Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|805
Gene name
LocationContig_1285:1712..2673
Strand-
Gene length (bp)961
Transcript length (bp)648
Coding sequence length (bp)648
Protein length (aa) 216

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04178 Got1 Got1/Sft2-like family 1.6E-34 81 192

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38166|SFT2_YEAST Protein transport protein SFT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SFT2 PE=1 SV=1 4 209 5.0E-40
sp|Q9P6K1|SFT2_SCHPO Protein transport protein sft2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sft2 PE=3 SV=1 44 213 3.0E-32
sp|Q9CSV6|SFT2C_MOUSE Vesicle transport protein SFT2C OS=Mus musculus GN=Sft2d3 PE=1 SV=2 75 201 3.0E-09

GO

GO Term Description Terminal node
GO:0016192 vesicle-mediated transport Yes
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 83 105 22
2 112 131 19
3 146 164 18
4 171 193 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|805
MASSSFRDSINSLGWSRRGSDEPANTSQQSGLLSSIKNLSPFQDRGYMRLPTTEGPGAPLPAPSRREEEEGWFVL
SRWDRLLVFGACNLAALACFVICFTLFPVLSLRPRKFVILWSVGSILFLASFAAVMGPVNYLHHLFSTPRLPFTA
AYFGSILLTLVFSLKLHSTILTLLSAVAQLACLIWYLVSYFPMGSAGLRLAASFGTRQATAWMSG*
Coding >Ophun1|805
ATGGCGTCAAGCTCCTTTCGGGATTCGATAAACTCGCTCGGCTGGAGTCGACGAGGCAGCGATGAACCCGCCAAT
ACGTCGCAGCAGTCCGGGCTGCTCTCTTCCATCAAGAACCTGTCTCCCTTTCAGGACCGTGGCTACATGCGCCTG
CCGACCACCGAGGGCCCCGGAGCACCTCTACCGGCACCAAGTCGGCGAGAGGAGGAAGAGGGCTGGTTCGTTTTG
AGCAGATGGGACCGGTTGTTGGTCTTTGGGGCTTGCAACCTTGCTGCTCTCGCCTGTTTCGTCATCTGCTTCACT
CTCTTCCCGGTCCTGTCTCTCCGGCCGCGCAAGTTTGTCATTCTGTGGTCTGTCGGCTCCATACTCTTCTTGGCG
TCCTTTGCCGCTGTCATGGGCCCGGTCAACTACTTGCATCATCTCTTCTCTACGCCTAGACTGCCGTTTACTGCG
GCGTACTTTGGTTCCATCCTGTTGACCCTAGTATTTTCCCTCAAGCTTCACAGCACCATCCTGACTCTACTCTCC
GCCGTGGCTCAGCTCGCGTGCCTAATCTGGTACCTCGTCAGCTACTTTCCCATGGGCTCGGCGGGCTTGCGTCTG
GCGGCCTCGTTCGGAACGCGGCAAGCTACAGCGTGGATGTCGGGGTGA
Transcript >Ophun1|805
ATGGCGTCAAGCTCCTTTCGGGATTCGATAAACTCGCTCGGCTGGAGTCGACGAGGCAGCGATGAACCCGCCAAT
ACGTCGCAGCAGTCCGGGCTGCTCTCTTCCATCAAGAACCTGTCTCCCTTTCAGGACCGTGGCTACATGCGCCTG
CCGACCACCGAGGGCCCCGGAGCACCTCTACCGGCACCAAGTCGGCGAGAGGAGGAAGAGGGCTGGTTCGTTTTG
AGCAGATGGGACCGGTTGTTGGTCTTTGGGGCTTGCAACCTTGCTGCTCTCGCCTGTTTCGTCATCTGCTTCACT
CTCTTCCCGGTCCTGTCTCTCCGGCCGCGCAAGTTTGTCATTCTGTGGTCTGTCGGCTCCATACTCTTCTTGGCG
TCCTTTGCCGCTGTCATGGGCCCGGTCAACTACTTGCATCATCTCTTCTCTACGCCTAGACTGCCGTTTACTGCG
GCGTACTTTGGTTCCATCCTGTTGACCCTAGTATTTTCCCTCAAGCTTCACAGCACCATCCTGACTCTACTCTCC
GCCGTGGCTCAGCTCGCGTGCCTAATCTGGTACCTCGTCAGCTACTTTCCCATGGGCTCGGCGGGCTTGCGTCTG
GCGGCCTCGTTCGGAACGCGGCAAGCTACAGCGTGGATGTCGGGGTGA
Gene >Ophun1|805
ATGGCGTCAAGCTCCTTTCGGGATTCGATAAACTCGCTCGGCTGGAGTCGACGAGGCAGCGATGAACCCGCCAAT
ACGTCGCAGCAGTCCGGGCTGCTCTCTTCCATCAAGAACCTGTCTCCCTTTCAGGACCGTGGCTACATGCGCCTG
CCGACCACCGAGGGCCCCGGAGCACCTCTACCGGCACCAAGTCGGCGAGAGGAGGAAGAGGGCTGGTTCGTTTGT
GAGTCAACCTGACGACATGAGGTCGCGCCCCCCCTGCATCGGGACATGCGCATGGCATTCTCTTGTCCATGGACT
GGATTCTGCATGTGATGCACCCCGTGGGCGGCAGAGCTAACTCGAGGTTGCAGTGAGCAGATGGGACCGGTTGTT
GGTCTTTGGGGCTTGCAACCTTGCTGCTCTCGCCTGTTTCGTCATCTGCTTCACTCTCTTCCCGGTCCTGTCTCT
CCGGCCGCGCAAGTTTGTCATTCTGTAAGTGGGAAAAGTCCATCTCGGTAGCATGCCGCCTGACGTCTTTGGCGT
CGTCTTCCCGCTCCCCGTCCCCCCCCTTTCAGTGCCGTGTCCTATATGTTGCCTCTTCTCGGCGTGCGACTTACA
GTGCGCAGGTGGTCTGTCGGCTCCATACTCTTCTTGGCGTCCTTTGCCGCTGTCATGGGCCCGGTCAACTACTTG
CATCATCTCTTCTCTACGCCTAGACTGCCGTTTACTGCGGCGTACTTTGGTTCCATCCTGTTGACCCTAGTATTT
TCCCTCAAGGTATGTCGGATCCTTCCCGTTCAAAGTCCGGCCTGACGCTTTTGTGCAGCTTCACAGCACCATCCT
GACTCTACTCTCCGCCGTGGCTCAGCTCGCGTGCCTAATCTGGTACCTCGTCAGCTACTTTCCCATGGGCTCGGC
GGGCTTGCGTCTGGCGGCCTCGTTCGGAACGCGGCAAGCTACAGCGTGGATGTCGGGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail