Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|827
Gene name
LocationContig_1292:462..1962
Strand+
Gene length (bp)1500
Transcript length (bp)1500
Coding sequence length (bp)1500
Protein length (aa) 500

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09729 Gti1_Pac2 Gti1/Pac2 family 1.4E-36 3 84
PF09729 Gti1_Pac2 Gti1/Pac2 family 4.9E-05 126 156

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10294|PAC2_SCHPO cAMP-independent regulatory protein pac2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pac2 PE=2 SV=1 1 187 1.0E-61
sp|S0E3H0|WOR1_GIBF5 Global transcription regulator sge1 OS=Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831) GN=sge1 PE=2 SV=1 3 183 1.0E-30
sp|J9N5P9|WOR1_FUSO4 Global transcription regulator sge1 OS=Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936) GN=sge1 PE=2 SV=1 3 179 3.0E-27
sp|W7MPI5|WOR1_GIBM7 Global transcription regulator sge1 OS=Gibberella moniliformis (strain M3125 / FGSC 7600) GN=sge1 PE=3 SV=1 3 310 4.0E-25
sp|G2X740|WOR1_VERDV Global transcription regulator sge1 OS=Verticillium dahliae (strain VdLs.17 / ATCC MYA-4575 / FGSC 10137) GN=sge1 PE=3 SV=1 3 179 1.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10294|PAC2_SCHPO cAMP-independent regulatory protein pac2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pac2 PE=2 SV=1 1 187 1.0E-61
sp|S0E3H0|WOR1_GIBF5 Global transcription regulator sge1 OS=Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831) GN=sge1 PE=2 SV=1 3 183 1.0E-30
sp|J9N5P9|WOR1_FUSO4 Global transcription regulator sge1 OS=Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936) GN=sge1 PE=2 SV=1 3 179 3.0E-27
sp|W7MPI5|WOR1_GIBM7 Global transcription regulator sge1 OS=Gibberella moniliformis (strain M3125 / FGSC 7600) GN=sge1 PE=3 SV=1 3 310 4.0E-25
sp|G2X740|WOR1_VERDV Global transcription regulator sge1 OS=Verticillium dahliae (strain VdLs.17 / ATCC MYA-4575 / FGSC 10137) GN=sge1 PE=3 SV=1 3 179 1.0E-23
sp|I1S5P3|WOR1_GIBZE Global transcription regulator FGP1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FGP1 PE=3 SV=1 3 181 7.0E-22
sp|P40002|MIT1_YEAST Transcriptional regulator MIT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIT1 PE=1 SV=1 3 183 4.0E-21
sp|O14367|GTI1_SCHPO Gluconate transport inducer 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gti1 PE=4 SV=1 3 85 4.0E-21
sp|P38867|YHX7_YEAST Uncharacterized protein YHR177W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHR177W PE=1 SV=2 3 183 2.0E-18
sp|Q5AP80|WOR1_CANAL White-opaque regulator 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=WOR1 PE=1 SV=1 3 80 4.0E-14
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3007
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5974
Ophiocordyceps australis map64 (Brazil) OphauB2|2842
Ophiocordyceps camponoti-floridani Ophcf2|00563
Ophiocordyceps camponoti-rufipedis Ophun1|827 (this protein)
Ophiocordyceps kimflemingae Ophio5|1213
Ophiocordyceps subramaniannii Hirsu2|5181

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|827
METYHGYVRAPADAIKLFEACRQGLLPRVQRRLSEKERQSIRSGSVFVWDEREAGMRRWTDGKSWSASRVSGSFL
TYREMEGKRGGGFGGGGGAVGAGGNRRGGAGKTPDSGRGSDEDHDDGEPEGYRYKADGLMKQSFSLTTTTGQHLH
LISYYTRPHAGQPELPQPTNDPNLRGVVPPKGLYPESSMGESNQTPAMTRAPMQQPYMQQQQQQHQQPHHYPSYA
GYGWPPSPAATPPYGQYPYAAMNPHQQQQQQQQQHHQQQQQQQQQQHPLHHGQLQHGHPPPPPPPPPQSHAQHQH
HAQQLQQHAHHHHHHHHHQQHPPPPPPPPPHPHHHHSHHPHPPQHYAHYTHAPPPERNPLPPPVQTNKPPYPGPQ
HHAHHHPRLHDSPRQKKLQEAAQAVMCDPQLAAKSLPALNSVMATPPTRHLSVTPPRSSAATTTRPSLSALLHPT
PASSEPGSAKTCSSGSAGSSPRTAGVVLDKAGASEDVRALRMLDRKFCI*
Coding >Ophun1|827
ATGGAGACGTACCACGGCTACGTGCGGGCGCCCGCCGACGCCATCAAGCTGTTCGAGGCTTGTCGCCAAGGTCTC
TTGCCGCGTGTTCAGCGGAGGCTATCCGAGAAGGAGAGGCAGTCGATCCGCTCCGGCTCTGTTTTCGTCTGGGAC
GAGCGCGAAGCCGGCATGAGGCGCTGGACCGATGGCAAGTCGTGGAGCGCCAGCCGCGTCTCGGGCAGCTTCCTG
ACCTATCGCGAGATGGAGGGCAAACGAGGTGGAGGATTCGGAGGAGGTGGGGGAGCGGTCGGAGCAGGAGGCAAC
CGTCGGGGAGGAGCCGGAAAGACGCCCGACTCGGGACGCGGCAGCGACGAGGATCACGACGACGGAGAGCCCGAG
GGCTACCGATACAAGGCAGACGGCCTGATGAAGCAGTCGTTTAGCCTGACGACGACGACGGGCCAGCATCTCCAC
CTCATCTCGTACTACACCCGTCCGCACGCCGGCCAGCCCGAGCTGCCCCAGCCGACAAACGACCCCAACTTGCGT
GGTGTGGTGCCTCCCAAGGGCTTGTATCCCGAGTCGAGCATGGGCGAGTCCAACCAGACGCCGGCCATGACGAGG
GCTCCAATGCAACAGCCCTACATGCAGCAGCAGCAGCAACAGCATCAGCAGCCACATCACTATCCCTCGTATGCT
GGCTATGGATGGCCGCCCTCGCCCGCTGCCACGCCTCCTTACGGCCAGTATCCCTACGCGGCCATGAATCCTCAC
CAGCAGCAGCAACAGCAACAGCAACAACACCATCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCATCCCCTGCAT
CACGGCCAGCTCCAACACGGGCATCCTCCTCCACCGCCGCCACCTCCTCCTCAGTCTCACGCCCAGCATCAACAC
CATGCACAACAGCTACAGCAACATGCACACCACCACCACCACCACCATCACCATCAACAGCATCCACCCCCTCCG
CCGCCGCCACCTCCCCATCCTCACCACCACCACAGCCACCACCCTCACCCTCCTCAGCACTACGCCCACTACACG
CACGCTCCCCCTCCCGAGCGCAACCCTCTGCCCCCGCCGGTGCAGACGAATAAGCCCCCCTATCCGGGCCCTCAG
CACCACGCCCACCACCACCCGCGATTGCACGACTCGCCGCGGCAGAAGAAGCTGCAGGAAGCAGCCCAGGCCGTC
ATGTGCGATCCCCAGCTGGCTGCCAAGTCGCTACCGGCCCTCAACTCGGTCATGGCCACGCCTCCCACTCGCCAT
CTCAGCGTGACGCCTCCCCGATCCTCGGCGGCGACGACGACGAGACCCAGCCTCTCGGCACTCCTGCACCCGACG
CCCGCCAGCAGCGAGCCGGGCAGTGCCAAGACGTGCAGCAGCGGGAGCGCGGGAAGCAGTCCTCGCACGGCGGGC
GTCGTTCTCGACAAGGCCGGGGCCAGCGAGGACGTGCGGGCCCTGAGGATGCTGGATCGCAAGTTTTGCATCTAG
Transcript >Ophun1|827
ATGGAGACGTACCACGGCTACGTGCGGGCGCCCGCCGACGCCATCAAGCTGTTCGAGGCTTGTCGCCAAGGTCTC
TTGCCGCGTGTTCAGCGGAGGCTATCCGAGAAGGAGAGGCAGTCGATCCGCTCCGGCTCTGTTTTCGTCTGGGAC
GAGCGCGAAGCCGGCATGAGGCGCTGGACCGATGGCAAGTCGTGGAGCGCCAGCCGCGTCTCGGGCAGCTTCCTG
ACCTATCGCGAGATGGAGGGCAAACGAGGTGGAGGATTCGGAGGAGGTGGGGGAGCGGTCGGAGCAGGAGGCAAC
CGTCGGGGAGGAGCCGGAAAGACGCCCGACTCGGGACGCGGCAGCGACGAGGATCACGACGACGGAGAGCCCGAG
GGCTACCGATACAAGGCAGACGGCCTGATGAAGCAGTCGTTTAGCCTGACGACGACGACGGGCCAGCATCTCCAC
CTCATCTCGTACTACACCCGTCCGCACGCCGGCCAGCCCGAGCTGCCCCAGCCGACAAACGACCCCAACTTGCGT
GGTGTGGTGCCTCCCAAGGGCTTGTATCCCGAGTCGAGCATGGGCGAGTCCAACCAGACGCCGGCCATGACGAGG
GCTCCAATGCAACAGCCCTACATGCAGCAGCAGCAGCAACAGCATCAGCAGCCACATCACTATCCCTCGTATGCT
GGCTATGGATGGCCGCCCTCGCCCGCTGCCACGCCTCCTTACGGCCAGTATCCCTACGCGGCCATGAATCCTCAC
CAGCAGCAGCAACAGCAACAGCAACAACACCATCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCATCCCCTGCAT
CACGGCCAGCTCCAACACGGGCATCCTCCTCCACCGCCGCCACCTCCTCCTCAGTCTCACGCCCAGCATCAACAC
CATGCACAACAGCTACAGCAACATGCACACCACCACCACCACCACCATCACCATCAACAGCATCCACCCCCTCCG
CCGCCGCCACCTCCCCATCCTCACCACCACCACAGCCACCACCCTCACCCTCCTCAGCACTACGCCCACTACACG
CACGCTCCCCCTCCCGAGCGCAACCCTCTGCCCCCGCCGGTGCAGACGAATAAGCCCCCCTATCCGGGCCCTCAG
CACCACGCCCACCACCACCCGCGATTGCACGACTCGCCGCGGCAGAAGAAGCTGCAGGAAGCAGCCCAGGCCGTC
ATGTGCGATCCCCAGCTGGCTGCCAAGTCGCTACCGGCCCTCAACTCGGTCATGGCCACGCCTCCCACTCGCCAT
CTCAGCGTGACGCCTCCCCGATCCTCGGCGGCGACGACGACGAGACCCAGCCTCTCGGCACTCCTGCACCCGACG
CCCGCCAGCAGCGAGCCGGGCAGTGCCAAGACGTGCAGCAGCGGGAGCGCGGGAAGCAGTCCTCGCACGGCGGGC
GTCGTTCTCGACAAGGCCGGGGCCAGCGAGGACGTGCGGGCCCTGAGGATGCTGGATCGCAAGTTTTGCATCTAG
Gene >Ophun1|827
ATGGAGACGTACCACGGCTACGTGCGGGCGCCCGCCGACGCCATCAAGCTGTTCGAGGCTTGTCGCCAAGGTCTC
TTGCCGCGTGTTCAGCGGAGGCTATCCGAGAAGGAGAGGCAGTCGATCCGCTCCGGCTCTGTTTTCGTCTGGGAC
GAGCGCGAAGCCGGCATGAGGCGCTGGACCGATGGCAAGTCGTGGAGCGCCAGCCGCGTCTCGGGCAGCTTCCTG
ACCTATCGCGAGATGGAGGGCAAACGAGGTGGAGGATTCGGAGGAGGTGGGGGAGCGGTCGGAGCAGGAGGCAAC
CGTCGGGGAGGAGCCGGAAAGACGCCCGACTCGGGACGCGGCAGCGACGAGGATCACGACGACGGAGAGCCCGAG
GGCTACCGATACAAGGCAGACGGCCTGATGAAGCAGTCGTTTAGCCTGACGACGACGACGGGCCAGCATCTCCAC
CTCATCTCGTACTACACCCGTCCGCACGCCGGCCAGCCCGAGCTGCCCCAGCCGACAAACGACCCCAACTTGCGT
GGTGTGGTGCCTCCCAAGGGCTTGTATCCCGAGTCGAGCATGGGCGAGTCCAACCAGACGCCGGCCATGACGAGG
GCTCCAATGCAACAGCCCTACATGCAGCAGCAGCAGCAACAGCATCAGCAGCCACATCACTATCCCTCGTATGCT
GGCTATGGATGGCCGCCCTCGCCCGCTGCCACGCCTCCTTACGGCCAGTATCCCTACGCGGCCATGAATCCTCAC
CAGCAGCAGCAACAGCAACAGCAACAACACCATCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCATCCCCTGCAT
CACGGCCAGCTCCAACACGGGCATCCTCCTCCACCGCCGCCACCTCCTCCTCAGTCTCACGCCCAGCATCAACAC
CATGCACAACAGCTACAGCAACATGCACACCACCACCACCACCACCATCACCATCAACAGCATCCACCCCCTCCG
CCGCCGCCACCTCCCCATCCTCACCACCACCACAGCCACCACCCTCACCCTCCTCAGCACTACGCCCACTACACG
CACGCTCCCCCTCCCGAGCGCAACCCTCTGCCCCCGCCGGTGCAGACGAATAAGCCCCCCTATCCGGGCCCTCAG
CACCACGCCCACCACCACCCGCGATTGCACGACTCGCCGCGGCAGAAGAAGCTGCAGGAAGCAGCCCAGGCCGTC
ATGTGCGATCCCCAGCTGGCTGCCAAGTCGCTACCGGCCCTCAACTCGGTCATGGCCACGCCTCCCACTCGCCAT
CTCAGCGTGACGCCTCCCCGATCCTCGGCGGCGACGACGACGAGACCCAGCCTCTCGGCACTCCTGCACCCGACG
CCCGCCAGCAGCGAGCCGGGCAGTGCCAAGACGTGCAGCAGCGGGAGCGCGGGAAGCAGTCCTCGCACGGCGGGC
GTCGTTCTCGACAAGGCCGGGGCCAGCGAGGACGTGCGGGCCCTGAGGATGCTGGATCGCAAGTTTTGCATCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail