Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|818
Gene name
LocationContig_129:21453..22005
Strand-
Gene length (bp)552
Transcript length (bp)552
Coding sequence length (bp)552
Protein length (aa) 184

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05486 SRP9-21 Signal recognition particle 9 kDa protein (SRP9) 4.0E-05 4 35
PF05486 SRP9-21 Signal recognition particle 9 kDa protein (SRP9) 1.0E-22 41 116

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5284
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2339
Ophiocordyceps australis map64 (Brazil) OphauB2|816
Ophiocordyceps camponoti-floridani Ophcf2|05662
Ophiocordyceps camponoti-rufipedis Ophun1|818 (this protein)
Ophiocordyceps kimflemingae Ophio5|6267
Ophiocordyceps subramaniannii Hirsu2|4704

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|818
MPYFSTSQEWLDQSALLLEARPTTVTCPLFYKQDRTTADENPQTRVTTRYSIKAVKPPRDQTPTDKDNDTPRPPR
ASLVLKTYDPVSGVTLKYRTTKAAEVSRLVHASLGRLARTMAALPDAATAADNAGGLPEEPMPDAPPVAGLDVSS
AVSGREGKDVQGSASRQQSQVGGAGHKKKKGRR*
Coding >Ophun1|818
ATGCCCTATTTCTCAACGAGCCAGGAGTGGCTCGACCAGTCAGCTCTCCTCCTCGAAGCCCGGCCTACGACCGTA
ACCTGCCCTCTCTTTTACAAACAAGACAGAACGACAGCTGACGAGAACCCACAGACGCGCGTAACGACACGCTAC
TCCATCAAGGCCGTCAAACCACCGCGCGACCAGACCCCAACAGACAAAGACAACGACACGCCAAGACCCCCCCGC
GCCTCTCTCGTCCTCAAGACGTACGACCCCGTCAGCGGCGTGACGCTCAAGTACCGCACCACCAAGGCCGCCGAG
GTCTCGCGCCTCGTCCACGCGTCGCTGGGGAGGCTGGCCAGGACAATGGCCGCCCTGCCTGATGCGGCTACCGCT
GCTGATAACGCCGGTGGCTTGCCGGAGGAGCCGATGCCTGATGCGCCGCCAGTTGCTGGGCTGGATGTGTCGAGC
GCGGTCAGCGGGAGGGAGGGTAAGGATGTGCAGGGTTCGGCTTCTAGACAGCAGTCGCAGGTTGGAGGGGCTGGT
CATAAGAAGAAGAAGGGCCGCAGATAG
Transcript >Ophun1|818
ATGCCCTATTTCTCAACGAGCCAGGAGTGGCTCGACCAGTCAGCTCTCCTCCTCGAAGCCCGGCCTACGACCGTA
ACCTGCCCTCTCTTTTACAAACAAGACAGAACGACAGCTGACGAGAACCCACAGACGCGCGTAACGACACGCTAC
TCCATCAAGGCCGTCAAACCACCGCGCGACCAGACCCCAACAGACAAAGACAACGACACGCCAAGACCCCCCCGC
GCCTCTCTCGTCCTCAAGACGTACGACCCCGTCAGCGGCGTGACGCTCAAGTACCGCACCACCAAGGCCGCCGAG
GTCTCGCGCCTCGTCCACGCGTCGCTGGGGAGGCTGGCCAGGACAATGGCCGCCCTGCCTGATGCGGCTACCGCT
GCTGATAACGCCGGTGGCTTGCCGGAGGAGCCGATGCCTGATGCGCCGCCAGTTGCTGGGCTGGATGTGTCGAGC
GCGGTCAGCGGGAGGGAGGGTAAGGATGTGCAGGGTTCGGCTTCTAGACAGCAGTCGCAGGTTGGAGGGGCTGGT
CATAAGAAGAAGAAGGGCCGCAGATAG
Gene >Ophun1|818
ATGCCCTATTTCTCAACGAGCCAGGAGTGGCTCGACCAGTCAGCTCTCCTCCTCGAAGCCCGGCCTACGACCGTA
ACCTGCCCTCTCTTTTACAAACAAGACAGAACGACAGCTGACGAGAACCCACAGACGCGCGTAACGACACGCTAC
TCCATCAAGGCCGTCAAACCACCGCGCGACCAGACCCCAACAGACAAAGACAACGACACGCCAAGACCCCCCCGC
GCCTCTCTCGTCCTCAAGACGTACGACCCCGTCAGCGGCGTGACGCTCAAGTACCGCACCACCAAGGCCGCCGAG
GTCTCGCGCCTCGTCCACGCGTCGCTGGGGAGGCTGGCCAGGACAATGGCCGCCCTGCCTGATGCGGCTACCGCT
GCTGATAACGCCGGTGGCTTGCCGGAGGAGCCGATGCCTGATGCGCCGCCAGTTGCTGGGCTGGATGTGTCGAGC
GCGGTCAGCGGGAGGGAGGGTAAGGATGTGCAGGGTTCGGCTTCTAGACAGCAGTCGCAGGTTGGAGGGGCTGGT
CATAAGAAGAAGAAGGGCCGCAGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail