNSSPSPVGIASILDTDLYKLTMQFAVFRFFKDVPVTYAFTNRTPDKRLSRAAFEWLDEQVEKLANVSLSED
EYAFLQSQCSYFATDYLEYLRDFRLRPSEEVSITFTPSAANSDVGDIDIQIKGSWSGTILYEIPLLALVSEAYFR
FMDTDWNYDGQEEQAYAKGIQLLEAGCLTSEFGTRRRRDYRTQALVLRGLVRASKEAAARGLPGKLVGTSNVHLA
MRFGLTPIGTVAHEWFMGTASIIDDYQKATEEALRHWIGCFGSSLTIALTDTFGTPEFLKAFSLPIRPVEGCAVP
DVFRKSDGAFKTYAELFDGVRQDSGDPAEYTKTMRSYYDEQGIKDKKKIIFSDSLNIERCLEYKSISEECGLQPS
FGVGTFLSNDFVRLSTGAKSTPLNIVIKLSSAAGRPAIKIRQALGEQSQWTGDLLTRSSDTVGKNTGDKDVVERV
KRELGYEERHWEEGDESTRWGKEEPARG*
Coding >Ophun1|831
ATGGACTCGGACAACTCATCACCCTCCCCCGTCGGGATTGCATCCATCCTCGACACCGACCTGTACAAGTTGACG
ATGCAATTTGCCGTCTTCCGGTTCTTCAAAGATGTGCCCGTCACCTACGCTTTCACAAACAGAACTCCCGACAAG
AGGCTCTCTCGCGCCGCTTTCGAGTGGCTTGACGAGCAGGTGGAGAAACTCGCCAACGTTTCTCTCTCCGAAGAC
GAGTACGCCTTTCTGCAATCACAATGCAGCTACTTCGCCACCGACTATCTCGAGTATCTGCGAGACTTCCGGCTG
CGGCCGAGCGAGGAGGTTTCCATAACGTTTACACCTAGTGCAGCCAACTCAGACGTAGGAGATATCGACATTCAA
ATAAAAGGATCCTGGTCCGGAACGATTCTCTACGAAATCCCGCTGCTTGCGCTCGTATCAGAAGCCTACTTTCGC
TTCATGGACACGGACTGGAACTACGACGGTCAGGAGGAACAGGCCTACGCCAAGGGTATACAGCTTCTGGAAGCG
GGCTGCCTTACATCCGAGTTTGGCACGCGCAGAAGACGCGACTATCGCACGCAGGCTCTCGTGCTGCGCGGTCTC
GTGAGGGCATCCAAGGAGGCCGCTGCGAGAGGCCTGCCAGGCAAACTTGTCGGCACAAGCAATGTGCACTTGGCC
ATGCGATTCGGCCTCACTCCCATCGGTACTGTGGCTCACGAATGGTTCATGGGGACAGCTTCCATCATCGACGAC
TACCAAAAGGCCACAGAGGAAGCCCTGCGGCACTGGATAGGTTGCTTTGGCTCCAGTCTTACCATTGCTTTGACC
GACACTTTCGGTACGCCCGAGTTCCTCAAGGCCTTTAGCCTGCCAATCCGTCCGGTAGAAGGCTGTGCTGTTCCG
GATGTCTTTCGCAAATCCGATGGCGCCTTCAAGACCTACGCTGAGCTCTTTGATGGGGTAAGGCAGGATTCGGGT
GATCCCGCCGAGTACACCAAGACGATGCGGTCGTACTACGATGAACAGGGCATCAAAGACAAGAAGAAGATTATC
TTTTCCGACTCGCTCAACATTGAGCGCTGTCTGGAGTATAAGAGTATCTCGGAAGAGTGCGGCCTACAGCCTAGT
TTTGGCGTGGGCACCTTTCTGTCAAATGATTTTGTCCGCCTCTCGACCGGGGCCAAGTCGACGCCGCTCAACATT
GTCATCAAGCTCAGTTCGGCTGCAGGTCGTCCGGCCATCAAGATCAGGCAAGCGCTGGGCGAACAGTCCCAATGG
ACTGGCGATTTGCTGACCAGAAGCAGTGACACCGTGGGGAAGAACACGGGAGACAAGGACGTCGTGGAAAGAGTC
AAGCGCGAGCTCGGCTACGAGGAGCGTCACTGGGAGGAGGGCGACGAGAGCACGAGATGGGGCAAGGAAGAGCCG
GCCAGAGGATAG
Transcript >Ophun1|831
ATGGACTCGGACAACTCATCACCCTCCCCCGTCGGGATTGCATCCATCCTCGACACCGACCTGTACAAGTTGACG
ATGCAATTTGCCGTCTTCCGGTTCTTCAAAGATGTGCCCGTCACCTACGCTTTCACAAACAGAACTCCCGACAAG
AGGCTCTCTCGCGCCGCTTTCGAGTGGCTTGACGAGCAGGTGGAGAAACTCGCCAACGTTTCTCTCTCCGAAGAC
GAGTACGCCTTTCTGCAATCACAATGCAGCTACTTCGCCACCGACTATCTCGAGTATCTGCGAGACTTCCGGCTG
CGGCCGAGCGAGGAGGTTTCCATAACGTTTACACCTAGTGCAGCCAACTCAGACGTAGGAGATATCGACATTCAA
ATAAAAGGATCCTGGTCCGGAACGATTCTCTACGAAATCCCGCTGCTTGCGCTCGTATCAGAAGCCTACTTTCGC
TTCATGGACACGGACTGGAACTACGACGGTCAGGAGGAACAGGCCTACGCCAAGGGTATACAGCTTCTGGAAGCG
GGCTGCCTTACATCCGAGTTTGGCACGCGCAGAAGACGCGACTATCGCACGCAGGCTCTCGTGCTGCGCGGTCTC
GTGAGGGCATCCAAGGAGGCCGCTGCGAGAGGCCTGCCAGGCAAACTTGTCGGCACAAGCAATGTGCACTTGGCC
ATGCGATTCGGCCTCACTCCCATCGGTACTGTGGCTCACGAATGGTTCATGGGGACAGCTTCCATCATCGACGAC
TACCAAAAGGCCACAGAGGAAGCCCTGCGGCACTGGATAGGTTGCTTTGGCTCCAGTCTTACCATTGCTTTGACC
GACACTTTCGGTACGCCCGAGTTCCTCAAGGCCTTTAGCCTGCCAATCCGTCCGGTAGAAGGCTGTGCTGTTCCG
GATGTCTTTCGCAAATCCGATGGCGCCTTCAAGACCTACGCTGAGCTCTTTGATGGGGTAAGGCAGGATTCGGGT
GATCCCGCCGAGTACACCAAGACGATGCGGTCGTACTACGATGAACAGGGCATCAAAGACAAGAAGAAGATTATC
TTTTCCGACTCGCTCAACATTGAGCGCTGTCTGGAGTATAAGAGTATCTCGGAAGAGTGCGGCCTACAGCCTAGT
TTTGGCGTGGGCACCTTTCTGTCAAATGATTTTGTCCGCCTCTCGACCGGGGCCAAGTCGACGCCGCTCAACATT
GTCATCAAGCTCAGTTCGGCTGCAGGTCGTCCGGCCATCAAGATCAGGCAAGCGCTGGGCGAACAGTCCCAATGG
ACTGGCGATTTGCTGACCAGAAGCAGTGACACCGTGGGGAAGAACACGGGAGACAAGGACGTCGTGGAAAGAGTC
AAGCGCGAGCTCGGCTACGAGGAGCGTCACTGGGAGGAGGGCGACGAGAGCACGAGATGGGGCAAGGAAGAGCCG
GCCAGAGGATAG
Gene >Ophun1|831
ATGGACTCGGACAACTCATCACCCTCCCCCGTCGGGATTGCATCCATCCTCGACACCGACCTGTACAAGTTGACG
ATGCAATTTGCCGTCTTCCGGTTCTTCAAAGATGTGCCCGTCACCTACGCTTTCACAAACAGAACTCCCGACAAG
AGGCTCTCTCGCGCCGCTTTCGAGTGGCTTGACGAGCAGGTGGAGAGTAAGTCGATGACGCACCTCTCTCTGGCT
GCGGCTGACGAATGCTCGTAGAACTCGCCAACGTTTCTCTCTCCGAAGACGAGTACGCCTTTCTGCAATCACAAT
GCAGCTACTTCGCCACCGACTATCTCGAGTATCTGCGAGACTTCCGGCTGCGGCCGAGCGAGGAGGTTTCCATAA
CGTTTACACCTAGTGCAGCCAACTCAGACGTAGGAGATATCGACATTCAAATAAAAGGATCCTGGTCCGGAACGA
TTCTCTACGAAATCCCGCTGCTTGCGCTCGTATCAGAAGCCTACTTTCGCTTCATGGACACGGACTGGAACTACG
ACGGTCAGGAGGAACAGGCCTACGCCAAGGGTATACAGCTTCTGGAAGCGGGCTGCCTTACATCCGAGTTTGGCA
CGCGCAGAAGACGCGACTATCGCACGCAGGCTCTCGTGCTGCGCGGTCTCGTGAGGGCATCCAAGGAGGCCGCTG
CGAGAGGCCTGCCAGGCAAACTTGTCGGCACAAGCAATGTGCACTTGGCCATGCGATTCGGCCTCACTCCCATCG
GTACTGTGGCTCACGAATGGTTCATGGGGACAGCTTCCATCATCGACGACTACCAAAAGGCCACAGAGGAAGCCC
TGCGGCACTGGATAGGTTGCTTTGGCTCCAGTCTTACCATTGCTTTGACCGACACTTTCGGTACGCCCGAGTTCC
TCAAGGCCTTTAGCCTGCCAATCCGTCCGGTAGAAGGCTGTGCTGTTCCGGATGTCTTTCGCAAATCCGATGGCG
CCTTCAAGACCTACGCTGAGCTCTTTGATGGGGTAAGGCAGGATTCGGGTGATCCCGCCGAGTACACCAAGACGA
TGCGGTCGTACTACGATGAACAGGGCATCAAAGACAAGAAGAAGATTATCTTTTCCGACTCGCTCAACATTGAGC
GCTGTCTGGAGTATAAGAGTATCTCGGAAGAGTGCGGCCTACAGCCTAGTTTTGGCGTGGGCACCTTTCTGTCAA
ATGATTTTGTCCGCCTCTCGACCGGGGCCAAGTCGACGCCGCTCAACATTGTCATCAAGCTCAGTTCGGCTGCAG
GTCGTCCGGCCATCAAGATCAGGCAAGCGCTGGGCGAACAGTCCCAATGGACTGGCGATTTGCTGACCAGAAGCA
GTGACACCGTGGGGAAGAACACGGGAGACAAGGACGTCGTGGAAAGAGTCAAGCGCGAGCTCGGCTACGAGGAGC
GTCACTGGGAGGAGGGCGACGAGAGCACGAGATGGGGCAAGGAAGAGCCGGCCAGAGGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail