Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|793
Gene name
LocationContig_128:3248..9038
Strand+
Gene length (bp)5790
Transcript length (bp)5565
Coding sequence length (bp)5565
Protein length (aa) 1855

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18378 Nup188_C Nuclear pore protein NUP188 C-terminal domain 3.9E-152 1490 1848
PF10487 Nup188 Nucleoporin subcomplex protein binding to Pom34 6.6E-08 96 475
PF10487 Nup188 Nucleoporin subcomplex protein binding to Pom34 4.6E-35 621 1188

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|G0SFH5|NU188_CHATD Nucleoporin NUP188 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP188 PE=1 SV=1 39 1847 0.0E+00
sp|Q9P7M8|NU184_SCHPO Nucleoporin nup184 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup184 PE=4 SV=1 633 1738 1.0E-44
sp|P52593|NU188_YEAST Nucleoporin NUP188 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP188 PE=1 SV=1 733 1730 3.0E-27

GO

GO Term Description Terminal node
GO:0017056 structural constituent of nuclear pore Yes
GO:0005198 structural molecule activity No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4494
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3831
Ophiocordyceps australis map64 (Brazil) OphauB2|6760
Ophiocordyceps camponoti-floridani Ophcf2|01274
Ophiocordyceps camponoti-rufipedis Ophun1|793 (this protein)
Ophiocordyceps kimflemingae Ophio5|1048
Ophiocordyceps subramaniannii Hirsu2|9374

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|793
MDATPLPPKSEQCFEMHIRDHARRDASRAASTSLTLAAMAPVSDSRYFPSLDDCLSGDRLLLSWKDVSVALSDES
GHRQSSSALIKFLSDEFVLSLLKDPSKAFAPPNEGSEADFKTKTAPINVSEDGVDIETIKSDAKWLSKNAKINVV
AALRVVVVEYQSRPLRHLMGPLSSQDASNLQEAAGLQNSQGASFIDLGAASTLDVDEISANFDKPESRKRRLIDA
LWTERRSFMMAADYMFSLKLYRRLPILTSVDCDLAGIYRLEPATDNVASLLAVYLKVVSDCMGSIEAGLASLTDD
ALLMVQEVELEWIGSLLTETIHAMSIVFQLADSLGSEFPPSDAINQWFSLMEIYGFFGSVQPIHPTIAELIPPLK
ALSCAVSLSLLKPARSLIFLSDREEDSTLTDNSYDAYLLSSDVLEQIHKSIINAASTDCEGATPVIFAWTLLLHR
MTVSYQTRMEKRDALQQQSAEKSFAQSTNDEDEYRRAAPRRNSAGSIYSIESSKFDGFLENAAGLKDLQLVEQLA
ASVTAHGKVFEVMADMASSLGPSGDGSMTPLISSRVRVAFLELLKVCYPIVGYQSEPLASLIHILAPGHGYWDLC
SSKDALSPAQDVVACMLHDDHAMEFYFQQALNRFPYEFSPFITLCRTFCAANLDDDRSDLVLGLLRKTPTLTLTL
PDAFSGYELVQEDENTNSFCLVQEIPLISLSSSWSRRCIEDDVYRLPLGTYGRFVTDSGRVVVVDYPHSTLSMLG
RQLEINLVKEGYDSALGMLQSDDVAEVISLLSTLLRSEHLKVEETSDGNALMHEQSDLLLEAGRHISGGKDIMAV
VCETMDHFMQDELAMADDAAVRVIDACVTFLDAILLVQPNRVWSYLARSELLGSEVRAGKLAKITGTLDLVSGRF
DLLTSSLSFFSNLVDTAMRSGVRRRAGNKPAGRQKLASNPWAGTADRVLSRVSLSLAQASIDILESTSTWRFDSE
TSRLSAVSKVVPVLDKLVMYSYSMGESPSSDSLTSCLGPAASYVVDCFMSPATGTLRYGPILSSLGAAFASSDST
LYPSRTAIVQSQACSMLAFCTTLLRAADYLGRSPAMLEAYLFKSSTLLARLSASPRQVRGPVIRLLESLVSSAGK
SAGEPPSLLGYLGPPLSKSFLQSLADLGKPFALPHEVKTVWSFFSSIVRNRQQWMSNCLLTGQTPREAMKDGGKK
GELAADSVFVRALAKLKQLKDLESVEALAVLDFVSSAQNYWPWTIFTLLRDTSYIEGLQAYVRGLKPSQLTLRSD
AIGTSLDARKAAYVAETLAMQLYHARHQGTAKKLASSLVADLDYFIRDGVEAAGYNKSLHNNFAKNFATRYPGCS
VDLFKRTPLEPRELGANYYYDVERADDMLKFDPAWLGRKGDGFKKEMELANANLSLVDAQIALFHAWEFLLVELG
TCLPTGETVARQMLQVAQQCLSANQGLPGPEAIFMKLVEARANLALILVQRLVKSSLAIKDANQLLATLVGTINT
TEDPFTERSITHYRTLLKTLFVTLRVYQNADVKVLAEMPGVDVVQTVLNILDHVVGRGFRTLVSFIHERDAGISP
EDLALLTAILQACLSLPTMDQSQAQIVNIIASHDTINAATSLFSWADQLAVQGDPVYGELSVLFLLELSSLPLLA
EQLACDGVLGNLLSANLARYMLKANISPYADAAISQRCYSIWAKGLLPLTLNLLTALGPTMAPEIAYLLNQFSHL
LKASVDRFETPSASRTRSKATPHYLTLLATSEIHSLALLTRILAALRVKCGREIPDVEWDAAGLLENVDFWLSTR
RLLRERLLPLGSREMEWRNTRVTVDEGHHDNLLECKVVCQLETVRDVLSEELDA*
Coding >Ophun1|793
ATGGACGCCACACCGCTCCCACCCAAAAGTGAGCAGTGCTTCGAGATGCATATCCGCGACCACGCGCGTCGTGAT
GCATCGCGCGCTGCTTCCACTTCCCTGACACTTGCGGCCATGGCGCCGGTGTCTGATAGCAGATACTTTCCCTCC
CTCGACGACTGTCTGTCTGGGGACCGACTGCTTTTGTCCTGGAAAGATGTATCGGTCGCGCTCTCGGACGAATCC
GGTCATCGGCAATCCTCTTCGGCTCTGATTAAATTTCTCTCTGATGAGTTTGTTCTCAGCCTGTTGAAAGACCCG
TCCAAGGCTTTCGCGCCGCCCAACGAAGGCTCCGAGGCCGACTTTAAGACCAAGACGGCGCCTATCAACGTCTCC
GAAGATGGCGTCGACATCGAGACTATCAAGAGCGACGCAAAATGGCTCAGCAAAAATGCCAAGATTAATGTCGTT
GCCGCGCTTCGCGTCGTCGTCGTTGAATATCAGTCGCGGCCTCTCAGACATCTCATGGGGCCGCTCTCTTCCCAA
GACGCGTCGAATCTTCAAGAGGCTGCAGGCCTTCAGAACTCGCAAGGAGCTTCATTTATAGACTTGGGCGCCGCC
TCGACTCTCGACGTGGATGAGATATCGGCCAACTTCGACAAGCCGGAGTCGAGAAAGAGGCGTCTCATCGATGCG
CTGTGGACCGAGCGGCGATCGTTTATGATGGCAGCGGACTACATGTTTTCCCTCAAGCTCTACCGTCGGCTGCCG
ATTCTCACTTCCGTGGACTGTGACTTGGCTGGCATCTACCGCCTCGAACCGGCGACGGATAACGTCGCGTCACTC
CTGGCCGTCTATCTGAAGGTGGTTTCTGACTGCATGGGCAGCATCGAGGCTGGTCTCGCCTCCTTGACAGACGAC
GCCCTGCTCATGGTGCAAGAAGTCGAGCTGGAGTGGATCGGGAGTCTCCTCACTGAGACGATTCATGCCATGTCG
ATCGTTTTTCAGCTCGCCGACAGCCTGGGAAGCGAATTTCCGCCTTCCGACGCCATCAACCAGTGGTTCTCCTTG
ATGGAGATATACGGCTTTTTTGGATCTGTGCAGCCAATTCATCCAACAATTGCAGAGCTGATCCCCCCCCTCAAG
GCCTTGTCTTGTGCAGTCTCACTCAGCCTACTTAAACCTGCCAGATCCCTCATCTTTCTCTCTGATAGGGAAGAG
GACTCGACGTTGACCGATAACTCGTATGACGCCTATCTGCTCTCTTCGGATGTACTAGAACAGATCCACAAGAGC
ATCATCAATGCGGCCAGCACGGATTGTGAAGGTGCCACGCCCGTCATATTCGCCTGGACTCTACTGCTGCACCGC
ATGACCGTATCCTATCAAACGCGAATGGAGAAGCGAGACGCCCTACAGCAGCAGAGCGCCGAAAAGAGCTTTGCC
CAGAGTACGAACGACGAAGACGAATATCGGCGTGCCGCCCCGAGACGCAATTCTGCTGGTAGCATCTATTCGATA
GAGTCTTCCAAGTTTGACGGGTTCCTTGAGAATGCCGCCGGTCTCAAGGACCTGCAACTGGTGGAGCAATTGGCC
GCCTCAGTCACGGCACACGGAAAGGTTTTTGAGGTCATGGCGGACATGGCCTCTTCGCTGGGACCGTCGGGCGAT
GGCAGCATGACGCCACTGATCAGCTCGCGCGTGAGGGTTGCCTTCTTGGAGCTTCTCAAGGTCTGCTATCCCATT
GTTGGCTATCAATCCGAACCGCTGGCGTCATTAATCCATATCTTGGCACCCGGCCACGGTTATTGGGACCTCTGC
TCGTCCAAAGACGCTCTCTCGCCTGCTCAGGATGTCGTGGCCTGCATGCTGCACGACGACCACGCCATGGAGTTT
TACTTTCAACAGGCTCTGAACAGGTTCCCCTACGAGTTCTCGCCTTTCATCACTCTGTGCAGGACGTTTTGCGCG
GCCAACTTGGACGACGACCGGTCCGACTTGGTACTCGGTCTGCTCCGCAAGACACCGACTCTCACACTCACCCTT
CCCGACGCCTTTTCTGGATATGAGCTTGTTCAAGAAGACGAAAACACCAACTCTTTCTGCTTGGTACAAGAGATT
CCACTCATTTCCCTTTCTTCATCGTGGAGTAGGCGATGTATCGAAGACGACGTGTACCGGCTGCCGTTAGGGACG
TACGGACGCTTCGTCACCGACTCTGGGAGGGTGGTCGTCGTTGATTATCCGCACTCCACTCTATCGATGCTAGGA
CGACAGCTGGAAATCAACCTTGTGAAAGAGGGCTATGATTCGGCCCTAGGGATGCTGCAGTCGGACGACGTTGCC
GAGGTCATCTCTCTGCTGTCCACTCTACTCCGTTCTGAGCACCTCAAGGTGGAAGAGACGAGTGATGGCAACGCC
CTGATGCACGAGCAGAGCGACCTCTTGCTGGAAGCCGGCCGGCACATCAGCGGTGGCAAAGACATCATGGCCGTC
GTCTGCGAAACCATGGATCACTTCATGCAAGACGAGCTGGCCATGGCCGATGATGCTGCGGTTCGCGTTATAGAT
GCCTGTGTCACGTTCCTGGATGCCATTTTGCTGGTGCAGCCGAACCGCGTCTGGTCGTACTTGGCTCGAAGCGAG
CTGCTGGGCTCGGAAGTCAGGGCCGGGAAGCTGGCAAAGATCACGGGCACCCTCGATTTGGTTTCGGGGAGATTC
GACTTGCTCACTTCTTCTCTCTCATTCTTCTCTAATCTGGTCGATACGGCCATGCGCTCGGGCGTCCGCCGTCGA
GCCGGCAACAAGCCTGCTGGTCGGCAGAAGCTGGCTTCGAACCCCTGGGCAGGGACCGCTGACAGGGTGCTCAGC
CGGGTAAGCCTGTCCCTGGCGCAGGCCTCCATCGATATCCTGGAGAGCACGTCGACATGGCGCTTCGACTCTGAA
ACCAGTCGCTTGTCGGCCGTGAGCAAGGTCGTCCCCGTCCTGGACAAGCTTGTCATGTACAGCTACAGCATGGGC
GAGTCGCCAAGCTCTGACAGCCTCACATCTTGTCTCGGACCTGCTGCTTCGTACGTCGTTGATTGCTTCATGTCG
CCGGCGACGGGAACTCTTCGATACGGCCCTATACTCTCTTCCCTCGGCGCCGCGTTCGCGTCGTCTGACAGCACG
CTCTATCCGAGTCGCACCGCAATAGTCCAGAGTCAAGCATGCTCTATGCTGGCCTTCTGCACGACACTGCTTCGT
GCGGCAGACTACCTCGGCCGGTCTCCGGCGATGCTGGAGGCCTACCTGTTCAAAAGCTCGACGCTGCTGGCCCGT
CTCTCCGCCTCGCCTCGTCAAGTCCGCGGCCCCGTCATTCGCTTGCTCGAGTCGCTCGTCAGCAGCGCGGGCAAA
TCTGCTGGCGAGCCGCCCTCGCTGCTGGGATACCTGGGACCTCCATTATCAAAGTCGTTTCTGCAGTCGCTCGCC
GATTTGGGAAAGCCGTTTGCTCTTCCACACGAGGTAAAGACAGTCTGGAGCTTCTTCTCGTCGATTGTGAGAAAC
CGGCAGCAGTGGATGTCAAACTGCCTCCTTACCGGCCAAACACCTCGCGAAGCGATGAAGGACGGCGGCAAGAAG
GGAGAGCTGGCGGCGGACTCCGTGTTTGTGCGCGCCCTGGCGAAGCTCAAGCAGCTAAAGGATCTCGAAAGCGTC
GAGGCCTTGGCTGTGCTCGACTTTGTTTCTTCAGCTCAGAACTACTGGCCCTGGACCATCTTTACGCTTCTGCGA
GACACGTCATACATCGAGGGTCTCCAGGCGTATGTGCGTGGTCTGAAGCCGTCACAGTTGACACTCAGGTCAGAC
GCCATCGGCACCAGTCTCGACGCCAGGAAAGCAGCGTATGTGGCAGAGACGCTGGCTATGCAGCTGTACCACGCC
CGCCACCAGGGAACGGCCAAGAAGCTCGCCTCCAGCCTCGTGGCGGATCTCGACTACTTCATTCGCGATGGCGTC
GAGGCTGCGGGATATAACAAGTCCCTGCATAACAACTTTGCCAAGAACTTTGCCACCAGGTATCCTGGCTGCTCC
GTCGACCTCTTCAAGCGGACGCCCTTGGAACCGAGAGAGCTGGGCGCAAACTACTATTACGACGTCGAACGAGCC
GACGACATGCTCAAGTTTGATCCGGCCTGGCTCGGACGGAAAGGCGACGGATTCAAGAAGGAAATGGAGCTGGCC
AATGCCAACTTGTCTCTGGTGGATGCTCAGATAGCCCTCTTCCATGCGTGGGAGTTCTTGCTGGTCGAGCTCGGC
ACATGTCTGCCGACTGGCGAGACCGTCGCCAGGCAGATGCTTCAGGTTGCACAGCAGTGTCTGTCGGCAAACCAG
GGGCTACCGGGTCCAGAAGCCATCTTCATGAAGCTGGTAGAGGCACGGGCGAACCTGGCCCTCATCTTGGTGCAG
CGACTCGTCAAGTCGTCGCTTGCGATAAAGGACGCCAACCAGCTTCTGGCAACGCTCGTCGGCACCATCAACACG
ACCGAGGACCCGTTTACGGAGCGGTCCATCACGCACTATCGCACGCTCCTGAAGACGCTGTTTGTCACGCTTCGC
GTCTATCAGAATGCCGATGTCAAGGTGTTGGCGGAGATGCCAGGGGTGGATGTTGTTCAGACGGTTCTCAACATT
CTCGATCACGTCGTCGGCAGAGGCTTCCGGACGCTCGTCAGCTTCATCCACGAGAGAGACGCCGGCATCTCGCCC
GAAGACTTGGCGCTATTGACGGCAATCCTACAGGCCTGTCTGAGTCTGCCGACGATGGACCAGTCGCAGGCGCAG
ATTGTCAACATCATTGCGTCGCACGATACCATCAACGCCGCCACGTCCCTCTTCTCGTGGGCCGACCAGCTGGCT
GTACAAGGCGACCCCGTCTACGGCGAGCTGAGTGTTCTGTTCTTGCTAGAGCTGTCGAGTCTGCCGCTGCTGGCG
GAACAGCTCGCTTGCGATGGCGTCCTGGGCAACTTGCTGTCGGCCAATCTGGCTCGTTACATGCTCAAAGCCAAC
ATCTCGCCCTACGCGGACGCAGCCATCTCTCAGCGATGCTACTCCATTTGGGCTAAAGGACTCTTGCCGCTGACT
CTCAACCTGCTGACGGCCCTCGGCCCGACGATGGCACCCGAGATTGCCTATCTTTTGAACCAGTTTTCGCACCTG
CTCAAGGCCAGCGTCGATCGGTTCGAGACGCCGAGCGCGAGCCGGACGAGGTCCAAGGCCACGCCACATTACTTG
ACGCTCCTGGCAACGTCCGAGATTCACTCGCTGGCGCTGCTCACGCGCATCCTGGCCGCGCTGCGGGTCAAATGC
GGGCGCGAGATCCCCGACGTCGAGTGGGACGCAGCCGGTCTGCTGGAGAATGTCGACTTCTGGCTATCTACGAGG
CGTCTGCTCAGAGAGCGTCTGTTGCCGCTGGGTTCCCGTGAGATGGAGTGGAGGAATACCAGAGTAACGGTCGAC
GAGGGTCACCATGACAACTTGCTAGAGTGCAAGGTCGTCTGTCAGCTGGAGACGGTACGGGACGTGTTGAGCGAG
GAGCTTGATGCGTGA
Transcript >Ophun1|793
ATGGACGCCACACCGCTCCCACCCAAAAGTGAGCAGTGCTTCGAGATGCATATCCGCGACCACGCGCGTCGTGAT
GCATCGCGCGCTGCTTCCACTTCCCTGACACTTGCGGCCATGGCGCCGGTGTCTGATAGCAGATACTTTCCCTCC
CTCGACGACTGTCTGTCTGGGGACCGACTGCTTTTGTCCTGGAAAGATGTATCGGTCGCGCTCTCGGACGAATCC
GGTCATCGGCAATCCTCTTCGGCTCTGATTAAATTTCTCTCTGATGAGTTTGTTCTCAGCCTGTTGAAAGACCCG
TCCAAGGCTTTCGCGCCGCCCAACGAAGGCTCCGAGGCCGACTTTAAGACCAAGACGGCGCCTATCAACGTCTCC
GAAGATGGCGTCGACATCGAGACTATCAAGAGCGACGCAAAATGGCTCAGCAAAAATGCCAAGATTAATGTCGTT
GCCGCGCTTCGCGTCGTCGTCGTTGAATATCAGTCGCGGCCTCTCAGACATCTCATGGGGCCGCTCTCTTCCCAA
GACGCGTCGAATCTTCAAGAGGCTGCAGGCCTTCAGAACTCGCAAGGAGCTTCATTTATAGACTTGGGCGCCGCC
TCGACTCTCGACGTGGATGAGATATCGGCCAACTTCGACAAGCCGGAGTCGAGAAAGAGGCGTCTCATCGATGCG
CTGTGGACCGAGCGGCGATCGTTTATGATGGCAGCGGACTACATGTTTTCCCTCAAGCTCTACCGTCGGCTGCCG
ATTCTCACTTCCGTGGACTGTGACTTGGCTGGCATCTACCGCCTCGAACCGGCGACGGATAACGTCGCGTCACTC
CTGGCCGTCTATCTGAAGGTGGTTTCTGACTGCATGGGCAGCATCGAGGCTGGTCTCGCCTCCTTGACAGACGAC
GCCCTGCTCATGGTGCAAGAAGTCGAGCTGGAGTGGATCGGGAGTCTCCTCACTGAGACGATTCATGCCATGTCG
ATCGTTTTTCAGCTCGCCGACAGCCTGGGAAGCGAATTTCCGCCTTCCGACGCCATCAACCAGTGGTTCTCCTTG
ATGGAGATATACGGCTTTTTTGGATCTGTGCAGCCAATTCATCCAACAATTGCAGAGCTGATCCCCCCCCTCAAG
GCCTTGTCTTGTGCAGTCTCACTCAGCCTACTTAAACCTGCCAGATCCCTCATCTTTCTCTCTGATAGGGAAGAG
GACTCGACGTTGACCGATAACTCGTATGACGCCTATCTGCTCTCTTCGGATGTACTAGAACAGATCCACAAGAGC
ATCATCAATGCGGCCAGCACGGATTGTGAAGGTGCCACGCCCGTCATATTCGCCTGGACTCTACTGCTGCACCGC
ATGACCGTATCCTATCAAACGCGAATGGAGAAGCGAGACGCCCTACAGCAGCAGAGCGCCGAAAAGAGCTTTGCC
CAGAGTACGAACGACGAAGACGAATATCGGCGTGCCGCCCCGAGACGCAATTCTGCTGGTAGCATCTATTCGATA
GAGTCTTCCAAGTTTGACGGGTTCCTTGAGAATGCCGCCGGTCTCAAGGACCTGCAACTGGTGGAGCAATTGGCC
GCCTCAGTCACGGCACACGGAAAGGTTTTTGAGGTCATGGCGGACATGGCCTCTTCGCTGGGACCGTCGGGCGAT
GGCAGCATGACGCCACTGATCAGCTCGCGCGTGAGGGTTGCCTTCTTGGAGCTTCTCAAGGTCTGCTATCCCATT
GTTGGCTATCAATCCGAACCGCTGGCGTCATTAATCCATATCTTGGCACCCGGCCACGGTTATTGGGACCTCTGC
TCGTCCAAAGACGCTCTCTCGCCTGCTCAGGATGTCGTGGCCTGCATGCTGCACGACGACCACGCCATGGAGTTT
TACTTTCAACAGGCTCTGAACAGGTTCCCCTACGAGTTCTCGCCTTTCATCACTCTGTGCAGGACGTTTTGCGCG
GCCAACTTGGACGACGACCGGTCCGACTTGGTACTCGGTCTGCTCCGCAAGACACCGACTCTCACACTCACCCTT
CCCGACGCCTTTTCTGGATATGAGCTTGTTCAAGAAGACGAAAACACCAACTCTTTCTGCTTGGTACAAGAGATT
CCACTCATTTCCCTTTCTTCATCGTGGAGTAGGCGATGTATCGAAGACGACGTGTACCGGCTGCCGTTAGGGACG
TACGGACGCTTCGTCACCGACTCTGGGAGGGTGGTCGTCGTTGATTATCCGCACTCCACTCTATCGATGCTAGGA
CGACAGCTGGAAATCAACCTTGTGAAAGAGGGCTATGATTCGGCCCTAGGGATGCTGCAGTCGGACGACGTTGCC
GAGGTCATCTCTCTGCTGTCCACTCTACTCCGTTCTGAGCACCTCAAGGTGGAAGAGACGAGTGATGGCAACGCC
CTGATGCACGAGCAGAGCGACCTCTTGCTGGAAGCCGGCCGGCACATCAGCGGTGGCAAAGACATCATGGCCGTC
GTCTGCGAAACCATGGATCACTTCATGCAAGACGAGCTGGCCATGGCCGATGATGCTGCGGTTCGCGTTATAGAT
GCCTGTGTCACGTTCCTGGATGCCATTTTGCTGGTGCAGCCGAACCGCGTCTGGTCGTACTTGGCTCGAAGCGAG
CTGCTGGGCTCGGAAGTCAGGGCCGGGAAGCTGGCAAAGATCACGGGCACCCTCGATTTGGTTTCGGGGAGATTC
GACTTGCTCACTTCTTCTCTCTCATTCTTCTCTAATCTGGTCGATACGGCCATGCGCTCGGGCGTCCGCCGTCGA
GCCGGCAACAAGCCTGCTGGTCGGCAGAAGCTGGCTTCGAACCCCTGGGCAGGGACCGCTGACAGGGTGCTCAGC
CGGGTAAGCCTGTCCCTGGCGCAGGCCTCCATCGATATCCTGGAGAGCACGTCGACATGGCGCTTCGACTCTGAA
ACCAGTCGCTTGTCGGCCGTGAGCAAGGTCGTCCCCGTCCTGGACAAGCTTGTCATGTACAGCTACAGCATGGGC
GAGTCGCCAAGCTCTGACAGCCTCACATCTTGTCTCGGACCTGCTGCTTCGTACGTCGTTGATTGCTTCATGTCG
CCGGCGACGGGAACTCTTCGATACGGCCCTATACTCTCTTCCCTCGGCGCCGCGTTCGCGTCGTCTGACAGCACG
CTCTATCCGAGTCGCACCGCAATAGTCCAGAGTCAAGCATGCTCTATGCTGGCCTTCTGCACGACACTGCTTCGT
GCGGCAGACTACCTCGGCCGGTCTCCGGCGATGCTGGAGGCCTACCTGTTCAAAAGCTCGACGCTGCTGGCCCGT
CTCTCCGCCTCGCCTCGTCAAGTCCGCGGCCCCGTCATTCGCTTGCTCGAGTCGCTCGTCAGCAGCGCGGGCAAA
TCTGCTGGCGAGCCGCCCTCGCTGCTGGGATACCTGGGACCTCCATTATCAAAGTCGTTTCTGCAGTCGCTCGCC
GATTTGGGAAAGCCGTTTGCTCTTCCACACGAGGTAAAGACAGTCTGGAGCTTCTTCTCGTCGATTGTGAGAAAC
CGGCAGCAGTGGATGTCAAACTGCCTCCTTACCGGCCAAACACCTCGCGAAGCGATGAAGGACGGCGGCAAGAAG
GGAGAGCTGGCGGCGGACTCCGTGTTTGTGCGCGCCCTGGCGAAGCTCAAGCAGCTAAAGGATCTCGAAAGCGTC
GAGGCCTTGGCTGTGCTCGACTTTGTTTCTTCAGCTCAGAACTACTGGCCCTGGACCATCTTTACGCTTCTGCGA
GACACGTCATACATCGAGGGTCTCCAGGCGTATGTGCGTGGTCTGAAGCCGTCACAGTTGACACTCAGGTCAGAC
GCCATCGGCACCAGTCTCGACGCCAGGAAAGCAGCGTATGTGGCAGAGACGCTGGCTATGCAGCTGTACCACGCC
CGCCACCAGGGAACGGCCAAGAAGCTCGCCTCCAGCCTCGTGGCGGATCTCGACTACTTCATTCGCGATGGCGTC
GAGGCTGCGGGATATAACAAGTCCCTGCATAACAACTTTGCCAAGAACTTTGCCACCAGGTATCCTGGCTGCTCC
GTCGACCTCTTCAAGCGGACGCCCTTGGAACCGAGAGAGCTGGGCGCAAACTACTATTACGACGTCGAACGAGCC
GACGACATGCTCAAGTTTGATCCGGCCTGGCTCGGACGGAAAGGCGACGGATTCAAGAAGGAAATGGAGCTGGCC
AATGCCAACTTGTCTCTGGTGGATGCTCAGATAGCCCTCTTCCATGCGTGGGAGTTCTTGCTGGTCGAGCTCGGC
ACATGTCTGCCGACTGGCGAGACCGTCGCCAGGCAGATGCTTCAGGTTGCACAGCAGTGTCTGTCGGCAAACCAG
GGGCTACCGGGTCCAGAAGCCATCTTCATGAAGCTGGTAGAGGCACGGGCGAACCTGGCCCTCATCTTGGTGCAG
CGACTCGTCAAGTCGTCGCTTGCGATAAAGGACGCCAACCAGCTTCTGGCAACGCTCGTCGGCACCATCAACACG
ACCGAGGACCCGTTTACGGAGCGGTCCATCACGCACTATCGCACGCTCCTGAAGACGCTGTTTGTCACGCTTCGC
GTCTATCAGAATGCCGATGTCAAGGTGTTGGCGGAGATGCCAGGGGTGGATGTTGTTCAGACGGTTCTCAACATT
CTCGATCACGTCGTCGGCAGAGGCTTCCGGACGCTCGTCAGCTTCATCCACGAGAGAGACGCCGGCATCTCGCCC
GAAGACTTGGCGCTATTGACGGCAATCCTACAGGCCTGTCTGAGTCTGCCGACGATGGACCAGTCGCAGGCGCAG
ATTGTCAACATCATTGCGTCGCACGATACCATCAACGCCGCCACGTCCCTCTTCTCGTGGGCCGACCAGCTGGCT
GTACAAGGCGACCCCGTCTACGGCGAGCTGAGTGTTCTGTTCTTGCTAGAGCTGTCGAGTCTGCCGCTGCTGGCG
GAACAGCTCGCTTGCGATGGCGTCCTGGGCAACTTGCTGTCGGCCAATCTGGCTCGTTACATGCTCAAAGCCAAC
ATCTCGCCCTACGCGGACGCAGCCATCTCTCAGCGATGCTACTCCATTTGGGCTAAAGGACTCTTGCCGCTGACT
CTCAACCTGCTGACGGCCCTCGGCCCGACGATGGCACCCGAGATTGCCTATCTTTTGAACCAGTTTTCGCACCTG
CTCAAGGCCAGCGTCGATCGGTTCGAGACGCCGAGCGCGAGCCGGACGAGGTCCAAGGCCACGCCACATTACTTG
ACGCTCCTGGCAACGTCCGAGATTCACTCGCTGGCGCTGCTCACGCGCATCCTGGCCGCGCTGCGGGTCAAATGC
GGGCGCGAGATCCCCGACGTCGAGTGGGACGCAGCCGGTCTGCTGGAGAATGTCGACTTCTGGCTATCTACGAGG
CGTCTGCTCAGAGAGCGTCTGTTGCCGCTGGGTTCCCGTGAGATGGAGTGGAGGAATACCAGAGTAACGGTCGAC
GAGGGTCACCATGACAACTTGCTAGAGTGCAAGGTCGTCTGTCAGCTGGAGACGGTACGGGACGTGTTGAGCGAG
GAGCTTGATGCGTGA
Gene >Ophun1|793
ATGGACGCCACACCGGTCGGTGGATCCAACGGGGGAGCTCTCACCGAAGCCTCGGCTGAACCCCGGCACTTCACA
GCTCCCACCCAAAAGTGAGCAGTGCTTCGAGATGCATATCCGCGACCACGCGCGTCGTGATGCATCGCGCGCTGC
TTCCACTTCCCTGACACTTGCGGCCATGGCGCCGGTGTCTGATAGCAGATACTTTCCCTCCCTCGACGACTGTCT
GTCTGGGGACCGACTGCTTTTGTTCGTTTCGCCCGTCTCTTGGTTTGCTTCTTTCTCTGACACGATGCTAGGTCC
TGGAAAGATGTATCGGTCGCGCTCTCGGACGAATCCGGTCATCGGCAATCCTCTTCGGCTCTGATTAAATTTCTC
TCTGATGAGTTTGTTCTCAGCCTGTTGAAAGACCCGTCCAAGGCTTTCGCGCCGCCCAACGAAGGCTCCGAGGCC
GACTTTAAGACCAAGACGGCGCCTATCAACGTCTCCGAAGATGGCGTCGACATCGAGACTATCAAGAGCGACGCA
AAATGGCTCAGCAAAAATGCCAAGATTAATGTCGTTGCCGCGCTTCGCGTCGTCGTCGTTGAATATCAGTCGCGG
CCTCTCAGACATCTCATGGGGCCGCTCTCTTCCCAAGACGCGTCGAATCTTCAAGAGGCTGCAGGCCTTCAGAAC
TCGCAAGGAGCTTCATTTATAGACTTGGGCGCCGCCTCGACTCTCGACGTGGATGAGATATCGGCCAACTTCGAC
AAGCCGGAGTCGAGAAAGAGGCGTCTCATCGATGCGCTGTGGACCGAGCGGCGATCGTTTATGATGGCAGCGGAC
TACATGTTTTCCCTCAAGCTCTACCGTCGGCTGCCGATTCTCACTTCCGTGGACTGTGACTTGGCTGGCATCTAC
CGCCTCGAACCGGCGACGGATAACGTCGCGTCACTCCTGGCCGTCTATCTGAAGGTGGTTTCTGACTGCATGGGC
AGCATCGAGGCTGGTCTCGCCTCCTTGACAGACGACGCCCTGCTCATGGTGCAAGAAGTCGAGCTGGAGTGGATC
GGGAGTCTCCTCACTGAGACGATTCATGCCATGTCGATCGTTTTTCAGCTCGCCGACAGCCTGGGAAGCGAATTT
CCGCCTTCCGACGCCATCAACCAGTGGTTCTCCTTGATGGAGATATACGGCTTTTTTGGATCTGTGCAGCCAGTG
AGCAGCGCAACCCTTCAGGCTGCGTTCGCTGAGGCGCTGACAATTACCCAGATTCATCCAACAATTGCAGAGCTG
ATCCCCCCCCTCAAGGCCTTGTCTTGTGCAGTCTCACTCAGCCTACTTAAACCTGCCAGATCCCTCATCTTTCTC
TCTGATAGGGAAGAGGACTCGACGTTGACCGATAACTCGTATGACGCCTATCTGCTCTCTTCGGATGTACTAGAA
CAGATCCACAAGAGCATCATCAATGCGGCCAGCACGGATTGTGAAGGTGCCACGCCCGTCATATTCGCCTGGACT
CTACTGCTGCACCGCATGACCGTATCCTATCAAACGCGAATGGAGAAGCGAGACGCCCTACAGCAGCAGAGCGCC
GAAAAGAGCTTTGCCCAGAGTACGAACGACGAAGACGAATATCGGCGTGCCGCCCCGAGACGCAATTCTGCTGGT
AGCATCTATTCGATAGAGTCTTCCAAGTTTGACGGGTTCCTTGAGAATGCCGCCGGTCTCAAGGACCTGCAACTG
GTGGAGCAATTGGCCGCCTCAGTCACGGCACACGGAAAGGTTTTTGAGGTCATGGCGGACATGGCCTCTTCGCTG
GGACCGTCGGGCGATGGCAGCATGACGCCACTGATCAGCTCGCGCGTGAGGGTTGCCTTCTTGGAGCTTCTCAAG
GTCTGCTATCCCATTGTTGGCTATCAATCCGAACCGCTGGCGTCATTAATCCATATCTTGGCACCCGGCCACGGT
TATTGGGACCTCTGCTCGTCCAAAGACGCTCTCTCGCCTGCTCAGGATGTCGTGGCCTGCATGCTGCACGACGAC
CACGCCATGGAGTTTTACTTTCAACAGGCTCTGAACAGGTTCCCCTACGAGTTCTCGCCTTTCATCACTCTGTGC
AGGACGTTTTGCGCGGCCAACTTGGACGACGACCGGTCCGACTTGGTACTCGGTCTGCTCCGCAAGACACCGACT
CTCACACTCACCCTTCCCGACGCCTTTTCTGGATATGAGCTTGTTCAAGAAGACGAAAACACCAACTCTTTCTGC
TTGGTACAAGAGATTCCACTCATTTCCCTTTCTTCATCGTGGAGTAGGCGATGTATCGAAGACGACGTGTACCGG
CTGCCGTTAGGGACGTACGGACGCTTCGTCACCGACTCTGGGAGGGTGGTCGTCGTTGATTATCCGCACTCCACT
CTATCGATGCTAGGACGACAGCTGGAAATCAACCTTGTGAAAGAGGGCTATGATTCGGCCCTAGGGATGCTGCAG
TCGGACGACGTTGCCGAGGTCATCTCTCTGCTGTCCACTCTACTCCGTTCTGAGCACCTCAAGGTGGAAGAGACG
AGTGATGGCAACGCCCTGATGCACGAGCAGAGCGACCTCTTGCTGGAAGCCGGCCGGCACATCAGCGGTGGCAAA
GACATCATGGCCGTCGTCTGCGAAACCATGGATCACTTCATGCAAGACGAGCTGGCCATGGCCGATGATGCTGCG
GTTCGCGTTATAGATGCCTGTGTCACGTTCCTGGATGCCATTTTGCTGGTGCAGCCGAACCGCGTCTGGTCGTAC
TTGGCTCGAAGCGAGCTGCTGGGCTCGGAAGTCAGGGCCGGGAAGCTGGCAAAGATCACGGGCACCCTCGATTTG
GTTTCGGGGAGATTCGACTTGCTCACTTCTTCTCTCTCATTCTTCTCTAATCTGGTCGATACGGCCATGCGCTCG
GGCGTCCGCCGTCGAGCCGGCAACAAGCCTGCTGGTCGGCAGAAGCTGGCTTCGAACCCCTGGGCAGGGACCGCT
GACAGGGTGCTCAGCCGGGTAAGCCTGTCCCTGGCGCAGGCCTCCATCGATATCCTGGAGAGCACGTCGACATGG
CGCTTCGACTCTGAAACCAGTCGCTTGTCGGCCGTGAGCAAGGTCGTCCCCGTCCTGGACAAGCTTGTCATGTAC
AGCTACAGCATGGGCGAGTCGCCAAGCTCTGACAGCCTCACATCTTGTCTCGGACCTGCTGCTTCGTACGTCGTT
GATTGCTTCATGTCGCCGGCGACGGGAACTCTTCGATACGGCCCTATACTCTCTTCCCTCGGCGCCGCGTTCGCG
TCGTCTGACAGCACGCTCTATCCGAGTCGCACCGCAATAGTCCAGAGTCAAGCATGCTCTATGCTGGCCTTCTGC
ACGACACTGCTTCGTGCGGCAGACTACCTCGGCCGGTCTCCGGCGATGCTGGAGGCCTACCTGTTCAAAAGCTCG
ACGCTGCTGGCCCGTCTCTCCGCCTCGCCTCGTCAAGTCCGCGGCCCCGTCATTCGCTTGCTCGAGTCGCTCGTC
AGCAGCGCGGGCAAATCTGCTGGCGAGCCGCCCTCGCTGCTGGGATACCTGGGACCTCCATTATCAAAGTCGTTT
CTGCAGTCGCTCGCCGATTTGGGAAAGCCGTTTGCTCTTCCACACGAGGTAAAGACAGTCTGGAGCTTCTTCTCG
TCGATTGTGAGAAACCGGCAGCAGTGGATGTCAAACTGCCTCCTTACCGGCCAAACACCTCGCGAAGCGATGAAG
GACGGCGGCAAGAAGGGAGAGCTGGCGGCGGACTCCGTGTTTGTGCGCGCCCTGGCGAAGCTCAAGCAGCTAAAG
GATCTCGAAAGCGTCGAGGCCTTGGCTGTGCTCGACTTTGTTTCTTCAGCTCAGAACTACTGGCCCTGGACCATC
TTTACGCTTCTGCGAGACACGTCATACATCGAGGGTCTCCAGGCGTATGTGCGTGGTCTGAAGCCGTCACAGTTG
ACACTCAGGTCAGACGCCATCGGCACCAGTCTCGACGCCAGGAAAGCAGCGTATGTGGCAGAGACGCTGGCTATG
CAGCTGTACCACGCCCGCCACCAGGGAACGGCCAAGAAGCTCGCCTCCAGCCTCGTGGCGGATCTCGACTACTTC
ATTCGCGATGGCGTCGAGGCTGCGGGATATAACAAGTCCCTGCATAACAACTTTGCCAAGAACTTTGCCACCAGG
TATCCTGGCTGCTCCGTCGACCTCTTCAAGCGGACGCCCTTGGAACCGAGAGAGCTGGGCGCAAACTACTATTAC
GACGTCGAACGAGCCGACGACATGCTCAAGTTTGATCCGGCCTGGCTCGGACGGAAAGGCGACGGATTCAAGAAG
GAAATGGAGCTGGCCAATGCCAACTTGTCTCTGGTGGATGCTCAGATAGTAAGTCGTCACAGACAGACCCGTGCT
GAGTGGACGATGCTAATCAGACCCGTGGCACAGGCCCTCTTCCATGCGTGGGAGTTCTTGCTGGTCGAGCTCGGC
ACATGTCTGCCGACTGGCGAGACCGTCGCCAGGCAGATGCTTCAGGTTGCACAGCAGTGTCTGTCGGCAAACCAG
GGGCTACCGGGTCCAGAAGCCATCTTCATGAAGCTGGTAGAGGCACGGGCGAACCTGGCCCTCATCTTGGTGCAG
CGACTCGTCAAGTCGTCGCTTGCGATAAAGGACGCCAACCAGCTTCTGGCAACGCTCGTCGGCACCATCAACACG
ACCGAGGACCCGTTTACGGAGCGGTCCATCACGCACTATCGCACGCTCCTGAAGACGCTGTTTGTCACGCTTCGC
GTCTATCAGAATGCCGATGTCAAGGTGTTGGCGGAGATGCCAGGGGTGGATGTTGTTCAGACGGTTCTCAACATT
CTCGATCACGTCGTCGGCAGAGGCTTCCGGACGCTCGTCAGCTTCATCCACGAGAGAGACGCCGGCATCTCGCCC
GAAGACTTGGCGCTATTGACGGCAATCCTACAGGCCTGTCTGAGTCTGCCGACGATGGACCAGTCGCAGGCGCAG
ATTGTCAACATCATTGCGTCGCACGATACCATCAACGCCGCCACGTCCCTCTTCTCGTGGGCCGACCAGCTGGCT
GTACAAGGCGACCCCGTCTACGGCGAGCTGAGTGTTCTGTTCTTGCTAGAGCTGTCGAGTCTGCCGCTGCTGGCG
GAACAGCTCGCTTGCGATGGCGTCCTGGGCAACTTGCTGTCGGCCAATCTGGCTCGTTACATGCTCAAAGCCAAC
ATCTCGCCCTACGCGGACGCAGCCATCTCTCAGCGATGCTACTCCATTTGGGCTAAAGGACTCTTGCCGCTGACT
CTCAACCTGCTGACGGCCCTCGGCCCGACGATGGCACCCGAGATTGCCTATCTTTTGAACCAGTTTTCGCACCTG
CTCAAGGCCAGCGTCGATCGGTTCGAGACGCCGAGCGCGAGCCGGACGAGGTCCAAGGCCACGCCACATTACTTG
ACGCTCCTGGCAACGTCCGAGATTCACTCGCTGGCGCTGCTCACGCGCATCCTGGCCGCGCTGCGGGTCAAATGC
GGGCGCGAGATCCCCGACGTCGAGTGGGACGCAGCCGGTCTGCTGGAGAATGTCGACTTCTGGCTATCTACGAGG
CGTCTGCTCAGAGAGCGTCTGTTGCCGCTGGGTTCCCGTGAGATGGAGTGGAGGAATACCAGAGTAACGGTCGAC
GAGGGTCACCATGACAACTTGCTAGAGTGCAAGGTCGTCTGTCAGCTGGAGACGGTACGGGACGTGTTGAGCGAG
GAGCTTGATGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail