Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|797
Gene name
LocationContig_128:17547..18993
Strand+
Gene length (bp)1446
Transcript length (bp)1332
Coding sequence length (bp)1332
Protein length (aa) 444

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00202 Aminotran_3 Aminotransferase class-III 3.2E-118 35 431

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q92413|OAT_EMENI Ornithine aminotransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=otaA PE=3 SV=2 14 441 0.0E+00
sp|Q9P7L5|OAT_SCHPO Ornithine aminotransferase car2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=car2 PE=2 SV=1 30 435 0.0E+00
sp|Q6CWC1|OAT_KLULA Ornithine aminotransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CAR2 PE=1 SV=1 22 440 7.0E-170
sp|P07991|OAT_YEAST Ornithine aminotransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAR2 PE=1 SV=2 22 434 6.0E-164
sp|Q54JP5|OAT_DICDI Probable ornithine aminotransferase OS=Dictyostelium discoideum GN=oatA PE=3 SV=1 16 427 3.0E-160
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q92413|OAT_EMENI Ornithine aminotransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=otaA PE=3 SV=2 14 441 0.0E+00
sp|Q9P7L5|OAT_SCHPO Ornithine aminotransferase car2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=car2 PE=2 SV=1 30 435 0.0E+00
sp|Q6CWC1|OAT_KLULA Ornithine aminotransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CAR2 PE=1 SV=1 22 440 7.0E-170
sp|P07991|OAT_YEAST Ornithine aminotransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAR2 PE=1 SV=2 22 434 6.0E-164
sp|Q54JP5|OAT_DICDI Probable ornithine aminotransferase OS=Dictyostelium discoideum GN=oatA PE=3 SV=1 16 427 3.0E-160
sp|Q9VW26|OAT_DROME Ornithine aminotransferase, mitochondrial OS=Drosophila melanogaster GN=Oat PE=2 SV=1 20 431 1.0E-156
sp|P04181|OAT_HUMAN Ornithine aminotransferase, mitochondrial OS=Homo sapiens GN=OAT PE=1 SV=1 30 431 8.0E-155
sp|P29758|OAT_MOUSE Ornithine aminotransferase, mitochondrial OS=Mus musculus GN=Oat PE=1 SV=1 4 431 2.0E-154
sp|P49724|OAT_DROAN Ornithine aminotransferase, mitochondrial OS=Drosophila ananassae GN=Oat PE=1 SV=1 20 431 2.0E-154
sp|P04182|OAT_RAT Ornithine aminotransferase, mitochondrial OS=Rattus norvegicus GN=Oat PE=1 SV=1 22 431 4.0E-152
sp|Q18040|OAT_CAEEL Probable ornithine aminotransferase, mitochondrial OS=Caenorhabditis elegans GN=C16A3.10 PE=3 SV=3 22 434 4.0E-152
sp|Q9FNK4|OAT_ARATH Ornithine aminotransferase, mitochondrial OS=Arabidopsis thaliana GN=DELTA-OAT PE=1 SV=1 27 439 9.0E-151
sp|Q10G56|OAT_ORYSJ Ornithine aminotransferase, mitochondrial OS=Oryza sativa subsp. japonica GN=OAT PE=2 SV=1 22 439 5.0E-150
sp|Q3ZCF5|OAT_BOVIN Ornithine aminotransferase, mitochondrial OS=Bos taurus GN=OAT PE=2 SV=1 4 431 3.0E-148
sp|C4L2E7|OAT_EXISA Ornithine aminotransferase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=rocD PE=3 SV=1 29 431 8.0E-137
sp|P38021|OAT_BACSU Ornithine aminotransferase OS=Bacillus subtilis (strain 168) GN=rocD PE=1 SV=2 35 432 1.0E-135
sp|Q9K5Z2|OAT_BACHD Ornithine aminotransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rocD PE=3 SV=2 18 432 5.0E-135
sp|Q6GID1|OAT2_STAAR Ornithine aminotransferase 2 OS=Staphylococcus aureus (strain MRSA252) GN=rocD2 PE=3 SV=1 35 427 7.0E-135
sp|Q8EP32|OAT_OCEIH Ornithine aminotransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rocD PE=3 SV=1 35 431 1.0E-134
sp|P60299|OAT2_STAAW Ornithine aminotransferase 2 OS=Staphylococcus aureus (strain MW2) GN=rocD2 PE=3 SV=1 35 427 1.0E-134
sp|Q6GAW9|OAT2_STAAS Ornithine aminotransferase 2 OS=Staphylococcus aureus (strain MSSA476) GN=rocD2 PE=3 SV=1 35 427 1.0E-134
sp|P60298|OAT2_STAAN Ornithine aminotransferase 2 OS=Staphylococcus aureus (strain N315) GN=rocD2 PE=1 SV=1 35 427 1.0E-134
sp|P60297|OAT2_STAAM Ornithine aminotransferase 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rocD2 PE=3 SV=1 35 427 1.0E-134
sp|Q5HHC8|OAT2_STAAC Ornithine aminotransferase 2 OS=Staphylococcus aureus (strain COL) GN=rocD2 PE=3 SV=1 35 427 1.0E-134
sp|C0ZBR4|OAT_BREBN Ornithine aminotransferase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=rocD PE=3 SV=1 29 420 9.0E-134
sp|C5D6R2|OAT_GEOSW Ornithine aminotransferase OS=Geobacillus sp. (strain WCH70) GN=rocD PE=3 SV=1 31 420 1.0E-133
sp|Q07805|OAT_PLAFD Ornithine aminotransferase OS=Plasmodium falciparum (isolate CDC / Honduras) GN=OAT PE=1 SV=1 22 432 3.0E-133
sp|Q6LFH8|OAT_PLAF7 Ornithine aminotransferase OS=Plasmodium falciparum (isolate 3D7) GN=OAT PE=1 SV=1 22 432 3.0E-133
sp|B9ITF9|OAT_BACCQ Ornithine aminotransferase OS=Bacillus cereus (strain Q1) GN=rocD PE=3 SV=1 35 427 2.0E-131
sp|B9EAM9|OAT_MACCJ Ornithine aminotransferase OS=Macrococcus caseolyticus (strain JCSC5402) GN=rocD PE=3 SV=1 35 420 2.0E-131
sp|Q89RB7|OAT_BRADU Ornithine aminotransferase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rocD PE=3 SV=1 27 433 2.0E-131
sp|Q5HQK4|OAT_STAEQ Ornithine aminotransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rocD PE=3 SV=1 35 427 3.0E-131
sp|Q8CT82|OAT_STAES Ornithine aminotransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rocD PE=3 SV=1 35 427 3.0E-131
sp|C1EL61|OAT_BACC3 Ornithine aminotransferase OS=Bacillus cereus (strain 03BB102) GN=rocD PE=3 SV=1 35 427 1.0E-130
sp|Q81TV3|OAT_BACAN Ornithine aminotransferase OS=Bacillus anthracis GN=rocD PE=1 SV=1 35 427 4.0E-130
sp|C3LBX0|OAT_BACAC Ornithine aminotransferase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=rocD PE=3 SV=1 35 427 4.0E-130
sp|C3P3K3|OAT_BACAA Ornithine aminotransferase OS=Bacillus anthracis (strain A0248) GN=rocD PE=3 SV=1 35 427 4.0E-130
sp|Q81GP2|OAT_BACCR Ornithine aminotransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rocD PE=3 SV=1 35 427 1.0E-129
sp|Q49W96|OAT2_STAS1 Ornithine aminotransferase 2 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rocD2 PE=3 SV=1 35 420 2.0E-127
sp|B9DIU0|OAT_STACT Ornithine aminotransferase OS=Staphylococcus carnosus (strain TM300) GN=rocD PE=3 SV=1 35 427 6.0E-127
sp|Q4XWV5|OAT_PLACH Ornithine aminotransferase OS=Plasmodium chabaudi GN=OAT PE=3 SV=1 27 436 7.0E-126
sp|Q7RT90|OAT_PLAYO Ornithine aminotransferase OS=Plasmodium yoelii yoelii GN=OAT PE=1 SV=1 27 436 1.0E-122
sp|Q7VSA0|OAT_BORPE Ornithine aminotransferase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=rocD PE=3 SV=2 30 420 4.0E-120
sp|Q7W1E4|OAT_BORPA Ornithine aminotransferase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=rocD PE=3 SV=3 30 420 4.0E-120
sp|Q7WP51|OAT_BORBR Ornithine aminotransferase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=rocD PE=3 SV=2 30 420 4.0E-120
sp|Q8NYM5|OAT1_STAAW Ornithine aminotransferase 1 OS=Staphylococcus aureus (strain MW2) GN=rocD1 PE=3 SV=1 34 422 2.0E-117
sp|Q6GCU1|OAT1_STAAS Ornithine aminotransferase 1 OS=Staphylococcus aureus (strain MSSA476) GN=rocD1 PE=3 SV=1 34 422 2.0E-117
sp|Q5HJI8|OAT1_STAAC Ornithine aminotransferase 1 OS=Staphylococcus aureus (strain COL) GN=rocD1 PE=3 SV=1 34 422 2.0E-117
sp|Q6GKC1|OAT1_STAAR Ornithine aminotransferase 1 OS=Staphylococcus aureus (strain MRSA252) GN=rocD1 PE=3 SV=1 34 422 2.0E-116
sp|P60296|OAT1_STAAN Ornithine aminotransferase 1 OS=Staphylococcus aureus (strain N315) GN=rocD1 PE=3 SV=1 34 422 5.0E-116
sp|P60295|OAT1_STAAM Ornithine aminotransferase 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rocD1 PE=3 SV=1 34 422 5.0E-116
sp|Q4A0N2|OAT1_STAS1 Ornithine aminotransferase 1 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rocD1 PE=3 SV=1 34 433 7.0E-115
sp|P31893|OAT_VIGAC Ornithine aminotransferase OS=Vigna aconitifolia PE=2 SV=1 9 410 2.0E-106
sp|Q58131|ARGD_METJA Acetylornithine aminotransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=argD PE=3 SV=1 30 434 3.0E-77
sp|Q7MH19|ARGD_VIBVY Acetylornithine aminotransferase OS=Vibrio vulnificus (strain YJ016) GN=argD PE=3 SV=1 38 434 4.0E-77
sp|P59323|ARGD_VIBVU Acetylornithine aminotransferase OS=Vibrio vulnificus (strain CMCP6) GN=argD PE=3 SV=1 38 434 4.0E-77
sp|O27392|ARGD_METTH Acetylornithine aminotransferase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=argD PE=3 SV=1 30 434 6.0E-76
sp|Q7NN66|ARGD_GLOVI Acetylornithine aminotransferase OS=Gloeobacter violaceus (strain PCC 7421) GN=argD PE=3 SV=2 36 440 1.0E-75
sp|Q8R7C1|ARGD_CALS4 Acetylornithine aminotransferase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=argD PE=3 SV=1 27 434 2.0E-75
sp|Q87L20|ARGD_VIBPA Acetylornithine aminotransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=argD PE=3 SV=1 38 434 3.0E-74
sp|P73133|ARGD_SYNY3 Acetylornithine aminotransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=argD PE=3 SV=1 36 434 4.0E-74
sp|P57600|ARGD_BUCAI Acetylornithine/succinyldiaminopimelate aminotransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=argD PE=3 SV=1 38 433 2.0E-73
sp|P59320|ARGD_SHEON Acetylornithine aminotransferase OS=Shewanella oneidensis (strain MR-1) GN=argD PE=3 SV=1 37 434 6.0E-73
sp|Q9JYY4|ARGD_NEIMB Acetylornithine aminotransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=argD PE=3 SV=1 37 438 9.0E-73
sp|Q97GH9|ARGD_CLOAB Acetylornithine aminotransferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=argD PE=3 SV=1 31 432 1.0E-72
sp|A8A0U0|ASTC_ECOHS Succinylornithine transaminase OS=Escherichia coli O9:H4 (strain HS) GN=astC PE=3 SV=1 38 434 2.0E-72
sp|P54752|ARGD_NOSS1 Acetylornithine aminotransferase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=argD PE=3 SV=1 3 431 4.0E-72
sp|B7L6M2|ASTC_ECO55 Succinylornithine transaminase OS=Escherichia coli (strain 55989 / EAEC) GN=astC PE=3 SV=1 38 434 9.0E-72
sp|B6IBG8|ASTC_ECOSE Succinylornithine transaminase OS=Escherichia coli (strain SE11) GN=astC PE=3 SV=1 38 434 1.0E-71
sp|P77581|ASTC_ECOLI Succinylornithine transaminase OS=Escherichia coli (strain K12) GN=astC PE=1 SV=1 38 434 1.0E-71
sp|B1IPI2|ASTC_ECOLC Succinylornithine transaminase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=astC PE=3 SV=1 38 434 1.0E-71
sp|B1XGK9|ASTC_ECODH Succinylornithine transaminase OS=Escherichia coli (strain K12 / DH10B) GN=astC PE=3 SV=1 38 434 1.0E-71
sp|C4ZZA4|ASTC_ECOBW Succinylornithine transaminase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=astC PE=3 SV=1 38 434 1.0E-71
sp|B7M1G0|ASTC_ECO8A Succinylornithine transaminase OS=Escherichia coli O8 (strain IAI1) GN=astC PE=3 SV=1 38 434 1.0E-71
sp|A7ZML6|ASTC_ECO24 Succinylornithine transaminase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=astC PE=3 SV=1 38 434 1.0E-71
sp|B5YQ35|ASTC_ECO5E Succinylornithine transaminase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=astC PE=3 SV=1 38 434 1.0E-71
sp|Q8X598|ASTC_ECO57 Succinylornithine transaminase OS=Escherichia coli O157:H7 GN=astC PE=3 SV=1 38 434 1.0E-71
sp|O66442|ARGD_AQUAE Acetylornithine aminotransferase OS=Aquifex aeolicus (strain VF5) GN=argD PE=1 SV=1 36 431 1.0E-71
sp|B7NT29|ASTC_ECO7I Succinylornithine transaminase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=astC PE=3 SV=1 38 434 2.0E-71
sp|Q3Z295|ASTC_SHISS Succinylornithine transaminase OS=Shigella sonnei (strain Ss046) GN=astC PE=3 SV=1 38 434 2.0E-71
sp|Q321P0|ASTC_SHIBS Succinylornithine transaminase OS=Shigella boydii serotype 4 (strain Sb227) GN=astC PE=3 SV=1 38 434 4.0E-71
sp|B2U3D0|ASTC_SHIB3 Succinylornithine transaminase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=astC PE=3 SV=1 38 434 4.0E-71
sp|B7N584|ASTC_ECOLU Succinylornithine transaminase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=astC PE=3 SV=1 38 434 8.0E-71
sp|Q1RB45|ASTC_ECOUT Succinylornithine transaminase OS=Escherichia coli (strain UTI89 / UPEC) GN=astC PE=3 SV=1 38 434 8.0E-71
sp|Q8FGZ9|ASTC_ECOL6 Succinylornithine transaminase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=astC PE=3 SV=1 38 434 8.0E-71
sp|Q0TH82|ASTC_ECOL5 Succinylornithine transaminase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=astC PE=3 SV=1 38 434 8.0E-71
sp|A1ABS9|ASTC_ECOK1 Succinylornithine transaminase OS=Escherichia coli O1:K1 / APEC GN=astC PE=3 SV=1 38 434 8.0E-71
sp|B7MVM7|ASTC_ECO81 Succinylornithine transaminase OS=Escherichia coli O81 (strain ED1a) GN=astC PE=3 SV=1 38 434 8.0E-71
sp|B7MAV9|ASTC_ECO45 Succinylornithine transaminase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=astC PE=3 SV=1 38 434 8.0E-71
sp|Q9JTX9|ARGD_NEIMA Acetylornithine aminotransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=argD PE=3 SV=1 37 434 9.0E-71
sp|B7LQ44|ASTC_ESCF3 Succinylornithine transaminase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=astC PE=3 SV=1 38 434 1.0E-70
sp|B7USC9|ASTC_ECO27 Succinylornithine transaminase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=astC PE=3 SV=1 38 434 1.0E-70
sp|B1LDY3|ASTC_ECOSM Succinylornithine transaminase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=astC PE=3 SV=1 38 434 3.0E-70
sp|Q9KNW2|ARGD_VIBCH Acetylornithine aminotransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=argD PE=3 SV=1 38 434 3.0E-70
sp|Q8UI71|ARGD_AGRFC Acetylornithine aminotransferase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=argD PE=3 SV=1 42 441 4.0E-70
sp|P59319|ARGD_PSEPK Acetylornithine aminotransferase OS=Pseudomonas putida (strain KT2440) GN=argD PE=3 SV=1 37 434 7.0E-70
sp|Q8PX16|ARGD_METMA Acetylornithine aminotransferase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=argD PE=3 SV=1 36 430 8.0E-70
sp|P59324|ARGD_YERPE Acetylornithine/succinyldiaminopimelate aminotransferase OS=Yersinia pestis GN=argD PE=3 SV=2 38 431 2.0E-69
sp|P40732|ARGD_SALTY Acetylornithine/succinyldiaminopimelate aminotransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=argD PE=1 SV=3 22 434 3.0E-69
sp|Q7N9E5|ARGD_PHOLL Acetylornithine/succinyldiaminopimelate aminotransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=argD PE=3 SV=1 38 434 4.0E-69
sp|Q8TUZ5|ARGD_METKA Acetylornithine aminotransferase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=argD PE=3 SV=1 36 432 8.0E-69
sp|Q8Z1Z3|ARGD_SALTI Acetylornithine/succinyldiaminopimelate aminotransferase OS=Salmonella typhi GN=argD PE=3 SV=3 22 434 8.0E-69
sp|Q8TUE8|ARGD_METAC Acetylornithine aminotransferase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=argD PE=3 SV=2 30 430 1.0E-68
sp|Q882K8|ARGD2_PSESM Acetylornithine aminotransferase 2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=argD2 PE=3 SV=1 37 431 3.0E-68
sp|Q8PH31|ARGD_XANAC Acetylornithine aminotransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=argD PE=3 SV=1 38 433 4.0E-68
sp|P59322|ARGD_THEEB Acetylornithine aminotransferase OS=Thermosynechococcus elongatus (strain BP-1) GN=argD PE=3 SV=1 37 434 8.0E-68
sp|A1JS45|ASTC_YERE8 Succinylornithine transaminase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=astC PE=3 SV=1 38 440 2.0E-67
sp|Q92SA0|ARGD_RHIME Acetylornithine aminotransferase OS=Rhizobium meliloti (strain 1021) GN=argD PE=3 SV=1 37 432 4.0E-67
sp|Q8X4S6|ARGD_ECO57 Acetylornithine/succinyldiaminopimelate aminotransferase OS=Escherichia coli O157:H7 GN=argD PE=3 SV=3 22 434 5.0E-67
sp|Q7N2G7|ASTC_PHOLL Succinylornithine transaminase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=astC PE=3 SV=1 38 431 7.0E-67
sp|O30508|ARUC_PSEAE Succinylornithine transaminase/acetylornithine aminotransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aruC PE=1 SV=2 37 434 1.0E-66
sp|P59317|ARGD_ECOL6 Acetylornithine/succinyldiaminopimelate aminotransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=argD PE=3 SV=2 22 434 1.0E-66
sp|P18335|ARGD_ECOLI Acetylornithine/succinyldiaminopimelate aminotransferase OS=Escherichia coli (strain K12) GN=argD PE=1 SV=4 22 434 1.0E-66
sp|Q9I6M4|DAVT_PSEAE 5-aminovalerate aminotransferase DavT OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=davT PE=1 SV=1 42 434 3.0E-66
sp|P59321|ARGD_SHIFL Acetylornithine/succinyldiaminopimelate aminotransferase OS=Shigella flexneri GN=argD PE=3 SV=1 22 434 3.0E-66
sp|Q7WKW5|ARGD1_BORBR Acetylornithine aminotransferase 1 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=argD1 PE=3 SV=1 35 434 6.0E-66
sp|Q7VTJ7|ARGD1_BORPE Acetylornithine aminotransferase 1 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=argD1 PE=3 SV=1 35 434 7.0E-66
sp|O30156|ARGD_ARCFU Acetylornithine aminotransferase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=argD PE=3 SV=1 30 427 1.0E-65
sp|B5BA72|ASTC_SALPK Succinylornithine transaminase OS=Salmonella paratyphi A (strain AKU_12601) GN=astC PE=3 SV=1 38 434 1.0E-65
sp|Q5PHC8|ASTC_SALPA Succinylornithine transaminase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=astC PE=3 SV=1 38 434 1.0E-65
sp|Q7W7H6|ARGD1_BORPA Acetylornithine aminotransferase 1 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=argD1 PE=3 SV=2 35 434 2.0E-65
sp|Q9CNT1|ARGD_PASMU Acetylornithine aminotransferase OS=Pasteurella multocida (strain Pm70) GN=argD PE=3 SV=1 36 431 2.0E-65
sp|B5F846|ASTC_SALA4 Succinylornithine transaminase OS=Salmonella agona (strain SL483) GN=astC PE=3 SV=1 38 434 3.0E-65
sp|Q885K0|ARGD1_PSESM Acetylornithine aminotransferase 1 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=argD1 PE=3 SV=1 37 434 3.0E-65
sp|A7FIL6|ASTC_YERP3 Succinylornithine transaminase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=astC PE=3 SV=1 38 434 3.0E-65
sp|Q8Z6F9|ASTC_SALTI Succinylornithine transaminase OS=Salmonella typhi GN=astC PE=3 SV=1 38 434 4.0E-65
sp|A8AHE0|ASTC_CITK8 Succinylornithine transaminase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=astC PE=3 SV=1 38 434 6.0E-65
sp|A9N278|ASTC_SALPB Succinylornithine transaminase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=astC PE=3 SV=1 38 434 7.0E-65
sp|Q66B21|ASTC_YERPS Succinylornithine transaminase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=astC PE=3 SV=1 38 434 8.0E-65
sp|C0Q6X9|ASTC_SALPC Succinylornithine transaminase OS=Salmonella paratyphi C (strain RKS4594) GN=astC PE=3 SV=1 38 434 1.0E-64
sp|B4TGE0|ASTC_SALHS Succinylornithine transaminase OS=Salmonella heidelberg (strain SL476) GN=astC PE=3 SV=1 38 434 1.0E-64
sp|Q87DM8|ARGD_XYLFT Acetylornithine aminotransferase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=argD PE=3 SV=1 38 424 1.0E-64
sp|A9QZ63|ASTC_YERPG Succinylornithine transaminase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=astC PE=3 SV=1 38 434 1.0E-64
sp|Q8D0D7|ASTC_YERPE Succinylornithine transaminase OS=Yersinia pestis GN=astC PE=3 SV=2 38 434 1.0E-64
sp|Q1C8B1|ASTC_YERPA Succinylornithine transaminase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=astC PE=3 SV=1 38 434 1.0E-64
sp|B5FJD8|ASTC_SALDC Succinylornithine transaminase OS=Salmonella dublin (strain CT_02021853) GN=astC PE=3 SV=1 38 434 1.0E-64
sp|Q9PDF2|ARGD_XYLFA Acetylornithine aminotransferase OS=Xylella fastidiosa (strain 9a5c) GN=argD PE=3 SV=1 38 424 1.0E-64
sp|B5RB01|ASTC_SALG2 Succinylornithine transaminase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=astC PE=3 SV=1 38 434 1.0E-64
sp|B5QWJ0|ASTC_SALEP Succinylornithine transaminase OS=Salmonella enteritidis PT4 (strain P125109) GN=astC PE=3 SV=1 38 434 1.0E-64
sp|P59315|ARGD_BIFLO Acetylornithine aminotransferase OS=Bifidobacterium longum (strain NCC 2705) GN=argD PE=3 SV=1 44 436 1.0E-64
sp|Q8ZPV2|ASTC_SALTY Succinylornithine transaminase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=astC PE=2 SV=1 38 434 2.0E-64
sp|Q57PX9|ASTC_SALCH Succinylornithine transaminase OS=Salmonella choleraesuis (strain SC-B67) GN=astC PE=3 SV=1 38 434 5.0E-64
sp|B4T3Z4|ASTC_SALNS Succinylornithine transaminase OS=Salmonella newport (strain SL254) GN=astC PE=3 SV=1 38 434 6.0E-64
sp|Q98BB7|ARGD_RHILO Acetylornithine aminotransferase OS=Rhizobium loti (strain MAFF303099) GN=argD PE=3 SV=1 42 434 8.0E-64
sp|P59086|ARGD_BUCAP Acetylornithine/succinyldiaminopimelate aminotransferase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=argD PE=3 SV=1 38 425 1.0E-63
sp|Q8CUM9|ARGD_OCEIH Acetylornithine aminotransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=argD PE=3 SV=1 36 434 2.0E-63
sp|Q8P5Q4|ARGD_XANCP Acetylornithine aminotransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=argD PE=3 SV=1 38 431 2.0E-63
sp|P36839|ARGD_BACSU Acetylornithine aminotransferase OS=Bacillus subtilis (strain 168) GN=argD PE=3 SV=2 36 431 5.0E-63
sp|Q9K8V5|ARGD_BACHD Acetylornithine aminotransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=argD PE=3 SV=1 38 442 3.0E-62
sp|Q9M8M7|ARGD_ARATH Acetylornithine aminotransferase, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=WIN1 PE=1 SV=1 5 434 9.0E-62
sp|Q7WDN7|ARGD2_BORBR Acetylornithine aminotransferase 2 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=argD2 PE=3 SV=1 43 425 6.0E-61
sp|Q59282|ARGD_CORGL Acetylornithine aminotransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=argD PE=3 SV=2 36 431 6.0E-61
sp|Q9X2A5|ARGD_THEMA Acetylornithine aminotransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=argD PE=1 SV=1 36 432 9.0E-61
sp|Q7W2N9|ARGD2_BORPA Acetylornithine aminotransferase 2 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=argD2 PE=3 SV=1 43 425 9.0E-61
sp|Q7VSH3|ARGD2_BORPE Acetylornithine aminotransferase 2 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=argD2 PE=3 SV=1 43 425 1.0E-60
sp|Q7V0G0|ARGD_PROMP Acetylornithine aminotransferase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=argD PE=3 SV=2 36 434 1.0E-60
sp|P22256|GABT_ECOLI 4-aminobutyrate aminotransferase GabT OS=Escherichia coli (strain K12) GN=gabT PE=1 SV=1 42 433 1.0E-60
sp|P63567|ARGD_BRUSU Acetylornithine aminotransferase OS=Brucella suis biovar 1 (strain 1330) GN=argD PE=3 SV=1 37 434 2.0E-60
sp|P63566|ARGD_BRUME Acetylornithine aminotransferase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=argD PE=3 SV=1 37 434 2.0E-60
sp|O04866|ARGD_ALNGL Acetylornithine aminotransferase, mitochondrial OS=Alnus glutinosa GN=AG118 PE=2 SV=1 12 434 6.0E-60
sp|P30900|ARGD_RHOCB Acetylornithine aminotransferase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=argD PE=3 SV=2 37 434 8.0E-60
sp|Q7VMS5|ARGD_HAEDU Acetylornithine aminotransferase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=argD PE=3 SV=2 35 434 1.0E-59
sp|Q9CC12|ARGD_MYCLE Acetylornithine aminotransferase OS=Mycobacterium leprae (strain TN) GN=argD PE=3 SV=1 36 420 1.0E-59
sp|Q8FTN2|ARGD_COREF Acetylornithine aminotransferase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=argD PE=3 SV=1 36 421 2.0E-59
sp|P59316|ARGD_CHLTE Acetylornithine aminotransferase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=argD PE=3 SV=1 24 419 6.0E-59
sp|A0QYS9|ARGD_MYCS2 Acetylornithine aminotransferase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=argD PE=1 SV=1 36 421 7.0E-59
sp|Q5JFW3|ARGD_THEKO Acetylornithine aminotransferase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=argD PE=3 SV=1 47 422 8.0E-59
sp|A7MIU0|PAT_CROS8 Putrescine aminotransferase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=patA PE=3 SV=2 47 434 1.0E-58
sp|Q7MAE6|ARGD_WOLSU Acetylornithine aminotransferase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=argD PE=3 SV=2 28 432 1.0E-58
sp|Q5SHH5|ARGD_THET8 Acetylornithine/acetyl-lysine aminotransferase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=argD PE=1 SV=1 25 432 1.0E-58
sp|Q9RW75|ARGD_DEIRA Acetylornithine/acetyl-lysine aminotransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=argD PE=3 SV=2 27 420 2.0E-58
sp|Q82UP3|ARGD_NITEU Acetylornithine aminotransferase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=argD PE=3 SV=1 36 419 2.0E-58
sp|Q93R93|ARGD_THET2 Acetylornithine/acetyl-lysine aminotransferase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=argD PE=1 SV=1 25 432 5.0E-58
sp|Q88RB9|DAVT_PSEPK 5-aminovalerate aminotransferase DavT OS=Pseudomonas putida (strain KT2440) GN=davT PE=1 SV=1 42 434 6.0E-58
sp|Q7V8L1|ARGD_PROMM Acetylornithine aminotransferase OS=Prochlorococcus marinus (strain MIT 9313) GN=argD PE=3 SV=1 19 425 1.0E-57
sp|Q9AAL3|ARGD1_CAUCR Acetylornithine aminotransferase 1 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=argD1 PE=3 SV=1 47 440 1.0E-57
sp|Q75AW1|ARGD_ASHGO Acetylornithine aminotransferase, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ARG8 PE=3 SV=1 43 437 4.0E-57
sp|Q7VAS9|ARGD_PROMA Acetylornithine aminotransferase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=argD PE=3 SV=2 38 434 5.0E-57
sp|P59318|ARGD_MYXXA Acetylornithine aminotransferase OS=Myxococcus xanthus GN=argD PE=3 SV=1 36 420 1.0E-56
sp|Q8XWN8|ARGD_RALSO Acetylornithine aminotransferase OS=Ralstonia solanacearum (strain GMI1000) GN=argD PE=3 SV=1 43 432 3.0E-56
sp|Q81M98|ARGD_BACAN Acetylornithine aminotransferase OS=Bacillus anthracis GN=argD PE=3 SV=1 36 431 3.0E-56
sp|Q8U0B4|ARGD_PYRFU Acetylornithine/acetyl-lysine aminotransferase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=argD PE=3 SV=1 47 422 3.0E-56
sp|P9WPZ7|ARGD_MYCTU Acetylornithine aminotransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=argD PE=1 SV=1 36 420 6.0E-56
sp|P9WPZ6|ARGD_MYCTO Acetylornithine aminotransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=argD PE=3 SV=1 36 420 6.0E-56
sp|P63569|ARGD_MYCBO Acetylornithine aminotransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=argD PE=3 SV=1 36 420 6.0E-56
sp|Q818W2|ARGD_BACCR Acetylornithine aminotransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=argD PE=3 SV=2 36 431 1.0E-55
sp|Q55DT8|ARGD_DICDI Probable acetylornithine aminotransferase, mitochondrial OS=Dictyostelium discoideum GN=argD PE=3 SV=1 43 439 1.0E-55
sp|Q9V1I4|ARGD_PYRAB Acetylornithine/acetyl-lysine aminotransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=argD PE=3 SV=1 47 420 2.0E-55
sp|P24087|ARGD_LEPIN Acetylornithine aminotransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=argD PE=3 SV=2 31 433 2.0E-55
sp|Q72RH8|ARGD_LEPIC Acetylornithine aminotransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=argD PE=3 SV=1 31 433 2.0E-55
sp|Q7U5R5|ARGD_SYNPX Acetylornithine aminotransferase OS=Synechococcus sp. (strain WH8102) GN=argD PE=3 SV=1 36 434 1.0E-54
sp|Q6D6Y6|PAT_PECAS Putrescine aminotransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=patA PE=3 SV=1 47 434 2.0E-54
sp|Q31WW1|PAT_SHIBS Putrescine aminotransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=patA PE=3 SV=2 55 416 3.0E-54
sp|Q59928|ARGD_STRMU Acetylornithine aminotransferase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=argD PE=3 SV=2 36 433 3.0E-54
sp|A4WEQ6|PAT_ENT38 Putrescine aminotransferase OS=Enterobacter sp. (strain 638) GN=patA PE=3 SV=1 55 434 3.0E-54
sp|Q9P3I3|ARGD_NEUCR Acetylornithine aminotransferase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=arg-8 PE=3 SV=1 37 432 4.0E-54
sp|Q9A652|ARGD2_CAUCR Acetylornithine aminotransferase 2 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=argD2 PE=3 SV=1 38 419 5.0E-54
sp|Q0TD34|PAT_ECOL5 Putrescine aminotransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=patA PE=3 SV=2 47 431 6.0E-54
sp|A8APX8|PAT_CITK8 Putrescine aminotransferase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=patA PE=3 SV=2 55 434 6.0E-54
sp|B1LF65|PAT_ECOSM Putrescine aminotransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=patA PE=3 SV=2 47 431 6.0E-54
sp|A6TEB2|PAT_KLEP7 Putrescine aminotransferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=patA PE=3 SV=2 47 416 7.0E-54
sp|B5XTY7|PAT_KLEP3 Putrescine aminotransferase OS=Klebsiella pneumoniae (strain 342) GN=patA PE=3 SV=1 47 416 8.0E-54
sp|P94427|GABT_BACSU Probable 4-aminobutyrate aminotransferase OS=Bacillus subtilis (strain 168) GN=gabT PE=3 SV=1 47 432 8.0E-54
sp|O59401|ARGD_PYRHO Acetylornithine/acetyl-lysine aminotransferase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=argD PE=3 SV=1 47 431 1.0E-53
sp|B7ND61|PAT_ECOLU Putrescine aminotransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=patA PE=3 SV=2 47 416 1.0E-53
sp|Q1R6Q7|PAT_ECOUT Putrescine aminotransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=patA PE=3 SV=2 47 416 1.0E-53
sp|B6I445|PAT_ECOSE Putrescine aminotransferase OS=Escherichia coli (strain SE11) GN=patA PE=3 SV=2 47 416 1.0E-53
sp|A1AFZ3|PAT_ECOK1 Putrescine aminotransferase OS=Escherichia coli O1:K1 / APEC GN=patA PE=3 SV=2 47 416 1.0E-53
sp|B7N0M2|PAT_ECO81 Putrescine aminotransferase OS=Escherichia coli O81 (strain ED1a) GN=patA PE=3 SV=2 47 416 1.0E-53
sp|B5YRB3|PAT_ECO5E Putrescine aminotransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=patA PE=3 SV=1 47 416 1.0E-53
sp|Q8XAN1|PAT_ECO57 Putrescine aminotransferase OS=Escherichia coli O157:H7 GN=patA PE=3 SV=2 47 416 1.0E-53
sp|B7LH08|PAT_ECO55 Putrescine aminotransferase OS=Escherichia coli (strain 55989 / EAEC) GN=patA PE=3 SV=2 47 416 1.0E-53
sp|B7MB08|PAT_ECO45 Putrescine aminotransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=patA PE=3 SV=2 47 416 1.0E-53
sp|B7UIY0|PAT_ECO27 Putrescine aminotransferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=patA PE=3 SV=1 47 416 1.0E-53
sp|A7ZRV6|PAT_ECO24 Putrescine aminotransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=patA PE=3 SV=2 47 416 1.0E-53
sp|A8A4N0|PAT_ECOHS Putrescine aminotransferase OS=Escherichia coli O9:H4 (strain HS) GN=patA PE=3 SV=2 55 416 1.0E-53
sp|Q8Z3L9|PAT_SALTI Putrescine aminotransferase OS=Salmonella typhi GN=patA PE=3 SV=2 55 416 1.0E-53
sp|B4TIU6|PAT_SALHS Putrescine aminotransferase OS=Salmonella heidelberg (strain SL476) GN=patA PE=3 SV=1 55 416 1.0E-53
sp|P42588|PAT_ECOLI Putrescine aminotransferase OS=Escherichia coli (strain K12) GN=patA PE=1 SV=2 55 416 1.0E-53
sp|B1XG77|PAT_ECODH Putrescine aminotransferase OS=Escherichia coli (strain K12 / DH10B) GN=patA PE=3 SV=2 55 416 1.0E-53
sp|C4ZQY9|PAT_ECOBW Putrescine aminotransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=patA PE=3 SV=1 55 416 1.0E-53
sp|Q89VE9|ARGD1_BRADU Acetylornithine aminotransferase 1 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=argD1 PE=3 SV=1 39 442 2.0E-53
sp|Q83JJ8|PAT_SHIFL Putrescine aminotransferase OS=Shigella flexneri GN=patA PE=3 SV=5 47 416 2.0E-53
sp|Q0T0J2|PAT_SHIF8 Putrescine aminotransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=patA PE=3 SV=1 47 416 2.0E-53
sp|B7LZM2|PAT_ECO8A Putrescine aminotransferase OS=Escherichia coli O8 (strain IAI1) GN=patA PE=3 SV=2 47 416 2.0E-53
sp|B1IRP4|PAT_ECOLC Putrescine aminotransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=patA PE=3 SV=2 47 416 2.0E-53
sp|B7NJT8|PAT_ECO7I Putrescine aminotransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=patA PE=3 SV=2 55 416 3.0E-53
sp|B5BG29|PAT_SALPK Putrescine aminotransferase OS=Salmonella paratyphi A (strain AKU_12601) GN=patA PE=3 SV=2 55 416 4.0E-53
sp|Q5PC95|PAT_SALPA Putrescine aminotransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=patA PE=3 SV=2 55 416 4.0E-53
sp|O14433|ARGD_KLULA Acetylornithine aminotransferase, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ARG8 PE=3 SV=2 40 434 4.0E-53
sp|A9MPU4|PAT_SALAR Putrescine aminotransferase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=patA PE=3 SV=2 55 416 5.0E-53
sp|Q8ZLX7|PAT_SALTY Putrescine aminotransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=patA PE=3 SV=2 55 416 5.0E-53
sp|B4TVV2|PAT_SALSV Putrescine aminotransferase OS=Salmonella schwarzengrund (strain CVM19633) GN=patA PE=3 SV=1 55 416 5.0E-53
sp|B4T688|PAT_SALNS Putrescine aminotransferase OS=Salmonella newport (strain SL254) GN=patA PE=3 SV=1 55 416 5.0E-53
sp|B5F6B4|PAT_SALA4 Putrescine aminotransferase OS=Salmonella agona (strain SL483) GN=patA PE=3 SV=1 55 416 5.0E-53
sp|B5REH5|PAT_SALG2 Putrescine aminotransferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=patA PE=3 SV=2 55 416 7.0E-53
sp|B5QZ53|PAT_SALEP Putrescine aminotransferase OS=Salmonella enteritidis PT4 (strain P125109) GN=patA PE=3 SV=2 55 416 7.0E-53
sp|B5FHV3|PAT_SALDC Putrescine aminotransferase OS=Salmonella dublin (strain CT_02021853) GN=patA PE=3 SV=1 55 416 7.0E-53
sp|Q71Z79|ARGD_LISMF Acetylornithine aminotransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=argD PE=3 SV=1 38 432 8.0E-53
sp|B7LQF8|PAT_ESCF3 Putrescine aminotransferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=patA PE=3 SV=2 47 416 9.0E-53
sp|C0PYZ1|PAT_SALPC Putrescine aminotransferase OS=Salmonella paratyphi C (strain RKS4594) GN=patA PE=3 SV=2 55 416 1.0E-52
sp|Q57JP1|PAT_SALCH Putrescine aminotransferase OS=Salmonella choleraesuis (strain SC-B67) GN=patA PE=3 SV=1 55 416 1.0E-52
sp|Q8FDF5|PAT_ECOL6 Putrescine aminotransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=patA PE=3 SV=2 47 416 2.0E-52
sp|Q828A3|ARGD_STRAW Acetylornithine aminotransferase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=argD PE=3 SV=1 21 427 2.0E-52
sp|A9N5Z8|PAT_SALPB Putrescine aminotransferase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=patA PE=3 SV=1 55 416 3.0E-52
sp|Q3YXH0|PAT_SHISS Putrescine aminotransferase OS=Shigella sonnei (strain Ss046) GN=patA PE=3 SV=2 55 416 4.0E-52
sp|Q6C846|ARGD_YARLI Acetylornithine aminotransferase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ARG8 PE=3 SV=1 27 433 5.0E-52
sp|O74548|ARGD_SCHPO Probable acetylornithine aminotransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arg1 PE=2 SV=1 38 434 8.0E-52
sp|Q6BUP9|ARGD_DEBHA Acetylornithine aminotransferase, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ARG8 PE=3 SV=1 12 441 9.0E-52
sp|P30268|Y2045_BACPE Uncharacterized aminotransferase BpOF4_10225 OS=Bacillus pseudofirmus (strain OF4) GN=BpOF4_10225 PE=3 SV=2 39 442 1.0E-51
sp|Q976K0|ARGD_SULTO Acetylornithine/acetyl-lysine aminotransferase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=argD PE=3 SV=1 47 422 2.0E-51
sp|Q8Y6U4|ARGD_LISMO Acetylornithine aminotransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=argD PE=3 SV=1 38 432 2.0E-51
sp|Q9CHD3|ARGD_LACLA Acetylornithine aminotransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=argD PE=3 SV=1 36 427 2.0E-51
sp|Q9PIR7|ARGD_CAMJE Acetylornithine aminotransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=argD PE=1 SV=2 38 434 4.0E-51
sp|Q6ZH29|GATP4_ORYSJ Probable gamma-aminobutyrate transaminase 4 OS=Oryza sativa subsp. japonica GN=GABA-T PE=2 SV=1 42 436 4.0E-51
sp|Q7SI94|ARGD_SULSO Acetylornithine/acetyl-lysine aminotransferase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=argD PE=3 SV=2 38 420 2.0E-50
sp|Q5HP24|ARGD_STAEQ Acetylornithine aminotransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=argD PE=3 SV=1 36 431 7.0E-50
sp|Q92BC0|ARGD_LISIN Acetylornithine aminotransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=argD PE=3 SV=1 38 433 7.0E-50
sp|Q8CSG1|ARGD_STAES Acetylornithine aminotransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=argD PE=3 SV=2 36 431 3.0E-49
sp|B8BBZ7|GATP3_ORYSI Probable gamma-aminobutyrate transaminase 3, mitochondrial OS=Oryza sativa subsp. indica GN=OsI_28220 PE=3 SV=1 42 436 4.0E-49
sp|Q9L1A4|ARGD_STRCO Acetylornithine aminotransferase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=argD PE=3 SV=1 41 438 6.0E-49
sp|Q84P54|GATP1_SOLLC Gamma aminobutyrate transaminase 1, mitochondrial OS=Solanum lycopersicum GN=GABA-TP1 PE=1 SV=1 42 433 6.0E-49
sp|Q7XN11|GATP1_ORYSJ Gamma-aminobutyrate transaminase 1, mitochondrial OS=Oryza sativa subsp. japonica GN=OSL2 PE=1 SV=2 42 436 7.0E-49
sp|Q6ZCF0|GATP3_ORYSJ Probable gamma-aminobutyrate transaminase 3, mitochondrial OS=Oryza sativa subsp. japonica GN=Os08g0205900 PE=3 SV=1 42 436 9.0E-49
sp|Q07907|ARGD_GEOSE Acetylornithine aminotransferase OS=Geobacillus stearothermophilus GN=argD PE=3 SV=2 38 432 2.0E-48
sp|Q53196|Y4UB_RHISN Uncharacterized aminotransferase y4uB OS=Rhizobium sp. (strain NGR234) GN=NGR_a01380 PE=3 SV=1 42 434 2.0E-48
sp|Q01K11|GATP1_ORYSI Gamma-aminobutyrate transaminase 1, mitochondrial OS=Oryza sativa subsp. indica GN=OsI_17385 PE=3 SV=1 42 436 3.0E-48
sp|Q7XN12|GATP2_ORYSJ Probable gamma-aminobutyrate transaminase 2, mitochondrial OS=Oryza sativa subsp. japonica GN=Os04g0614500 PE=2 SV=2 42 436 3.0E-48
sp|Q01K12|GATP2_ORYSI Probable gamma-aminobutyrate transaminase 2, mitochondrial OS=Oryza sativa subsp. indica GN=OsI_17384 PE=3 SV=1 42 436 3.0E-48
sp|P33189|YHXA_BACSU Uncharacterized aminotransferase YhxA OS=Bacillus subtilis (strain 168) GN=yhxA PE=3 SV=4 43 434 4.0E-48
sp|Q84P52|GATP3_SOLLC Gamma aminobutyrate transaminase 3, chloroplastic OS=Solanum lycopersicum GN=GABA-TP3 PE=1 SV=1 42 439 8.0E-48
sp|Q829L4|ECTB_STRAW Diaminobutyrate--2-oxoglutarate transaminase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ectB PE=3 SV=1 42 433 9.0E-48
sp|P18544|ARGD_YEAST Acetylornithine aminotransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARG8 PE=1 SV=1 30 432 1.0E-47
sp|Q89LG2|ARGD2_BRADU Acetylornithine aminotransferase 2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=argD2 PE=3 SV=1 44 346 5.0E-47
sp|Q8ZV07|ARGD_PYRAE Acetylornithine/acetyl-lysine aminotransferase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=argD PE=3 SV=1 53 439 6.0E-47
sp|Q84P53|GATP2_SOLLC Gamma aminobutyrate transaminase 2 OS=Solanum lycopersicum GN=GABA-TP2 PE=1 SV=1 42 433 2.0E-46
sp|P50457|PUUE_ECOLI 4-aminobutyrate aminotransferase PuuE OS=Escherichia coli (strain K12) GN=puuE PE=1 SV=1 48 433 3.0E-46
sp|Q9KED4|ECTB_BACHD Diaminobutyrate--2-oxoglutarate transaminase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=ectB PE=3 SV=1 41 439 3.0E-46
sp|Q93RW1|ECTB_STRCO Diaminobutyrate--2-oxoglutarate transaminase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=ectB PE=3 SV=1 42 433 4.0E-46
sp|Q7M9K2|ECTB_WOLSU Diaminobutyrate--2-oxoglutarate transaminase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=ectB PE=3 SV=1 41 434 4.0E-46
sp|Q8ESU8|ECTB_OCEIH Diaminobutyrate--2-oxoglutarate transaminase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=ectB PE=3 SV=1 26 432 2.0E-45
sp|Q6QUY9|ECTB_STRAQ Diaminobutyrate--2-oxoglutarate transaminase OS=Streptomyces anulatus GN=ectB PE=3 SV=1 42 433 2.0E-45
sp|P16932|DGDA_BURCE 2,2-dialkylglycine decarboxylase OS=Burkholderia cepacia GN=dgdA PE=1 SV=3 42 433 2.0E-45
sp|Q9LCS5|ARGD_STRC2 Acetylornithine aminotransferase OS=Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602) GN=argD PE=3 SV=1 45 427 3.0E-45
sp|M1GRN3|ILE2E_LACBU Isoleucine 2-epimerase OS=Lactobacillus buchneri PE=1 SV=1 37 430 4.0E-45
sp|Q9AP34|ECTB_SPOPA Diaminobutyrate--2-oxoglutarate transaminase OS=Sporosarcina pasteurii GN=ectB PE=2 SV=1 30 434 1.0E-44
sp|P53555|BIOK_BACSU L-Lysine--8-amino-7-oxononanoate transaminase OS=Bacillus subtilis (strain 168) GN=bioK PE=1 SV=1 37 434 7.0E-44
sp|P56969|Y1815_ARCFU Uncharacterized aminotransferase AF_1815 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_1815 PE=3 SV=1 46 420 1.0E-43
sp|Q94CE5|GATP_ARATH Gamma-aminobutyrate transaminase POP2, mitochondrial OS=Arabidopsis thaliana GN=POP2 PE=1 SV=1 9 439 2.0E-43
sp|O08321|ARGD_LACPL Acetylornithine aminotransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=argD PE=3 SV=4 37 429 2.0E-43
sp|P40829|GABT_MYCLE 4-aminobutyrate aminotransferase OS=Mycobacterium leprae (strain TN) GN=gabT PE=3 SV=1 41 434 2.0E-43
sp|Q74CT9|BIOA_GEOSL Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=bioA PE=3 SV=1 36 420 7.0E-43
sp|Q6FXA4|ARGD_CANGA Acetylornithine aminotransferase, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ARG8 PE=3 SV=1 30 434 1.0E-42
sp|O34662|YODT_BACSU Uncharacterized aminotransferase YodT OS=Bacillus subtilis (strain 168) GN=yodT PE=3 SV=1 42 439 3.0E-42
sp|Q5YW77|ECTB_NOCFA Diaminobutyrate--2-oxoglutarate transaminase OS=Nocardia farcinica (strain IFM 10152) GN=ectB PE=3 SV=1 42 431 2.0E-41
sp|P44426|BIOA_HAEIN Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bioA PE=3 SV=1 27 422 2.0E-41
sp|O66557|BIOA_AQUAE Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Aquifex aeolicus (strain VF5) GN=bioA PE=3 SV=1 43 434 3.0E-41
sp|Q8BWU8|AT2L1_MOUSE Ethanolamine-phosphate phospho-lyase OS=Mus musculus GN=Etnppl PE=2 SV=1 42 421 8.0E-41
sp|Q9KLC2|ECTB_VIBCH Diaminobutyrate--2-oxoglutarate transaminase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ectB PE=3 SV=1 41 433 8.0E-41
sp|O06060|ECTB_MARHA Diaminobutyrate--2-oxoglutarate transaminase OS=Marinococcus halophilus GN=ectB PE=3 SV=1 41 434 9.0E-41
sp|Q9YBY6|ARGD_AERPE Acetylornithine/acetyl-lysine aminotransferase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=argD PE=3 SV=1 53 419 9.0E-41
sp|Q9APM5|TPA_BILWA Taurine--pyruvate aminotransferase OS=Bilophila wadsworthia GN=tpa PE=1 SV=1 42 420 1.0E-40
sp|P22805|BIOA_LYSSH Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Lysinibacillus sphaericus GN=bioA PE=1 SV=1 30 436 1.0E-40
sp|Q6PR32|ECTB_VIRPA Diaminobutyrate--2-oxoglutarate transaminase OS=Virgibacillus pantothenticus GN=ectB PE=3 SV=1 42 427 2.0E-40
sp|P56744|DAT_ACIBA Diaminobutyrate--2-oxoglutarate aminotransferase OS=Acinetobacter baumannii GN=dat PE=1 SV=1 41 431 3.0E-40
sp|P44951|DAT_HAEIN Diaminobutyrate--2-oxoglutarate aminotransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=dat PE=1 SV=1 41 431 4.0E-40
sp|Q5WL78|ECTB_BACSK Diaminobutyrate--2-oxoglutarate transaminase OS=Bacillus clausii (strain KSM-K16) GN=ectB PE=3 SV=1 41 432 1.0E-39
sp|Q8A7T2|BIOAB_BACTN Biotin biosynthesis bifunctional protein BioAB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=bioB PE=3 SV=2 40 434 3.0E-39
sp|Q7W979|ECTB_BORPA Diaminobutyrate--2-oxoglutarate transaminase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=ectB PE=3 SV=1 41 443 4.0E-39
sp|Q7WHI8|ECTB_BORBR Diaminobutyrate--2-oxoglutarate transaminase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=ectB PE=3 SV=1 41 443 4.0E-39
sp|P91408|AGT2L_CAEEL Alanine--glyoxylate aminotransferase 2-like OS=Caenorhabditis elegans GN=T01B11.2 PE=3 SV=1 38 420 5.0E-39
sp|Q9ZEU7|ECTB_CHRSD Diaminobutyrate--2-oxoglutarate transaminase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=ectB PE=3 SV=1 41 434 9.0E-39
sp|D5AKY0|TPA_RHOCB Taurine--pyruvate aminotransferase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=tpa PE=2 SV=1 42 434 3.0E-38
sp|Q9I700|BAUA_PSEAE Beta-alanine--pyruvate aminotransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=bauA PE=1 SV=1 24 432 3.0E-38
sp|E1V7V7|DOED_HALED Diaminobutyrate--2-oxoglutarate transaminase OS=Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9) GN=doeD PE=3 SV=1 44 420 4.0E-38
sp|Q9ZKM5|BIOA_HELPJ Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=bioA PE=3 SV=1 36 434 6.0E-38
sp|B7GHM5|BIOA_ANOFW Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=bioA PE=3 SV=1 37 436 7.0E-38
sp|P12677|BIOA_SALTY Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=bioA PE=3 SV=2 40 431 1.0E-37
sp|Q2FVJ6|BIOA_STAA8 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Staphylococcus aureus (strain NCTC 8325) GN=bioA PE=3 SV=1 43 434 3.0E-37
sp|Q9US34|YFZ7_SCHPO Uncharacterized aminotransferase C1039.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.07c PE=3 SV=1 42 431 4.0E-37
sp|Q64VX4|BIOAB_BACFR Biotin biosynthesis bifunctional protein BioAB OS=Bacteroides fragilis (strain YCH46) GN=bioB PE=3 SV=1 39 422 7.0E-37
sp|O53379|Y3329_MYCTU Probable aminotransferase Rv3329 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3329 PE=1 SV=2 22 420 8.0E-37
sp|Q9Z3R2|RHBA_RHIME Diaminobutyrate--2-oxoglutarate aminotransferase OS=Rhizobium meliloti (strain 1021) GN=rhbA PE=3 SV=1 41 438 8.0E-37
sp|Q5LEY1|BIOAB_BACFN Biotin biosynthesis bifunctional protein BioAB OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=bioB PE=3 SV=1 39 422 9.0E-37
sp|E1WTS4|BIOAB_BACF6 Biotin biosynthesis bifunctional protein BioAB OS=Bacteroides fragilis (strain 638R) GN=bioB PE=3 SV=1 39 422 1.0E-36
sp|Q94AL9|AGT22_ARATH Alanine--glyoxylate aminotransferase 2 homolog 2, mitochondrial OS=Arabidopsis thaliana GN=AGT3 PE=1 SV=2 53 419 2.0E-36
sp|Q58696|BIOA_METJA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=bioA PE=3 SV=2 43 433 2.0E-36
sp|Q9SR86|AGT23_ARATH Alanine--glyoxylate aminotransferase 2 homolog 3, mitochondrial OS=Arabidopsis thaliana GN=At3g08860 PE=2 SV=1 22 434 2.0E-36
sp|Q17QF0|AGT2_BOVIN Alanine--glyoxylate aminotransferase 2, mitochondrial OS=Bos taurus GN=AGXT2 PE=2 SV=1 38 431 3.0E-36
sp|P9WQ79|GABT_MYCTU 4-aminobutyrate aminotransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=gabT PE=1 SV=1 41 434 3.0E-36
sp|P9WQ78|GABT_MYCTO 4-aminobutyrate aminotransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=gabT PE=3 SV=1 41 434 3.0E-36
sp|P63505|GABT_MYCBO 4-aminobutyrate aminotransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=gabT PE=3 SV=1 41 434 3.0E-36
sp|Q64565|AGT2_RAT Alanine--glyoxylate aminotransferase 2, mitochondrial OS=Rattus norvegicus GN=Agxt2 PE=1 SV=2 38 433 1.0E-35
sp|Q7SY54|AT2L1_DANRE Ethanolamine-phosphate phospho-lyase OS=Danio rerio GN=etnppl PE=2 SV=1 42 434 1.0E-35
sp|Q6DEB1|AT2L1_XENLA Ethanolamine-phosphate phospho-lyase OS=Xenopus laevis GN=etnppl PE=2 SV=1 42 421 1.0E-35
sp|Q3UEG6|AGT2_MOUSE Alanine--glyoxylate aminotransferase 2, mitochondrial OS=Mus musculus GN=Agxt2 PE=1 SV=1 26 431 2.0E-35
sp|Q8TBG4|AT2L1_HUMAN Ethanolamine-phosphate phospho-lyase OS=Homo sapiens GN=ETNPPL PE=1 SV=1 42 421 2.0E-35
sp|Q73DX4|GSA1_BACC1 Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=hemL1 PE=3 SV=1 42 353 2.0E-35
sp|Q5RFA3|AGT2_PONAB Alanine--glyoxylate aminotransferase 2, mitochondrial OS=Pongo abelii GN=AGXT2 PE=2 SV=1 38 433 2.0E-35
sp|B9J3N2|GSA1_BACCQ Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Bacillus cereus (strain Q1) GN=hemL1 PE=3 SV=1 42 353 3.0E-35
sp|B7HU66|GSA1_BACC7 Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Bacillus cereus (strain AH187) GN=hemL1 PE=3 SV=1 42 353 3.0E-35
sp|B7IW22|GSA2_BACC2 Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Bacillus cereus (strain G9842) GN=hemL2 PE=3 SV=1 42 353 3.0E-35
sp|Q81I85|GSA1_BACCR Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=hemL1 PE=3 SV=1 42 353 3.0E-35
sp|B7H9S6|GSA1_BACC4 Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Bacillus cereus (strain B4264) GN=hemL1 PE=3 SV=1 42 353 3.0E-35
sp|Q6HNS8|GSA1_BACHK Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=hemL1 PE=3 SV=1 42 353 3.0E-35
sp|C1EWG6|GSA1_BACC3 Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Bacillus cereus (strain 03BB102) GN=hemL1 PE=3 SV=1 42 353 3.0E-35
sp|A0R9G6|GSA1_BACAH Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=hemL1 PE=3 SV=1 42 353 3.0E-35
sp|Q87NZ7|ECTB_VIBPA Diaminobutyrate--2-oxoglutarate transaminase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=ectB PE=3 SV=1 41 434 3.0E-35
sp|O52250|ECTB_HALED Diaminobutyrate--2-oxoglutarate transaminase OS=Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9) GN=ectB PE=1 SV=1 30 433 3.0E-35
sp|Q63GB4|GSA1_BACCZ Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Bacillus cereus (strain ZK / E33L) GN=hemL1 PE=3 SV=1 42 353 3.0E-35
sp|C3LHA0|GSA1_BACAC Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=hemL1 PE=3 SV=1 42 353 3.0E-35
sp|Q81YV0|GSA1_BACAN Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Bacillus anthracis GN=hemL1 PE=1 SV=1 42 353 4.0E-35
sp|C3PCZ3|GSA1_BACAA Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Bacillus anthracis (strain A0248) GN=hemL1 PE=3 SV=1 42 353 4.0E-35
sp|Q728P4|BIOA_DESVH Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=bioA PE=3 SV=1 34 436 4.0E-35
sp|B7JNG6|GSA1_BACC0 Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Bacillus cereus (strain AH820) GN=hemL1 PE=3 SV=1 42 353 4.0E-35
sp|Q5E9S4|AT2L1_BOVIN Ethanolamine-phosphate phospho-lyase OS=Bos taurus GN=ETNPPL PE=2 SV=1 42 421 1.0E-34
sp|Q5SJS4|GSA_THET8 Glutamate-1-semialdehyde 2,1-aminomutase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=hemL PE=1 SV=1 42 335 1.0E-34
sp|Q65M82|GSA1_BACLD Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=hemL1 PE=3 SV=1 42 436 2.0E-34
sp|Q72K83|GSA_THET2 Glutamate-1-semialdehyde 2,1-aminomutase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=hemL PE=3 SV=1 42 335 2.0E-34
sp|Q5ZVA6|GSA_LEGPH Glutamate-1-semialdehyde 2,1-aminomutase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=hemL PE=3 SV=2 42 345 2.0E-34
sp|A3DIF3|GSA_CLOTH Glutamate-1-semialdehyde 2,1-aminomutase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=hemL PE=3 SV=1 42 364 2.0E-34
sp|C0QQ98|GSA_PERMH Glutamate-1-semialdehyde 2,1-aminomutase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=hemL PE=3 SV=1 42 356 2.0E-34
sp|Q9BYV1|AGT2_HUMAN Alanine--glyoxylate aminotransferase 2, mitochondrial OS=Homo sapiens GN=AGXT2 PE=1 SV=1 38 433 3.0E-34
sp|A7GL00|GSA1_BACCN Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=hemL1 PE=3 SV=1 42 353 3.0E-34
sp|P53656|BIOA_ESCVU Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Escherichia vulneris GN=bioA PE=3 SV=1 29 431 4.0E-34
sp|B8GLE4|GSA_THISH Glutamate-1-semialdehyde 2,1-aminomutase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=hemL PE=3 SV=1 42 333 4.0E-34
sp|O29027|GSA_ARCFU Glutamate-1-semialdehyde 2,1-aminomutase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=hemL PE=3 SV=1 38 354 4.0E-34
sp|A5EXX1|GSA_DICNV Glutamate-1-semialdehyde 2,1-aminomutase OS=Dichelobacter nodosus (strain VCS1703A) GN=hemL PE=3 SV=1 42 336 5.0E-34
sp|A9VSS7|GSA1_BACWK Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=hemL1 PE=3 SV=1 42 353 5.0E-34
sp|Q5X529|GSA_LEGPA Glutamate-1-semialdehyde 2,1-aminomutase OS=Legionella pneumophila (strain Paris) GN=hemL PE=3 SV=1 42 345 6.0E-34
sp|P57379|BIOA_BUCAI Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=bioA PE=3 SV=1 34 433 7.0E-34
sp|O25627|BIOA_HELPY Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=bioA PE=3 SV=1 37 434 7.0E-34
sp|B3PL68|GSA_CELJU Glutamate-1-semialdehyde 2,1-aminomutase OS=Cellvibrio japonicus (strain Ueda107) GN=hemL PE=3 SV=1 42 356 1.0E-33
sp|A5IC29|GSA_LEGPC Glutamate-1-semialdehyde 2,1-aminomutase OS=Legionella pneumophila (strain Corby) GN=hemL PE=3 SV=1 42 345 1.0E-33
sp|Q5WIE9|GSA1_BACSK Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Bacillus clausii (strain KSM-K16) GN=hemL1 PE=3 SV=1 42 377 1.0E-33
sp|Q5WWG1|GSA_LEGPL Glutamate-1-semialdehyde 2,1-aminomutase OS=Legionella pneumophila (strain Lens) GN=hemL PE=3 SV=1 42 345 2.0E-33
sp|Q9KEB0|GSA1_BACHD Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=hemL1 PE=3 SV=1 42 377 2.0E-33
sp|P12995|BIOA_ECOLI Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Escherichia coli (strain K12) GN=bioA PE=1 SV=2 29 433 2.0E-33
sp|E6SRG2|BIOAB_BACT6 Biotin biosynthesis bifunctional protein BioAB OS=Bacteroides helcogenes (strain ATCC 35417 / DSM 20613 / JCM 6297 / P 36-108) GN=bioB PE=3 SV=1 40 434 2.0E-33
sp|A7Z2N8|GSA1_BACMF Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=hemL1 PE=3 SV=1 42 378 4.0E-33
sp|A8FB92|GSA1_BACP2 Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Bacillus pumilus (strain SAFR-032) GN=hemL1 PE=3 SV=1 42 355 4.0E-33
sp|P71084|GSAB_BACSU Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Bacillus subtilis (strain 168) GN=gsaB PE=3 SV=2 42 434 7.0E-33
sp|B1HVD3|GSA2_LYSSC Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Lysinibacillus sphaericus (strain C3-41) GN=hemL2 PE=3 SV=1 42 403 7.0E-33
sp|Q2IHP8|GSA_ANADE Glutamate-1-semialdehyde 2,1-aminomutase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=hemL PE=3 SV=1 42 360 7.0E-33
sp|C4L367|GSA1_EXISA Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=hemL1 PE=3 SV=1 42 377 8.0E-33
sp|A8MGY8|GSA_ALKOO Glutamate-1-semialdehyde 2,1-aminomutase OS=Alkaliphilus oremlandii (strain OhILAs) GN=hemL PE=3 SV=1 42 434 9.0E-33
sp|Q5L2S4|GSA1_GEOKA Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Geobacillus kaustophilus (strain HTA426) GN=hemL1 PE=3 SV=1 42 434 9.0E-33
sp|C1DUY4|GSA_SULAA Glutamate-1-semialdehyde 2,1-aminomutase OS=Sulfurihydrogenibium azorense (strain Az-Fu1 / DSM 15241 / OCM 825) GN=hemL PE=3 SV=1 42 335 1.0E-32
sp|B1HUT1|GSA1_LYSSC Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Lysinibacillus sphaericus (strain C3-41) GN=hemL1 PE=3 SV=1 42 355 1.0E-32
sp|B4UKE6|GSA_ANASK Glutamate-1-semialdehyde 2,1-aminomutase OS=Anaeromyxobacter sp. (strain K) GN=hemL PE=3 SV=1 42 335 1.0E-32
sp|B8JCU6|GSA_ANAD2 Glutamate-1-semialdehyde 2,1-aminomutase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=hemL PE=3 SV=1 42 335 1.0E-32
sp|P28269|OAPT_PSEPU Omega-amino acid--pyruvate aminotransferase OS=Pseudomonas putida PE=1 SV=1 19 434 2.0E-32
sp|Q18ES5|GSA_HALWD Glutamate-1-semialdehyde 2,1-aminomutase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=hemL PE=3 SV=1 39 358 2.0E-32
sp|Q67KM3|GSA_SYMTH Glutamate-1-semialdehyde 2,1-aminomutase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=hemL PE=3 SV=1 42 333 2.0E-32
sp|Q3A7W5|GSA_PELCD Glutamate-1-semialdehyde 2,1-aminomutase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=hemL PE=3 SV=1 42 353 2.0E-32
sp|Q7UPM9|GSA_RHOBA Glutamate-1-semialdehyde 2,1-aminomutase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=hemL PE=3 SV=1 5 353 3.0E-32
sp|Q8YS26|GSA_NOSS1 Glutamate-1-semialdehyde 2,1-aminomutase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hemL PE=3 SV=2 42 353 4.0E-32
sp|B7IHH3|GSA_THEAB Glutamate-1-semialdehyde 2,1-aminomutase OS=Thermosipho africanus (strain TCF52B) GN=hemL PE=3 SV=1 42 371 4.0E-32
sp|C0Z671|GSA1_BREBN Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=hemL1 PE=3 SV=1 42 402 5.0E-32
sp|B2J7M9|GSA_NOSP7 Glutamate-1-semialdehyde 2,1-aminomutase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=hemL PE=3 SV=1 42 353 8.0E-32
sp|B2A1H4|GSA_NATTJ Glutamate-1-semialdehyde 2,1-aminomutase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=hemL PE=3 SV=1 42 336 9.0E-32
sp|P55628|Y4QG_RHISN Uncharacterized aminotransferase y4qG OS=Rhizobium sp. (strain NGR234) GN=NGR_a01910 PE=3 SV=1 41 431 1.0E-31
sp|Q12WM7|GSA_METBU Glutamate-1-semialdehyde 2,1-aminomutase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=hemL PE=3 SV=1 40 353 1.0E-31
sp|B9E7Y3|GSA2_MACCJ Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Macrococcus caseolyticus (strain JCSC5402) GN=hemL2 PE=3 SV=1 42 378 1.0E-31
sp|B1X023|GSA_CYAA5 Glutamate-1-semialdehyde 2,1-aminomutase OS=Cyanothece sp. (strain ATCC 51142) GN=hemL PE=3 SV=2 42 353 1.0E-31
sp|B5EFG4|GSA_GEOBB Glutamate-1-semialdehyde 2,1-aminomutase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=hemL PE=3 SV=1 42 335 1.0E-31
sp|Q39566|GSA_CHLRE Glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic OS=Chlamydomonas reinhardtii GN=GSA PE=2 SV=1 42 333 1.0E-31
sp|Q10174|YAV5_SCHPO Uncharacterized aminotransferase C27F1.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC27F1.05c PE=3 SV=1 125 441 2.0E-31
sp|Q2S8X9|GSA_HAHCH Glutamate-1-semialdehyde 2,1-aminomutase OS=Hahella chejuensis (strain KCTC 2396) GN=hemL PE=3 SV=1 42 335 2.0E-31
sp|Q7M181|ACLR_ACHOB 2-aminohexano-6-lactam racemase OS=Achromobacter obae PE=1 SV=1 41 434 3.0E-31
sp|B8HYK1|GSA_CYAP4 Glutamate-1-semialdehyde 2,1-aminomutase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=hemL PE=3 SV=1 42 335 3.0E-31
sp|B7GIK0|GSA1_ANOFW Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=hemL1 PE=3 SV=2 42 353 3.0E-31
sp|Q8IUZ5|AT2L2_HUMAN 5-phosphohydroxy-L-lysine phospho-lyase OS=Homo sapiens GN=PHYKPL PE=1 SV=1 42 440 3.0E-31
sp|A1ASE9|GSA_PELPD Glutamate-1-semialdehyde 2,1-aminomutase OS=Pelobacter propionicus (strain DSM 2379) GN=hemL PE=3 SV=1 42 335 3.0E-31
sp|B1YK58|GSA1_EXIS2 Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=hemL1 PE=3 SV=1 42 377 4.0E-31
sp|A4IKL1|GSA1_GEOTN Glutamate-1-semialdehyde 2,1-aminomutase 1 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=hemL1 PE=3 SV=1 42 353 4.0E-31
sp|A0LIP3|GSA_SYNFM Glutamate-1-semialdehyde 2,1-aminomutase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=hemL PE=3 SV=1 42 336 5.0E-31
sp|B2VE25|GSA_ERWT9 Glutamate-1-semialdehyde 2,1-aminomutase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=hemL PE=3 SV=1 41 355 5.0E-31
sp|Q5UZ90|GSA_HALMA Glutamate-1-semialdehyde 2,1-aminomutase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=hemL PE=3 SV=1 40 353 6.0E-31
sp|P9WQ81|BIOA_MYCTU Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=bioA PE=1 SV=1 62 435 6.0E-31
sp|P9WQ80|BIOA_MYCTO Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=bioA PE=3 SV=1 62 435 6.0E-31
sp|P0A4X7|BIOA_MYCBO Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=bioA PE=3 SV=1 62 435 6.0E-31
sp|Q9HKM6|GSA_THEAC Glutamate-1-semialdehyde 2,1-aminomutase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=hemL PE=3 SV=2 18 344 7.0E-31
sp|Q8R1K4|AT2L2_MOUSE 5-phosphohydroxy-L-lysine phospho-lyase OS=Mus musculus GN=Phykpl PE=1 SV=1 42 416 8.0E-31
sp|Q940M2|AGT21_ARATH Alanine--glyoxylate aminotransferase 2 homolog 1, mitochondrial OS=Arabidopsis thaliana GN=AGT2 PE=2 SV=1 37 419 8.0E-31
sp|Q3M3B9|GSA_ANAVT Glutamate-1-semialdehyde 2,1-aminomutase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=hemL PE=3 SV=1 42 353 9.0E-31
sp|A9KSC7|GSA2_CLOPH Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=hemL2 PE=3 SV=1 42 385 9.0E-31
sp|B9LZL6|GSA_GEODF Glutamate-1-semialdehyde 2,1-aminomutase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=hemL PE=3 SV=1 42 354 1.0E-30
sp|Q2JMP7|GSA_SYNJB Glutamate-1-semialdehyde 2,1-aminomutase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=hemL PE=3 SV=1 42 353 1.0E-30
sp|Q5KWK9|GSA2_GEOKA Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Geobacillus kaustophilus (strain HTA426) GN=hemL2 PE=3 SV=1 42 347 1.0E-30
sp|P36568|BIOA_SERMA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Serratia marcescens GN=bioA PE=3 SV=1 23 432 1.0E-30
sp|B8I0R1|GSA_CLOCE Glutamate-1-semialdehyde 2,1-aminomutase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=hemL PE=3 SV=1 42 360 1.0E-30
sp|B7KA18|GSA_CYAP7 Glutamate-1-semialdehyde 2,1-aminomutase OS=Cyanothece sp. (strain PCC 7424) GN=hemL PE=3 SV=1 42 366 2.0E-30
sp|Q39QA6|GSA_GEOMG Glutamate-1-semialdehyde 2,1-aminomutase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=hemL PE=3 SV=1 42 336 2.0E-30
sp|B0CC57|GSA_ACAM1 Glutamate-1-semialdehyde 2,1-aminomutase OS=Acaryochloris marina (strain MBIC 11017) GN=hemL PE=3 SV=1 42 366 2.0E-30
sp|Q5FAH9|GSA_NEIG1 Glutamate-1-semialdehyde 2,1-aminomutase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=hemL PE=3 SV=1 41 358 2.0E-30
sp|Q74GA9|GSA_GEOSL Glutamate-1-semialdehyde 2,1-aminomutase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=hemL PE=3 SV=1 42 347 2.0E-30
sp|B4RNX2|GSA_NEIG2 Glutamate-1-semialdehyde 2,1-aminomutase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=hemL PE=3 SV=1 41 358 2.0E-30
sp|Q2JS70|GSA_SYNJA Glutamate-1-semialdehyde 2,1-aminomutase OS=Synechococcus sp. (strain JA-3-3Ab) GN=hemL PE=3 SV=1 42 366 2.0E-30
sp|A4J6H0|GSA_DESRM Glutamate-1-semialdehyde 2,1-aminomutase OS=Desulfotomaculum reducens (strain MI-1) GN=hemL PE=3 SV=1 42 353 2.0E-30
sp|B4S0D0|GSA_ALTMD Glutamate-1-semialdehyde 2,1-aminomutase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=hemL PE=3 SV=2 42 350 2.0E-30
sp|A1V9X6|GSA_DESVV Glutamate-1-semialdehyde 2,1-aminomutase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=hemL PE=3 SV=1 42 369 2.0E-30
sp|Q0I8G1|GSA_SYNS3 Glutamate-1-semialdehyde 2,1-aminomutase OS=Synechococcus sp. (strain CC9311) GN=hemL PE=3 SV=1 42 345 2.0E-30
sp|A2C7I7|GSA_PROM3 Glutamate-1-semialdehyde 2,1-aminomutase OS=Prochlorococcus marinus (strain MIT 9303) GN=hemL PE=3 SV=1 42 336 2.0E-30
sp|A8G9U7|GSA_SERP5 Glutamate-1-semialdehyde 2,1-aminomutase OS=Serratia proteamaculans (strain 568) GN=hemL PE=3 SV=1 41 353 2.0E-30
sp|Q82UQ8|GSA_NITEU Glutamate-1-semialdehyde 2,1-aminomutase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=hemL PE=3 SV=1 42 358 2.0E-30
sp|A5UML0|GSA_METS3 Glutamate-1-semialdehyde 2,1-aminomutase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=hemL PE=3 SV=1 38 356 3.0E-30
sp|A9A875|GSA_METM6 Glutamate-1-semialdehyde 2,1-aminomutase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=hemL PE=3 SV=1 36 351 3.0E-30
sp|A1WYL3|GSA_HALHL Glutamate-1-semialdehyde 2,1-aminomutase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=hemL PE=3 SV=1 42 333 4.0E-30
sp|Q3IT20|GSA_NATPD Glutamate-1-semialdehyde 2,1-aminomutase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=hemL PE=3 SV=1 39 356 4.0E-30
sp|Q7V677|GSA_PROMM Glutamate-1-semialdehyde 2,1-aminomutase OS=Prochlorococcus marinus (strain MIT 9313) GN=hemL PE=3 SV=1 42 336 4.0E-30
sp|Q0AFV1|GSA_NITEC Glutamate-1-semialdehyde 2,1-aminomutase OS=Nitrosomonas eutropha (strain C91) GN=hemL PE=3 SV=1 42 382 4.0E-30
sp|A2BVE5|GSA_PROM5 Glutamate-1-semialdehyde 2,1-aminomutase OS=Prochlorococcus marinus (strain MIT 9515) GN=hemL PE=3 SV=2 42 389 4.0E-30
sp|Q2KUS4|GSA_BORA1 Glutamate-1-semialdehyde 2,1-aminomutase OS=Bordetella avium (strain 197N) GN=hemL PE=3 SV=1 42 345 4.0E-30
sp|Q31FB1|GSA_THICR Glutamate-1-semialdehyde 2,1-aminomutase OS=Thiomicrospira crunogena (strain XCL-2) GN=hemL PE=3 SV=1 42 335 4.0E-30
sp|Q9ZJ10|ARGD_BACAM Acetylornithine aminotransferase (Fragment) OS=Bacillus amyloliquefaciens GN=argD PE=3 SV=1 36 276 5.0E-30
sp|Q3ACS9|GSA_CARHZ Glutamate-1-semialdehyde 2,1-aminomutase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=hemL PE=3 SV=1 42 353 6.0E-30
sp|Q725I1|GSA_DESVH Glutamate-1-semialdehyde 2,1-aminomutase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=hemL PE=3 SV=1 42 369 6.0E-30
sp|A7HIX3|GSA_ANADF Glutamate-1-semialdehyde 2,1-aminomutase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=hemL PE=3 SV=1 42 360 7.0E-30
sp|A5G9C0|GSA_GEOUR Glutamate-1-semialdehyde 2,1-aminomutase OS=Geobacter uraniireducens (strain Rf4) GN=hemL PE=3 SV=1 42 354 7.0E-30
sp|Q6L2G9|GSA_PICTO Glutamate-1-semialdehyde 2,1-aminomutase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=hemL PE=3 SV=1 38 337 8.0E-30
sp|Q8Y6J9|GSA2_LISMO Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=hemL2 PE=3 SV=1 41 353 8.0E-30
sp|Q24VD4|GSA_DESHY Glutamate-1-semialdehyde 2,1-aminomutase OS=Desulfitobacterium hafniense (strain Y51) GN=hemL PE=3 SV=1 42 356 8.0E-30
sp|Q9K8G3|GSA2_BACHD Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=hemL2 PE=3 SV=1 42 356 8.0E-30
sp|B5YHH6|GSA_THEYD Glutamate-1-semialdehyde 2,1-aminomutase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=hemL PE=3 SV=1 42 353 8.0E-30
sp|Q5QVP9|GSA_IDILO Glutamate-1-semialdehyde 2,1-aminomutase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=hemL PE=3 SV=1 42 353 8.0E-30
sp|A2BL27|GSA_HYPBU Glutamate-1-semialdehyde 2,1-aminomutase OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=hemL PE=3 SV=1 40 335 9.0E-30
sp|P24630|GSA_SYNP6 Glutamate-1-semialdehyde 2,1-aminomutase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=hemL PE=1 SV=4 42 347 9.0E-30
sp|Q31QJ2|GSA_SYNE7 Glutamate-1-semialdehyde 2,1-aminomutase OS=Synechococcus elongatus (strain PCC 7942) GN=hemL PE=1 SV=3 42 347 9.0E-30
sp|B8G2L6|GSA_DESHD Glutamate-1-semialdehyde 2,1-aminomutase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=hemL PE=3 SV=1 42 336 9.0E-30
sp|Q46GT9|GSA_PROMT Glutamate-1-semialdehyde 2,1-aminomutase OS=Prochlorococcus marinus (strain NATL2A) GN=hemL PE=3 SV=1 42 336 9.0E-30
sp|C0QCR9|GSA_DESAH Glutamate-1-semialdehyde 2,1-aminomutase OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=hemL PE=3 SV=1 42 335 9.0E-30
sp|A6LKX4|GSA_THEM4 Glutamate-1-semialdehyde 2,1-aminomutase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=hemL PE=3 SV=1 42 365 1.0E-29
sp|B4EUE1|GSA_PROMH Glutamate-1-semialdehyde 2,1-aminomutase OS=Proteus mirabilis (strain HI4320) GN=hemL PE=3 SV=1 42 353 1.0E-29
sp|A2C0U2|GSA_PROM1 Glutamate-1-semialdehyde 2,1-aminomutase OS=Prochlorococcus marinus (strain NATL1A) GN=hemL PE=3 SV=1 42 336 1.0E-29
sp|Q0I3R7|GSA_HAES1 Glutamate-1-semialdehyde 2,1-aminomutase OS=Haemophilus somnus (strain 129Pt) GN=hemL PE=3 SV=1 42 345 1.0E-29
sp|A9A1A0|GSA_NITMS Glutamate-1-semialdehyde 2,1-aminomutase OS=Nitrosopumilus maritimus (strain SCM1) GN=hemL PE=3 SV=1 38 335 1.0E-29
sp|Q1QSB0|GSA_CHRSD Glutamate-1-semialdehyde 2,1-aminomutase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=hemL PE=3 SV=1 42 335 1.0E-29
sp|A3PBK8|GSA_PROM0 Glutamate-1-semialdehyde 2,1-aminomutase OS=Prochlorococcus marinus (strain MIT 9301) GN=hemL PE=3 SV=1 42 336 1.0E-29
sp|Q55665|GSA_SYNY3 Glutamate-1-semialdehyde 2,1-aminomutase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=hemL PE=3 SV=2 42 335 1.0E-29
sp|Q7V2J3|GSA_PROMP Glutamate-1-semialdehyde 2,1-aminomutase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=hemL PE=3 SV=1 42 336 1.0E-29
sp|Q1LQM3|GSA_CUPMC Glutamate-1-semialdehyde 2,1-aminomutase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=hemL PE=3 SV=1 42 347 2.0E-29
sp|Q71YY2|GSA2_LISMF Glutamate-1-semialdehyde 2,1-aminomutase 2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=hemL2 PE=3 SV=1 41 357 2.0E-29
sp|Q97B25|GSA_THEVO Glutamate-1-semialdehyde 2,1-aminomutase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=hemL PE=3 SV=1 38 344 2.0E-29
sp|Q89AK4|BIOA_BUCBP Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=bioA PE=3 SV=1 39 431 2.0E-29
sp|B8FBA1|GSA_DESAA Glutamate-1-semialdehyde 2,1-aminomutase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=hemL PE=3 SV=1 42 333 2.0E-29
sp|Q8DLK8|GSA_THEEB Glutamate-1-semialdehyde 2,1-aminomutase OS=Thermosynechococcus elongatus (strain BP-1) GN=hemL PE=1 SV=2 42 353 2.0E-29
sp|B7K2I1|GSA_CYAP8 Glutamate-1-semialdehyde 2,1-aminomutase OS=Cyanothece sp. (strain PCC 8801) GN=hemL PE=3 SV=1 42 335 3.0E-29
sp|A4FZY1|GSA_METM5 Glutamate-1-semialdehyde 2,1-aminomutase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=hemL PE=3 SV=1 36 336 3.0E-29
sp|A9BEA5|GSA_PROM4 Glutamate-1-semialdehyde 2,1-aminomutase OS=Prochlorococcus marinus (strain MIT 9211) GN=hemL PE=3 SV=1 42 353 3.0E-29
sp|B0UST3|GSA_HISS2 Glutamate-1-semialdehyde 2,1-aminomutase OS=Histophilus somni (strain 2336) GN=hemL PE=3 SV=1 42 345 3.0E-29
sp|Q8TT57|GSA_METAC Glutamate-1-semialdehyde 2,1-aminomutase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=hemL PE=3 SV=1 40 350 3.0E-29
sp|Q3SFU6|GSA_THIDA Glutamate-1-semialdehyde 2,1-aminomutase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=hemL PE=3 SV=1 42 335 3.0E-29
sp|Q31C50|GSA_PROM9 Glutamate-1-semialdehyde 2,1-aminomutase OS=Prochlorococcus marinus (strain MIT 9312) GN=hemL PE=3 SV=1 42 336 3.0E-29
sp|Q05174|LAT_AMYLA L-lysine-epsilon aminotransferase OS=Amycolatopsis lactamdurans GN=lat PE=3 SV=1 58 431 4.0E-29
sp|Q8K9P0|BIOA_BUCAP Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=bioA PE=3 SV=1 39 373 4.0E-29
sp|Q30WH2|GSA_DESAG Glutamate-1-semialdehyde 2,1-aminomutase OS=Desulfovibrio alaskensis (strain G20) GN=hemL PE=3 SV=1 42 345 4.0E-29
sp|Q3ALU9|GSA_SYNSC Glutamate-1-semialdehyde 2,1-aminomutase OS=Synechococcus sp. (strain CC9605) GN=hemL PE=3 SV=1 42 335 4.0E-29
sp|A1TYG5|GSA_MARHV Glutamate-1-semialdehyde 2,1-aminomutase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=hemL PE=3 SV=1 42 350 4.0E-29
sp|A5GMT2|GSA_SYNPW Glutamate-1-semialdehyde 2,1-aminomutase OS=Synechococcus sp. (strain WH7803) GN=hemL PE=3 SV=1 42 335 4.0E-29
[Show less]

GO

GO Term Description Terminal node
GO:0008483 transaminase activity Yes
GO:0030170 pyridoxal phosphate binding Yes
GO:0097159 organic cyclic compound binding No
GO:0019842 vitamin binding No
GO:0070279 vitamin B6 binding No
GO:0016769 transferase activity, transferring nitrogenous groups No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043168 anion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|797
MAPHASDVSSGPDAVSRFHAGSSAAAMATEKDLAAHNYHPLPVVFSRAKGVDVWDPEGRHYLDFLSAYSAVNQGH
CHPELVKALADQAGRLTLSSRAFYNDVFPRWAEKMHRVFGYDMVLPMNTGVEAVETAVKIARKWAYKVKGVEQDK
ALVFCVTDNFHGRSMTAITLSTDSESKANYGPYVPGLGASCPTTGKSIRFNNVDDVREVLEAHGKSTAAFMVEPI
QGEAGVVVPDDDYLPRVHALCKKHNVLLICDEVQTGIGRTGRMLCSEWSGIKPDMVTLGKAISGGMYPVSAVLSS
KEVMLVVEPGTHGSTYGGNPLGCAVSIRALELIEEEDMITNARRLGDVFRHGLAALKSPVIKEIRGKGLLNAVVI
DERAAGGRTAWDLCLLLKKKGLLAKPTHGDIIRFAPPLVITETEIRKGLKIIAEAVKELPETAKAAAH*
Coding >Ophun1|797
ATGGCTCCTCACGCAAGCGACGTCTCCTCCGGCCCCGATGCCGTCTCCCGCTTCCACGCCGGCTCGTCGGCCGCC
GCCATGGCAACGGAGAAGGATCTCGCGGCGCACAACTACCATCCACTCCCCGTCGTCTTCTCCCGCGCCAAGGGT
GTCGACGTCTGGGATCCCGAGGGTCGTCACTATCTCGACTTCTTGTCTGCCTACAGCGCTGTCAACCAGGGGCAT
TGCCACCCGGAGCTGGTCAAGGCTCTTGCTGATCAGGCTGGGCGTTTGACGCTCAGCTCGCGCGCTTTCTACAAT
GATGTTTTTCCGCGGTGGGCTGAGAAGATGCACCGTGTTTTTGGATACGATATGGTGCTGCCTATGAACACGGGT
GTTGAGGCGGTTGAGACGGCGGTCAAGATTGCTCGTAAGTGGGCGTACAAGGTCAAGGGTGTTGAGCAGGACAAG
GCTCTCGTTTTTTGCGTGACGGACAACTTTCACGGTCGATCGATGACGGCGATTACGCTCTCGACCGACTCCGAG
TCCAAGGCCAACTACGGTCCCTACGTGCCCGGGCTGGGGGCCTCGTGCCCGACGACAGGCAAGTCGATTCGCTTC
AACAACGTCGACGATGTGCGCGAGGTGCTCGAGGCTCATGGCAAGTCGACGGCTGCGTTTATGGTTGAGCCGATT
CAGGGCGAGGCTGGTGTGGTGGTGCCGGATGACGATTACCTCCCGCGGGTGCACGCGCTGTGCAAGAAGCACAAT
GTTCTCCTTATCTGCGACGAGGTGCAGACGGGTATCGGTCGTACCGGCCGTATGCTTTGTTCCGAGTGGTCCGGC
ATCAAGCCCGACATGGTGACGCTGGGAAAGGCCATCTCGGGAGGCATGTATCCCGTCAGCGCCGTGCTGAGCAGC
AAGGAGGTGATGCTCGTGGTCGAGCCGGGCACGCATGGCTCTACCTACGGAGGGAACCCGTTGGGTTGTGCTGTT
TCGATCCGCGCGCTGGAGCTCATTGAGGAGGAGGACATGATCACCAACGCTCGACGGCTGGGCGACGTCTTTCGC
CATGGGCTGGCTGCGCTCAAGAGTCCTGTTATCAAGGAGATTCGGGGCAAGGGGCTTCTCAACGCCGTCGTCATT
GACGAAAGGGCCGCTGGTGGGCGCACCGCGTGGGATCTATGCCTGTTGTTGAAGAAGAAGGGTCTCTTGGCCAAG
CCGACTCACGGTGACATCATCCGCTTCGCTCCTCCGCTCGTCATCACCGAGACGGAGATTCGCAAGGGACTCAAG
ATCATTGCCGAGGCGGTCAAGGAGCTGCCCGAGACGGCAAAGGCCGCAGCCCACTAA
Transcript >Ophun1|797
ATGGCTCCTCACGCAAGCGACGTCTCCTCCGGCCCCGATGCCGTCTCCCGCTTCCACGCCGGCTCGTCGGCCGCC
GCCATGGCAACGGAGAAGGATCTCGCGGCGCACAACTACCATCCACTCCCCGTCGTCTTCTCCCGCGCCAAGGGT
GTCGACGTCTGGGATCCCGAGGGTCGTCACTATCTCGACTTCTTGTCTGCCTACAGCGCTGTCAACCAGGGGCAT
TGCCACCCGGAGCTGGTCAAGGCTCTTGCTGATCAGGCTGGGCGTTTGACGCTCAGCTCGCGCGCTTTCTACAAT
GATGTTTTTCCGCGGTGGGCTGAGAAGATGCACCGTGTTTTTGGATACGATATGGTGCTGCCTATGAACACGGGT
GTTGAGGCGGTTGAGACGGCGGTCAAGATTGCTCGTAAGTGGGCGTACAAGGTCAAGGGTGTTGAGCAGGACAAG
GCTCTCGTTTTTTGCGTGACGGACAACTTTCACGGTCGATCGATGACGGCGATTACGCTCTCGACCGACTCCGAG
TCCAAGGCCAACTACGGTCCCTACGTGCCCGGGCTGGGGGCCTCGTGCCCGACGACAGGCAAGTCGATTCGCTTC
AACAACGTCGACGATGTGCGCGAGGTGCTCGAGGCTCATGGCAAGTCGACGGCTGCGTTTATGGTTGAGCCGATT
CAGGGCGAGGCTGGTGTGGTGGTGCCGGATGACGATTACCTCCCGCGGGTGCACGCGCTGTGCAAGAAGCACAAT
GTTCTCCTTATCTGCGACGAGGTGCAGACGGGTATCGGTCGTACCGGCCGTATGCTTTGTTCCGAGTGGTCCGGC
ATCAAGCCCGACATGGTGACGCTGGGAAAGGCCATCTCGGGAGGCATGTATCCCGTCAGCGCCGTGCTGAGCAGC
AAGGAGGTGATGCTCGTGGTCGAGCCGGGCACGCATGGCTCTACCTACGGAGGGAACCCGTTGGGTTGTGCTGTT
TCGATCCGCGCGCTGGAGCTCATTGAGGAGGAGGACATGATCACCAACGCTCGACGGCTGGGCGACGTCTTTCGC
CATGGGCTGGCTGCGCTCAAGAGTCCTGTTATCAAGGAGATTCGGGGCAAGGGGCTTCTCAACGCCGTCGTCATT
GACGAAAGGGCCGCTGGTGGGCGCACCGCGTGGGATCTATGCCTGTTGTTGAAGAAGAAGGGTCTCTTGGCCAAG
CCGACTCACGGTGACATCATCCGCTTCGCTCCTCCGCTCGTCATCACCGAGACGGAGATTCGCAAGGGACTCAAG
ATCATTGCCGAGGCGGTCAAGGAGCTGCCCGAGACGGCAAAGGCCGCAGCCCACTAA
Gene >Ophun1|797
ATGGCTCCTCACGCAAGCGACGTCTCCTCCGGCCCCGATGCCGTCTCCCGCTTCCACGCCGGCTCGTCGGCCGCC
GCCATGGCAACGGAGAAGGATCTCGCGGCGCACAACTACCATCCACTCCCCGTCGTCTTCTCCCGCGCCAAGGGT
GTCGACGTCTGGGATCCCGAGGGTCGTCACTATCTCGACTTCTTGTCTGCCTACAGCGCTGTCAACCAGGGGCAT
TGCCACCCGGAGCTGGTCAAGGCTCTTGCTGATCAGGCTGGGCGTTTGACGCTCAGCTCGCGCGCTTTCTACAAT
GATGTTTTTCCGCGGTGGGCTGAGAAGATGCACCGTGTTTTTGGATACGATATGGTGCTGCCTATGAACACGGGT
GTTGAGGCGGTTGAGACGGCGGTCAAGATTGCTCGTAAGTGGGCGTACAAGGTCAAGGGTGTTGAGCAGGACAAG
GCTCTCGTTTTTTGCGTGACGGACAACTTTCACGGTCGATCGGTATGTTTGTTGGTTGGTTCGCGTGGGTTAAGA
TGGGTGCTGAAGTTGAGGAAACGCAGATGACGGCGATTACGCTCTCGACCGACTCCGAGTCCAAGGCCAACTACG
GTCCCTACGTGCCCGGGCTGGGGGCCTCGTGCCCGACGACAGGCAAGTCGATTCGCTTCAACAACGTCGACGATG
TGCGCGAGGTGCTCGAGGCTCATGGCAAGTCGACGGCTGCGTTTATGGTTGAGCCGATTCAGGGCGAGGCTGGTG
TGGTGGTGCCGGATGACGATTACCTCCCGCGGGTGCACGCGCTGTGCAAGAAGCACAATGTTCTCCTTATCTGCG
ACGAGGTGCAGACGGGTATCGGTCGTACCGGCCGTATGCTTTGTTCCGAGTGGTCCGGCATCAAGCCCGACATGG
TGACGCTGGGAAAGGCCATCTCGGGAGGCATGTATCCCGTCAGCGCCGTGCTGAGCAGCAAGGAGGTGATGCTCG
TGGTCGAGCCGGGCACGCATGGCTCTACCTACGGAGGGAACCCGTTGGGTTGTGCTGTTTCGATCCGCGCGCTGG
AGCTCATTGAGGAGGAGGACATGATCACCAACGCTCGACGGCTGGGCGACGTCTTTCGCCATGGGCTGGCTGCGC
TCAAGAGTCCTGTTATCAAGGAGATTCGGGGCAAGGGGCTTCTCAACGCCGTCGTCATTGACGAAAGGGCCGCTG
GTGGGCGCACCGCGTGGGATCTATGCCTGTTGTTGAAGAAGAAGGGTCTCTTGGTGAGTGCTATCGATAAACCTG
TATCGACGATCTGACTGACGGAACCGCTGGCAGGCCAAGCCGACTCACGGTGACATCATCCGCTTCGCTCCTCCG
CTCGTCATCACCGAGACGGAGATTCGCAAGGGACTCAAGATCATTGCCGAGGCGGTCAAGGAGCTGCCCGAGACG
GCAAAGGCCGCAGCCCACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail