Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|806
Gene name
LocationContig_1287:121..1766
Strand+
Gene length (bp)1645
Transcript length (bp)1503
Coding sequence length (bp)1503
Protein length (aa) 501

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00010 HLH Helix-loop-helix DNA-binding domain 1.0E-11 342 385

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q04635|ESC1_SCHPO Protein esc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=esc1 PE=2 SV=1 329 385 7.0E-16

GO

GO Term Description Terminal node
GO:0046983 protein dimerization activity Yes
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0005515 protein binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Helix-loop-helix

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4651
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1428
Ophiocordyceps australis map64 (Brazil) OphauB2|5454
Ophiocordyceps camponoti-floridani Ophcf2|04644
Ophiocordyceps camponoti-rufipedis Ophun1|806 (this protein)
Ophiocordyceps kimflemingae Ophio5|8076
Ophiocordyceps subramaniannii Hirsu2|98

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|806
MTVAAMEAQQQRPTPAKAAGLTNILNQDDQPSAHNAPLPQLRDSGFYSTADTSSSKHTSAASFSVNGLSPAASGY
QSSSADKTPSPVAANMMPQALVSPSASNMSVASMVSPTSPVSFRFNRTTSLESQPPNGATLGESLAAGASIARRE
SVDSRINQGLSDMRLGGSPYASNNHSTTSIHNTLHSQRIPRPGFDALSMHRISNGYQPSADRNPEPKTVKTAPAI
TGPATGHIARAAEPTKGQAWAFPEEEISRVGPRYDDSRRSSITESVASSQFTTESRLPPGQRRLDDGPDHLRLAH
HSDFPPVHHHHSMQHKQLSDLQAEEGGGPTGSQPYSRTPELRVSHKLAERKRRTEMKELFDQLRDLMPQERGSKA
SKWEILTKAIAEHQRMNEHIRLLQTHYNTALSEIDLLRREINNMRMEPGHPQSAQQQPPAPPPPPPPQAQQPQPG
PYPADAYSNASRTELPPLRSISSSIPSGPDSMTGVQYEPPRVNGYRQERY*
Coding >Ophun1|806
ATGACGGTTGCTGCCATGGAGGCCCAGCAGCAGCGGCCGACGCCCGCCAAGGCTGCGGGCTTGACAAACATACTC
AATCAGGACGACCAGCCTTCGGCGCACAATGCCCCTCTCCCCCAGCTGCGCGATTCTGGCTTCTATTCGACGGCC
GATACGTCGAGCAGCAAACACACTTCTGCCGCCTCGTTCAGCGTCAACGGGCTCAGCCCGGCCGCTTCGGGCTAT
CAGTCGTCGTCGGCCGACAAGACGCCGTCCCCCGTCGCCGCCAACATGATGCCTCAGGCCCTCGTCTCTCCTTCG
GCCAGCAACATGAGCGTCGCCTCCATGGTGTCCCCCACGAGCCCCGTCAGCTTCCGATTCAACCGAACCACGTCG
CTCGAGTCCCAGCCCCCCAACGGTGCCACCCTAGGCGAGAGCCTCGCCGCCGGCGCCTCCATCGCCAGGCGCGAG
AGCGTCGACAGCCGCATCAACCAGGGCCTCAGCGACATGCGCCTCGGCGGCTCCCCCTACGCCAGCAACAATCAC
TCCACCACCTCGATCCACAACACGCTGCACTCGCAGCGCATCCCCCGTCCCGGTTTCGACGCCCTCTCCATGCAC
AGAATCTCGAATGGCTATCAGCCGAGCGCGGATCGGAACCCGGAACCAAAGACGGTCAAGACGGCGCCGGCTATC
ACCGGCCCCGCCACCGGACATATCGCCCGGGCCGCCGAGCCGACTAAGGGTCAGGCTTGGGCGTTTCCCGAGGAA
GAGATATCCAGGGTGGGGCCGCGTTACGACGACTCGAGACGGAGCAGCATCACCGAGTCCGTCGCCAGCAGCCAG
TTCACCACCGAGTCCCGCCTGCCGCCCGGCCAGCGGAGGCTCGACGATGGGCCCGACCACCTCCGTCTGGCTCAC
CACTCCGACTTCCCCCCGGTCCACCATCATCACAGCATGCAGCACAAGCAGCTCAGCGACCTGCAGGCCGAGGAG
GGCGGCGGGCCCACGGGCTCTCAGCCCTACAGCCGGACGCCCGAGCTGAGGGTCAGCCACAAGCTGGCCGAGAGG
AAGCGGCGCACCGAGATGAAGGAGCTCTTCGACCAGTTGCGCGATCTCATGCCGCAGGAGCGGGGATCCAAGGCC
TCCAAGTGGGAGATTCTCACCAAAGCCATTGCGGAGCACCAAAGAATGAACGAGCACATTCGGCTGCTGCAGACG
CACTACAATACGGCTCTGTCCGAGATCGACCTCCTCCGCCGCGAGATCAACAACATGAGGATGGAACCGGGTCAC
CCGCAGTCGGCGCAACAACAGCCTCCAGCGCCGCCGCCGCCTCCTCCTCCTCAGGCGCAGCAGCCGCAGCCCGGG
CCTTACCCGGCCGACGCCTACTCCAACGCCAGCCGGACGGAGCTGCCGCCGTTGCGGTCCATCAGCAGCAGCATA
CCCAGCGGGCCGGACTCGATGACGGGCGTCCAATACGAGCCGCCGCGGGTCAACGGTTACCGTCAAGAGAGATAC
TGA
Transcript >Ophun1|806
ATGACGGTTGCTGCCATGGAGGCCCAGCAGCAGCGGCCGACGCCCGCCAAGGCTGCGGGCTTGACAAACATACTC
AATCAGGACGACCAGCCTTCGGCGCACAATGCCCCTCTCCCCCAGCTGCGCGATTCTGGCTTCTATTCGACGGCC
GATACGTCGAGCAGCAAACACACTTCTGCCGCCTCGTTCAGCGTCAACGGGCTCAGCCCGGCCGCTTCGGGCTAT
CAGTCGTCGTCGGCCGACAAGACGCCGTCCCCCGTCGCCGCCAACATGATGCCTCAGGCCCTCGTCTCTCCTTCG
GCCAGCAACATGAGCGTCGCCTCCATGGTGTCCCCCACGAGCCCCGTCAGCTTCCGATTCAACCGAACCACGTCG
CTCGAGTCCCAGCCCCCCAACGGTGCCACCCTAGGCGAGAGCCTCGCCGCCGGCGCCTCCATCGCCAGGCGCGAG
AGCGTCGACAGCCGCATCAACCAGGGCCTCAGCGACATGCGCCTCGGCGGCTCCCCCTACGCCAGCAACAATCAC
TCCACCACCTCGATCCACAACACGCTGCACTCGCAGCGCATCCCCCGTCCCGGTTTCGACGCCCTCTCCATGCAC
AGAATCTCGAATGGCTATCAGCCGAGCGCGGATCGGAACCCGGAACCAAAGACGGTCAAGACGGCGCCGGCTATC
ACCGGCCCCGCCACCGGACATATCGCCCGGGCCGCCGAGCCGACTAAGGGTCAGGCTTGGGCGTTTCCCGAGGAA
GAGATATCCAGGGTGGGGCCGCGTTACGACGACTCGAGACGGAGCAGCATCACCGAGTCCGTCGCCAGCAGCCAG
TTCACCACCGAGTCCCGCCTGCCGCCCGGCCAGCGGAGGCTCGACGATGGGCCCGACCACCTCCGTCTGGCTCAC
CACTCCGACTTCCCCCCGGTCCACCATCATCACAGCATGCAGCACAAGCAGCTCAGCGACCTGCAGGCCGAGGAG
GGCGGCGGGCCCACGGGCTCTCAGCCCTACAGCCGGACGCCCGAGCTGAGGGTCAGCCACAAGCTGGCCGAGAGG
AAGCGGCGCACCGAGATGAAGGAGCTCTTCGACCAGTTGCGCGATCTCATGCCGCAGGAGCGGGGATCCAAGGCC
TCCAAGTGGGAGATTCTCACCAAAGCCATTGCGGAGCACCAAAGAATGAACGAGCACATTCGGCTGCTGCAGACG
CACTACAATACGGCTCTGTCCGAGATCGACCTCCTCCGCCGCGAGATCAACAACATGAGGATGGAACCGGGTCAC
CCGCAGTCGGCGCAACAACAGCCTCCAGCGCCGCCGCCGCCTCCTCCTCCTCAGGCGCAGCAGCCGCAGCCCGGG
CCTTACCCGGCCGACGCCTACTCCAACGCCAGCCGGACGGAGCTGCCGCCGTTGCGGTCCATCAGCAGCAGCATA
CCCAGCGGGCCGGACTCGATGACGGGCGTCCAATACGAGCCGCCGCGGGTCAACGGTTACCGTCAAGAGAGATAC
TGA
Gene >Ophun1|806
ATGACGGTTGCTGCCATGGAGGCCCAGCAGCAGCGGCCGACGCCCGCCAAGGCTGCGGGCTTGACAAACATACTC
AATCAGGACGACCAGCCTTCGGCGCACAATGCCCCTCTCCCCCAGCTGCGCGATTCTGGCTTCTATTCGACGGCC
GATACGTCGAGCAGCAAACGTAGGTGGCGGCCTGCTTCCTCTCTTCTCCCCCGCCTGCCGTTGCTCACGTCCGCA
GACACTTCTGCCGCCTCGTTCAGCGTCAACGGGCTCAGCCCGGCCGCTTCGGGCTATCAGTCGTCGTCGGCCGAC
AAGACGCCGTCCCCCGTCGCCGCCAACATGATGCCTCAGGCCCTCGTCTCTCCTTCGGCCAGCAACATGAGCGTC
GCCTCCATGGTGTCCCCCACGAGCCCCGTCAGCTTCCGATTCAACCGAACCACGTCGCTCGAGTCCCAGCCCCCC
AACGGTGCCACCCTAGGCGAGAGCCTCGCCGCCGGCGCCTCCATCGCCAGGCGCGAGAGCGTCGACAGCCGCATC
AACCAGGGCCTCAGCGACATGCGCCTCGGCGGCTCCCCCTACGCCAGCAACAATCACTCCACCACCTCGATCCAC
AACACGCTGCACTCGCAGCGCATCCCCCGTCCCGGTTTCGACGCCCTCTCCATGCACAGAATCTCGAATGGCTAT
CAGCCGAGCGCGGATCGGAACCCGGAACCAAAGACGGTCAAGACGGCGCCGGCTATCACCGGCCCCGCCACCGGA
CATATCGCCCGGGCCGCCGAGCCGACTAAGGGTCAGGCTTGGGCGTTTCCCGAGGAAGAGATATCCAGGGTGGGG
CCGCGTTACGACGACTCGAGACGGAGCAGCATCACCGAGTCCGTCGCCAGCAGCCAGTTCACCACCGAGTCCCGC
CTGCCGCCCGGCCAGCGGAGGCTCGACGATGGGCCCGACCACCTCCGTCTGGCTCACCACTCCGACTTCCCCCCG
GTCCACCATCATCACAGCATGCAGCACAAGCAGCTCAGCGACCTGCAGGCCGAGGAGGGCGGCGGGCCCACGGGC
TCTCAGCCCTACAGCCGGACGCCCGAGCTGAGGGTCAGCCACAAGCTGGCCGAGAGGAAGCGGCGCACCGAGATG
AAGGAGCTCTTCGACCAGTTGCGCGATCTCATGCCGCAGGAGCGGGGATCCAAGGCCTCCAAGTGGGAGATTCTC
ACCAAAGGTTAGATGACGATGATGGTGATGCGGATGACGTTGTCTCGCGGCGCGCCCGAAGCTGACGTGCTTTCT
TTTTCCCTTACCGACAGCCATTGCGGAGCACCAAAGAATGAACGAGCACATTCGGCTGCTGCAGACGCACTACAA
TACGGCTCTGTCCGAGATCGACCTCCTCCGCCGCGAGATCAACAACATGAGGATGGAACCGGGTCACCCGCAGTC
GGCGCAACAACAGCCTCCAGCGCCGCCGCCGCCTCCTCCTCCTCAGGCGCAGCAGCCGCAGCCCGGGCCTTACCC
GGCCGACGCCTACTCCAACGCCAGCCGGACGGAGCTGCCGCCGTTGCGGTCCATCAGCAGCAGCATACCCAGCGG
GCCGGACTCGATGACGGGCGTCCAATACGAGCCGCCGCGGGTCAACGGTTACCGTCAAGAGAGATACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail