Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|816
Gene name
LocationContig_129:17042..17964
Strand+
Gene length (bp)922
Transcript length (bp)816
Coding sequence length (bp)816
Protein length (aa) 272

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13430 DUF4112 Domain of unknown function (DUF4112) 1.7E-33 63 166

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q06170|YL326_YEAST Uncharacterized membrane protein YLR326W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR326W PE=1 SV=1 24 158 3.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

Domain # Start End Length
1 75 97 22
2 126 148 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|816
MASFAAKVVSKRILGESLQNKFGTEDPYFETVPATRLGRPTGKYKKRKKALPPGISDHDGKILTKVKRRAYRLDL
ALCSFLGIRFGWGSVIGLVPAIGDALDAFMALMVFKTCCQIDGGLPSSLKVQMILNVAFDFAIGLVPFLGDLADA
VFKANTRNCLLLEQHLREKGKKEIRKSGLPLPAVDPSSAEEYDKTALDISPSETPPRRPSAATPSRMEHVESRPS
APAESQGRKGRGWFSWNKSRPRPHDVETGEGAGRVHTSDERRGSRR*
Coding >Ophun1|816
ATGGCTTCATTTGCTGCCAAGGTTGTGAGCAAGAGGATTTTGGGCGAGAGCCTGCAAAACAAATTCGGCACCGAG
GATCCATACTTCGAGACTGTGCCCGCCACTCGACTCGGAAGGCCGACGGGCAAGTACAAGAAGCGGAAGAAGGCT
CTCCCGCCCGGTATTTCGGACCATGACGGCAAGATCTTGACCAAAGTCAAGAGACGAGCATACCGCCTCGACCTG
GCCCTCTGCAGTTTTCTGGGGATCCGGTTCGGCTGGGGTAGCGTGATTGGGCTCGTGCCTGCCATCGGAGATGCG
TTGGATGCTTTCATGGCTTTGATGGTCTTTAAGACTTGCTGTCAGATCGATGGAGGGCTACCGAGCTCCCTCAAA
GTGCAGATGATCCTTAACGTCGCCTTCGACTTTGCCATCGGCTTGGTGCCATTCCTCGGAGACCTCGCCGACGCC
GTCTTCAAGGCCAATACTCGCAACTGTTTGCTTTTGGAACAGCACTTGCGGGAGAAGGGCAAGAAAGAAATCCGC
AAGAGTGGCCTGCCGCTTCCCGCAGTCGACCCGAGCAGCGCTGAGGAGTATGACAAGACGGCGCTAGATATCAGT
CCGTCGGAAACTCCGCCTCGACGACCTTCAGCGGCGACCCCATCGCGGATGGAGCACGTGGAGAGCAGGCCCAGT
GCGCCAGCGGAGAGCCAAGGCCGCAAAGGCCGCGGCTGGTTCAGTTGGAACAAGTCTCGCCCTCGCCCTCATGAT
GTCGAGACGGGTGAAGGAGCCGGCAGAGTCCATACTTCAGACGAGCGTCGTGGTAGCCGAAGATGA
Transcript >Ophun1|816
ATGGCTTCATTTGCTGCCAAGGTTGTGAGCAAGAGGATTTTGGGCGAGAGCCTGCAAAACAAATTCGGCACCGAG
GATCCATACTTCGAGACTGTGCCCGCCACTCGACTCGGAAGGCCGACGGGCAAGTACAAGAAGCGGAAGAAGGCT
CTCCCGCCCGGTATTTCGGACCATGACGGCAAGATCTTGACCAAAGTCAAGAGACGAGCATACCGCCTCGACCTG
GCCCTCTGCAGTTTTCTGGGGATCCGGTTCGGCTGGGGTAGCGTGATTGGGCTCGTGCCTGCCATCGGAGATGCG
TTGGATGCTTTCATGGCTTTGATGGTCTTTAAGACTTGCTGTCAGATCGATGGAGGGCTACCGAGCTCCCTCAAA
GTGCAGATGATCCTTAACGTCGCCTTCGACTTTGCCATCGGCTTGGTGCCATTCCTCGGAGACCTCGCCGACGCC
GTCTTCAAGGCCAATACTCGCAACTGTTTGCTTTTGGAACAGCACTTGCGGGAGAAGGGCAAGAAAGAAATCCGC
AAGAGTGGCCTGCCGCTTCCCGCAGTCGACCCGAGCAGCGCTGAGGAGTATGACAAGACGGCGCTAGATATCAGT
CCGTCGGAAACTCCGCCTCGACGACCTTCAGCGGCGACCCCATCGCGGATGGAGCACGTGGAGAGCAGGCCCAGT
GCGCCAGCGGAGAGCCAAGGCCGCAAAGGCCGCGGCTGGTTCAGTTGGAACAAGTCTCGCCCTCGCCCTCATGAT
GTCGAGACGGGTGAAGGAGCCGGCAGAGTCCATACTTCAGACGAGCGTCGTGGTAGCCGAAGATGA
Gene >Ophun1|816
ATGGCTTCATTTGCTGCCAAGGTTGTGAGCAAGAGGATTTTGGGCGAGAGCCTGCAAAACAAATTCGGCACCGAG
GTTCGCGCATCCCAGACGCCCCTGTCATCGAAAATTCTCTGACCAGTTCCGCCTCTAGGATCCATACTTCGAGAC
TGTGCCCGCCACTCGACTCGGAAGGCCGACGGGCAAGTACAAGAAGCGGAAGAAGGCTCTCCCGCCCGGTATTTC
GGACCATGACGGCAAGATCTTGACCAAAGTCAAGAGACGAGCATACCGCCTCGACCTGGCCCTCTGCAGTTTTCT
GGGGATCCGGTTCGGCTGGGGTAGCGTGATTGGGCTCGTGCCTGCGTGAGCTTGCCCCGAGACAACTGCCGGTGT
TGAACTGACCGTCTTCAGCATCGGAGATGCGTTGGATGCTTTCATGGCTTTGATGGTCTTTAAGACTTGCTGTCA
GATCGATGGAGGGCTACCGAGCTCCCTCAAAGTGCAGATGATCCTTAACGTCGCCTTCGACTTTGCCATCGGCTT
GGTGCCATTCCTCGGAGACCTCGCCGACGCCGTCTTCAAGGCCAATACTCGCAACTGTTTGCTTTTGGAACAGCA
CTTGCGGGAGAAGGGCAAGAAAGAAATCCGCAAGAGTGGCCTGCCGCTTCCCGCAGTCGACCCGAGCAGCGCTGA
GGAGTATGACAAGACGGCGCTAGATATCAGTCCGTCGGAAACTCCGCCTCGACGACCTTCAGCGGCGACCCCATC
GCGGATGGAGCACGTGGAGAGCAGGCCCAGTGCGCCAGCGGAGAGCCAAGGCCGCAAAGGCCGCGGCTGGTTCAG
TTGGAACAAGTCTCGCCCTCGCCCTCATGATGTCGAGACGGGTGAAGGAGCCGGCAGAGTCCATACTTCAGACGA
GCGTCGTGGTAGCCGAAGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail