Ophiocordyceps camponoti-rufipedis

General Properties

Protein ID	Ophun1\|792
Gene name
Location	Contig_128:764..3100
Strand	-
Gene length (bp)	2336
Transcript length (bp)	2289
Coding sequence length (bp)	2289
Protein length (aa)	763

PFAM Domains

PFAM Domain ID	Short name	Long name	E-value	Start	End
PF00218	IGPS	Indole-3-glycerol phosphate synthase	1.8E-93	251	513
PF00697	PRAI	N-(5'phosphoribosyl)anthranilate (PRA) isomerase	2.1E-45	571	756
PF00117	GATase	Glutamine amidotransferase class-I	6.2E-46	29	216
PF07722	Peptidase_C26	Peptidase C26	2.1E-04	96	201

Swissprot hits

[Show all]

Swissprot ID	Swissprot Description	Start	End	E-value
sp\|P00908\|TRPG_NEUCR	Multifunctional tryptophan biosynthesis protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=trp-1 PE=3 SV=2	3	762	0.0E+00
sp\|P24773\|TRPG_PENCH	Multifunctional tryptophan biosynthesis protein OS=Penicillium chrysogenum GN=trpC PE=3 SV=1	6	762	0.0E+00
sp\|P06531\|TRPG_EMENI	Multifunctional tryptophan biosynthesis protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=trpC PE=2 SV=3	7	760	0.0E+00
sp\|P05328\|TRPG_ASPNG	Multifunctional tryptophan biosynthesis protein OS=Aspergillus niger GN=trpC PE=3 SV=1	7	761	0.0E+00
sp\|P18483\|TRPG_ASPAW	Multifunctional tryptophan biosynthesis protein OS=Aspergillus awamori GN=trpC PE=3 SV=1	7	761	0.0E+00

[Show all]

[Show less]

Swissprot ID	Swissprot Description	Start	End	E-value
sp\|P00908\|TRPG_NEUCR	Multifunctional tryptophan biosynthesis protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=trp-1 PE=3 SV=2	3	762	0.0E+00
sp\|P24773\|TRPG_PENCH	Multifunctional tryptophan biosynthesis protein OS=Penicillium chrysogenum GN=trpC PE=3 SV=1	6	762	0.0E+00
sp\|P06531\|TRPG_EMENI	Multifunctional tryptophan biosynthesis protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=trpC PE=2 SV=3	7	760	0.0E+00
sp\|P05328\|TRPG_ASPNG	Multifunctional tryptophan biosynthesis protein OS=Aspergillus niger GN=trpC PE=3 SV=1	7	761	0.0E+00
sp\|P18483\|TRPG_ASPAW	Multifunctional tryptophan biosynthesis protein OS=Aspergillus awamori GN=trpC PE=3 SV=1	7	761	0.0E+00
sp\|Q92411\|TRPG_COCHE	Multifunctional tryptophan biosynthesis protein OS=Cochliobolus heterostrophus GN=TRP1 PE=3 SV=1	1	761	0.0E+00
sp\|Q92370\|TRPG_SCHPO	Multifunctional tryptophan biosynthesis protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trp1 PE=2 SV=2	27	761	0.0E+00
sp\|P20409\|TRPG_PHYBL	Multifunctional tryptophan biosynthesis protein OS=Phycomyces blakesleeanus GN=trp1 PE=3 SV=1	28	761	0.0E+00
sp\|P0CN86\|TRPG_CRYNJ	Multifunctional tryptophan biosynthesis protein OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TRP1 PE=3 SV=1	28	759	0.0E+00
sp\|P0CN87\|TRPG_CRYNB	Multifunctional tryptophan biosynthesis protein OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TRP1 PE=3 SV=1	28	759	0.0E+00
sp\|P27710\|TRPG_CRYNH	Multifunctional tryptophan biosynthesis protein OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=TRP1 PE=3 SV=2	28	760	0.0E+00
sp\|P25170\|TRPG_PHACH	Multifunctional tryptophan biosynthesis protein OS=Phanerochaete chrysosporium GN=TRPC PE=3 SV=1	26	761	0.0E+00
sp\|P00937\|TRPG_YEAST	Multifunctional tryptophan biosynthesis protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRP3 PE=1 SV=2	22	514	0.0E+00
sp\|P09575\|TRPG_PICAN	Multifunctional tryptophan biosynthesis protein (Fragment) OS=Pichia angusta PE=3 SV=1	21	401	8.0E-147
sp\|P24920\|TRPC_PHYPR	Tryptophan biosynthesis protein TRP1 OS=Phytophthora parasitica GN=TRP1 PE=3 SV=1	249	759	2.0E-81
sp\|P00901\|TRPG_PSEPU	Anthranilate synthase component 2 OS=Pseudomonas putida GN=trpG PE=1 SV=2	27	221	3.0E-66
sp\|P20576\|TRPG_PSEAE	Anthranilate synthase component 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=trpG PE=3 SV=2	27	225	4.0E-63
sp\|P06193\|PABA_SALTY	Aminodeoxychorismate synthase component 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pabA PE=3 SV=1	27	216	2.0E-60
sp\|P00903\|PABA_ECOLI	Aminodeoxychorismate synthase component 2 OS=Escherichia coli (strain K12) GN=pabA PE=1 SV=1	27	217	2.0E-59
sp\|P06194\|PABA_ENTAE	Aminodeoxychorismate synthase component 2 OS=Enterobacter aerogenes GN=pabA PE=3 SV=1	27	217	1.0E-58
sp\|P06195\|PABA_SERMA	Aminodeoxychorismate synthase component 2 OS=Serratia marcescens GN=pabA PE=3 SV=1	27	216	7.0E-58
sp\|Q08654\|TRPGD_THEMA	Bifunctional protein TrpGD OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=trpGD PE=3 SV=2	27	219	3.0E-56
sp\|P28819\|PABA_BACSU	Aminodeoxychorismate/anthranilate synthase component 2 OS=Bacillus subtilis (strain 168) GN=pabA PE=2 SV=1	27	216	8.0E-56
sp\|P00902\|TRPG_ACIAD	Anthranilate synthase component 2 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=trpG PE=3 SV=1	27	218	4.0E-55
sp\|A6X0L0\|TRPC_OCHA4	Indole-3-glycerol phosphate synthase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=trpC PE=3 SV=1	248	516	4.0E-51
sp\|A6Q3P0\|TRPC_NITSB	Indole-3-glycerol phosphate synthase OS=Nitratiruptor sp. (strain SB155-2) GN=trpC PE=3 SV=1	250	502	6.0E-50
sp\|P20441\|TRPG_LEPBI	Anthranilate synthase component 2 OS=Leptospira biflexa GN=trpG PE=3 SV=2	27	217	7.0E-50
sp\|A5VQR5\|TRPC_BRUO2	Indole-3-glycerol phosphate synthase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=trpC PE=3 SV=1	248	519	2.0E-49
sp\|P66989\|TRPC_BRUSU	Indole-3-glycerol phosphate synthase OS=Brucella suis biovar 1 (strain 1330) GN=trpC PE=3 SV=1	248	519	3.0E-49
sp\|P66988\|TRPC_BRUME	Indole-3-glycerol phosphate synthase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=trpC PE=3 SV=1	248	519	3.0E-49
sp\|C0RJB1\|TRPC_BRUMB	Indole-3-glycerol phosphate synthase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=trpC PE=3 SV=1	248	519	3.0E-49
sp\|A9M5F4\|TRPC_BRUC2	Indole-3-glycerol phosphate synthase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=trpC PE=3 SV=1	248	519	3.0E-49
sp\|Q57CZ8\|TRPC_BRUAB	Indole-3-glycerol phosphate synthase OS=Brucella abortus biovar 1 (strain 9-941) GN=trpC PE=3 SV=1	248	519	3.0E-49
sp\|Q2YRR4\|TRPC_BRUA2	Indole-3-glycerol phosphate synthase OS=Brucella abortus (strain 2308) GN=trpC PE=1 SV=1	248	519	3.0E-49
sp\|B2S5Z1\|TRPC_BRUA1	Indole-3-glycerol phosphate synthase OS=Brucella abortus (strain S19) GN=trpC PE=3 SV=1	248	519	3.0E-49
sp\|B0CGT9\|TRPC_BRUSI	Indole-3-glycerol phosphate synthase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=trpC PE=3 SV=1	248	519	4.0E-49
sp\|P48261\|TRPG_CYAPA	Anthranilate synthase component 2 OS=Cyanophora paradoxa GN=trpG PE=3 SV=1	27	217	5.0E-49
sp\|Q3Z6G5\|TRPC_DEHM1	Indole-3-glycerol phosphate synthase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=trpC PE=3 SV=1	287	513	6.0E-49
sp\|Q3ZZ14\|TRPC_DEHMC	Indole-3-glycerol phosphate synthase OS=Dehalococcoides mccartyi (strain CBDB1) GN=trpC PE=3 SV=1	302	513	9.0E-49
sp\|A6WC91\|TRPC_KINRD	Indole-3-glycerol phosphate synthase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=trpC PE=3 SV=1	302	525	1.0E-48
sp\|A5FPM3\|TRPC_DEHMB	Indole-3-glycerol phosphate synthase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=trpC PE=3 SV=1	302	513	5.0E-48
sp\|A1VYK3\|TRPC_CAMJJ	Indole-3-glycerol phosphate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=trpC PE=3 SV=1	250	507	1.0E-47
sp\|Q5HVR3\|TRPC_CAMJR	Indole-3-glycerol phosphate synthase OS=Campylobacter jejuni (strain RM1221) GN=trpC PE=3 SV=1	250	507	2.0E-47
sp\|Q9PI11\|TRPC_CAMJE	Indole-3-glycerol phosphate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=trpC PE=3 SV=1	250	507	2.0E-47
sp\|A8FKS2\|TRPC_CAMJ8	Indole-3-glycerol phosphate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=trpC PE=3 SV=1	250	507	2.0E-47
sp\|A7H4P0\|TRPC_CAMJD	Indole-3-glycerol phosphate synthase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=trpC PE=3 SV=1	250	507	2.0E-47
sp\|Q7UKJ7\|TRPC_RHOBA	Indole-3-glycerol phosphate synthase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=trpC PE=3 SV=1	302	508	2.0E-47
sp\|B1GZC0\|TRPC_UNCTG	Indole-3-glycerol phosphate synthase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=trpC PE=3 SV=1	250	513	3.0E-47
sp\|B8I0V0\|TRPC_CLOCE	Indole-3-glycerol phosphate synthase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=trpC PE=3 SV=1	293	513	4.0E-47
sp\|Q42565\|ASB1_ARATH	Anthranilate synthase beta subunit 1, chloroplastic OS=Arabidopsis thaliana GN=ASB1 PE=1 SV=1	27	229	4.0E-47
sp\|P33974\|TRPG_HALVD	Anthranilate synthase component 2 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=trpG PE=3 SV=2	27	221	7.0E-47
sp\|Q7XUS2\|ASB1_ORYSJ	Anthranilate synthase beta subunit 1, chloroplastic OS=Oryza sativa subsp. japonica GN=ASB1 PE=1 SV=1	27	218	8.0E-47
sp\|A1VTG7\|TRPC_POLNA	Indole-3-glycerol phosphate synthase OS=Polaromonas naphthalenivorans (strain CJ2) GN=trpC PE=3 SV=1	303	513	1.0E-46
sp\|Q21SE8\|TRPC_RHOFT	Indole-3-glycerol phosphate synthase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=trpC PE=3 SV=1	248	513	2.0E-46
sp\|A7GYQ7\|TRPC_CAMC5	Indole-3-glycerol phosphate synthase OS=Campylobacter curvus (strain 525.92) GN=trpC PE=3 SV=1	304	516	3.0E-46
sp\|A9VJW0\|TRPC_BACWK	Indole-3-glycerol phosphate synthase OS=Bacillus weihenstephanensis (strain KBAB4) GN=trpC PE=3 SV=1	291	512	4.0E-46
sp\|A7NMZ8\|TRPC_ROSCS	Indole-3-glycerol phosphate synthase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=trpC PE=3 SV=1	248	513	5.0E-46
sp\|A9KL43\|TRPC_CLOPH	Indole-3-glycerol phosphate synthase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=trpC PE=3 SV=1	302	515	6.0E-46
sp\|Q9FJM5\|ASB2_ARATH	Anthranilate synthase beta subunit 2, chloroplastic OS=Arabidopsis thaliana GN=ASB2 PE=2 SV=1	27	229	7.0E-46
sp\|P05379\|TRPG_THET8	Anthranilate synthase component 2 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=trpG PE=3 SV=1	27	216	8.0E-46
sp\|B7JES8\|TRPC_BACC0	Indole-3-glycerol phosphate synthase OS=Bacillus cereus (strain AH820) GN=trpC PE=3 SV=1	291	512	8.0E-46
sp\|Q81TM0\|TRPC_BACAN	Indole-3-glycerol phosphate synthase OS=Bacillus anthracis GN=trpC PE=3 SV=1	291	512	8.0E-46
sp\|C3LAW0\|TRPC_BACAC	Indole-3-glycerol phosphate synthase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=trpC PE=3 SV=1	291	512	8.0E-46
sp\|C3P3T8\|TRPC_BACAA	Indole-3-glycerol phosphate synthase OS=Bacillus anthracis (strain A0248) GN=trpC PE=3 SV=1	291	512	8.0E-46
sp\|Q6HLU6\|TRPC_BACHK	Indole-3-glycerol phosphate synthase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=trpC PE=3 SV=1	291	512	9.0E-46
sp\|Q81GG7\|TRPC_BACCR	Indole-3-glycerol phosphate synthase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=trpC PE=3 SV=1	267	512	1.0E-45
sp\|B7HGZ9\|TRPC_BACC4	Indole-3-glycerol phosphate synthase OS=Bacillus cereus (strain B4264) GN=trpC PE=3 SV=1	267	512	1.0E-45
sp\|A5USQ4\|TRPC_ROSS1	Indole-3-glycerol phosphate synthase OS=Roseiflexus sp. (strain RS-1) GN=trpC PE=3 SV=1	248	517	1.0E-45
sp\|B9JX64\|TRPC_AGRVS	Indole-3-glycerol phosphate synthase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=trpC PE=3 SV=1	248	505	1.0E-45
sp\|A8LGR8\|TRPC_FRASN	Indole-3-glycerol phosphate synthase OS=Frankia sp. (strain EAN1pec) GN=trpC PE=3 SV=1	302	525	2.0E-45
sp\|Q63EC9\|TRPC_BACCZ	Indole-3-glycerol phosphate synthase OS=Bacillus cereus (strain ZK / E33L) GN=trpC PE=3 SV=1	267	512	2.0E-45
sp\|B7IM74\|TRPC_BACC2	Indole-3-glycerol phosphate synthase OS=Bacillus cereus (strain G9842) GN=trpC PE=3 SV=1	267	512	2.0E-45
sp\|C1ELE8\|TRPC_BACC3	Indole-3-glycerol phosphate synthase OS=Bacillus cereus (strain 03BB102) GN=trpC PE=3 SV=1	291	512	3.0E-45
sp\|A0RB62\|TRPC_BACAH	Indole-3-glycerol phosphate synthase OS=Bacillus thuringiensis (strain Al Hakam) GN=trpC PE=3 SV=1	291	512	3.0E-45
sp\|B1YLS2\|TRPC_EXIS2	Indole-3-glycerol phosphate synthase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=trpC PE=3 SV=1	249	519	4.0E-45
sp\|Q98ME3\|TRPC_RHILO	Indole-3-glycerol phosphate synthase OS=Rhizobium loti (strain MAFF303099) GN=trpC PE=3 SV=1	248	516	4.0E-45
sp\|B2FKL1\|TRPC_STRMK	Indole-3-glycerol phosphate synthase OS=Stenotrophomonas maltophilia (strain K279a) GN=trpC PE=3 SV=1	248	507	5.0E-45
sp\|Q123F4\|TRPC_POLSJ	Indole-3-glycerol phosphate synthase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=trpC PE=3 SV=1	303	513	6.0E-45
sp\|Q5V214\|TRPG1_HALMA	Anthranilate synthase component II OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=trpG1 PE=3 SV=1	14	216	6.0E-45
sp\|B9IU36\|TRPC_BACCQ	Indole-3-glycerol phosphate synthase OS=Bacillus cereus (strain Q1) GN=trpC PE=3 SV=1	267	512	7.0E-45
sp\|B7I0F0\|TRPC_BACC7	Indole-3-glycerol phosphate synthase OS=Bacillus cereus (strain AH187) GN=trpC PE=3 SV=1	267	512	7.0E-45
sp\|Q9HPG6\|TRPG_HALSA	Anthranilate synthase component 2 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=trpG PE=3 SV=1	26	216	1.0E-44
sp\|B3EG28\|TRPC_CHLL2	Indole-3-glycerol phosphate synthase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=trpC PE=3 SV=1	251	505	1.0E-44
sp\|Q3ABS1\|TRPC_CARHZ	Indole-3-glycerol phosphate synthase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=trpC PE=3 SV=1	251	507	2.0E-44
sp\|Q7TTU3\|TRPC_SYNPX	Indole-3-glycerol phosphate synthase OS=Synechococcus sp. (strain WH8102) GN=trpC PE=3 SV=1	240	516	2.0E-44
sp\|A0RNN3\|TRPC_CAMFF	Indole-3-glycerol phosphate synthase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=trpC PE=3 SV=1	292	502	2.0E-44
sp\|A0AJ82\|TRPC_LISW6	Indole-3-glycerol phosphate synthase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=trpC PE=3 SV=1	249	502	2.0E-44
sp\|Q764B9\|ASB2_ORYSJ	Anthranilate synthase beta subunit 2, chloroplastic OS=Oryza sativa subsp. japonica GN=ASB2 PE=2 SV=1	27	226	2.0E-44
sp\|A9HY11\|TRPC_BORPD	Indole-3-glycerol phosphate synthase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=trpC PE=3 SV=1	248	513	3.0E-44
sp\|Q2IWB0\|TRPC_RHOP2	Indole-3-glycerol phosphate synthase OS=Rhodopseudomonas palustris (strain HaA2) GN=trpC PE=3 SV=1	248	505	3.0E-44
sp\|C3MCF2\|TRPC_RHISN	Indole-3-glycerol phosphate synthase OS=Rhizobium sp. (strain NGR234) GN=trpC PE=3 SV=1	248	524	3.0E-44
sp\|Q03X00\|TRPC_LEUMM	Indole-3-glycerol phosphate synthase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=trpC PE=3 SV=1	296	513	3.0E-44
sp\|A3DDS7\|TRPC_CLOTH	Indole-3-glycerol phosphate synthase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=trpC PE=3 SV=1	301	503	3.0E-44
sp\|B4SLE8\|TRPC_STRM5	Indole-3-glycerol phosphate synthase OS=Stenotrophomonas maltophilia (strain R551-3) GN=trpC PE=3 SV=1	248	507	3.0E-44
sp\|Q7M831\|TRPC_WOLSU	Indole-3-glycerol phosphate synthase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=trpC PE=3 SV=1	304	506	3.0E-44
sp\|B4RBX5\|TRPC_PHEZH	Indole-3-glycerol phosphate synthase OS=Phenylobacterium zucineum (strain HLK1) GN=trpC PE=3 SV=1	248	505	4.0E-44
sp\|B9LAF4\|TRPC_NAUPA	Indole-3-glycerol phosphate synthase OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=trpC PE=3 SV=1	304	502	4.0E-44
sp\|B3QLY7\|TRPC_CHLP8	Indole-3-glycerol phosphate synthase OS=Chlorobaculum parvum (strain NCIB 8327) GN=trpC PE=3 SV=1	251	501	5.0E-44
sp\|Q2G6R0\|TRPC_NOVAD	Indole-3-glycerol phosphate synthase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=trpC PE=3 SV=1	303	505	5.0E-44
sp\|B1XSZ1\|TRPC_POLNS	Indole-3-glycerol phosphate synthase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=trpC PE=3 SV=1	303	515	5.0E-44
sp\|Q11HU1\|TRPC_CHESB	Indole-3-glycerol phosphate synthase OS=Chelativorans sp. (strain BNC1) GN=trpC PE=3 SV=1	249	505	9.0E-44
sp\|B2JHI8\|TRPC_BURP8	Indole-3-glycerol phosphate synthase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=trpC PE=3 SV=1	248	513	1.0E-43
sp\|Q1XDC5\|TRPG_PYRYE	Anthranilate synthase component 2 OS=Pyropia yezoensis GN=trpG PE=3 SV=1	27	216	1.0E-43
sp\|Q30SM1\|TRPC_SULDN	Indole-3-glycerol phosphate synthase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=trpC PE=3 SV=1	297	517	1.0E-43
sp\|Q87EX2\|TRPC_XYLFT	Indole-3-glycerol phosphate synthase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=trpC PE=3 SV=1	301	513	1.0E-43
sp\|B2I6S5\|TRPC_XYLF2	Indole-3-glycerol phosphate synthase OS=Xylella fastidiosa (strain M23) GN=trpC PE=3 SV=1	301	513	1.0E-43
sp\|Q7CYR2\|TRPC_AGRFC	Indole-3-glycerol phosphate synthase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=trpC PE=3 SV=2	248	516	1.0E-43
sp\|B0K8T4\|TRPC_THEP3	Indole-3-glycerol phosphate synthase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=trpC PE=3 SV=1	302	501	1.0E-43
sp\|B9JFD8\|TRPC_AGRRK	Indole-3-glycerol phosphate synthase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=trpC PE=3 SV=1	248	516	2.0E-43
sp\|B3Q0L3\|TRPC_RHIE6	Indole-3-glycerol phosphate synthase OS=Rhizobium etli (strain CIAT 652) GN=trpC PE=3 SV=1	248	505	2.0E-43
sp\|Q9PGT5\|TRPC_XYLFA	Indole-3-glycerol phosphate synthase OS=Xylella fastidiosa (strain 9a5c) GN=trpC PE=3 SV=1	301	513	2.0E-43
sp\|A6U9C5\|TRPC_SINMW	Indole-3-glycerol phosphate synthase OS=Sinorhizobium medicae (strain WSM419) GN=trpC PE=3 SV=1	248	517	2.0E-43
sp\|B0K2U1\|TRPC_THEPX	Indole-3-glycerol phosphate synthase OS=Thermoanaerobacter sp. (strain X514) GN=trpC PE=3 SV=1	302	501	3.0E-43
sp\|A4SV52\|TRPC_POLSQ	Indole-3-glycerol phosphate synthase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=trpC PE=3 SV=1	304	513	3.0E-43
sp\|Q8KBW1\|TRPC_CHLTE	Indole-3-glycerol phosphate synthase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=trpC PE=3 SV=1	251	509	4.0E-43
sp\|B0U1P0\|TRPC_XYLFM	Indole-3-glycerol phosphate synthase OS=Xylella fastidiosa (strain M12) GN=trpC PE=3 SV=1	301	513	4.0E-43
sp\|Q7VU67\|TRPC_BORPE	Indole-3-glycerol phosphate synthase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=trpC PE=3 SV=1	248	515	4.0E-43
sp\|Q7W387\|TRPC_BORPA	Indole-3-glycerol phosphate synthase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=trpC PE=3 SV=1	248	515	4.0E-43
sp\|Q7WEK6\|TRPC_BORBR	Indole-3-glycerol phosphate synthase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=trpC PE=3 SV=1	248	515	4.0E-43
sp\|C4Z138\|TRPC_EUBE2	Indole-3-glycerol phosphate synthase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=trpC PE=3 SV=1	293	513	5.0E-43
sp\|Q92PR9\|TRPC_RHIME	Indole-3-glycerol phosphate synthase OS=Rhizobium meliloti (strain 1021) GN=trpC PE=3 SV=1	248	517	5.0E-43
sp\|A8ET36\|TRPC_ARCB4	Indole-3-glycerol phosphate synthase OS=Arcobacter butzleri (strain RM4018) GN=trpC PE=3 SV=1	282	504	5.0E-43
sp\|A8ZZX0\|TRPC_DESOH	Indole-3-glycerol phosphate synthase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=trpC PE=3 SV=1	290	515	5.0E-43
sp\|Q6AF68\|TRPC_LEIXX	Indole-3-glycerol phosphate synthase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=trpC PE=3 SV=1	298	501	6.0E-43
sp\|B8DHB2\|TRPC_LISMH	Indole-3-glycerol phosphate synthase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=trpC PE=3 SV=1	249	507	7.0E-43
sp\|Q71Z38\|TRPC_LISMF	Indole-3-glycerol phosphate synthase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=trpC PE=3 SV=1	249	507	9.0E-43
sp\|C1KVS7\|TRPC_LISMC	Indole-3-glycerol phosphate synthase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=trpC PE=3 SV=1	249	507	9.0E-43
sp\|Q2K879\|TRPC_RHIEC	Indole-3-glycerol phosphate synthase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=trpC PE=3 SV=1	248	505	9.0E-43
sp\|Q0K6I0\|TRPC_CUPNH	Indole-3-glycerol phosphate synthase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=trpC PE=3 SV=1	248	513	9.0E-43
sp\|Q3AU73\|TRPC_CHLCH	Indole-3-glycerol phosphate synthase OS=Chlorobium chlorochromatii (strain CaD3) GN=trpC PE=3 SV=1	251	500	1.0E-42
sp\|Q8PD70\|TRPC_XANCP	Indole-3-glycerol phosphate synthase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=trpC PE=3 SV=1	303	513	1.0E-42
sp\|Q4UZF8\|TRPC_XANC8	Indole-3-glycerol phosphate synthase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=trpC PE=3 SV=1	303	513	1.0E-42
sp\|B8EJS1\|TRPC_METSB	Indole-3-glycerol phosphate synthase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=trpC PE=3 SV=1	302	516	1.0E-42
sp\|A8Z6K1\|TRPC_CAMC1	Indole-3-glycerol phosphate synthase OS=Campylobacter concisus (strain 13826) GN=trpC PE=3 SV=1	262	516	1.0E-42
sp\|Q8Y6Q4\|TRPC_LISMO	Indole-3-glycerol phosphate synthase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=trpC PE=3 SV=1	249	502	1.0E-42
sp\|Q88WI2\|TRPC_LACPL	Indole-3-glycerol phosphate synthase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=trpC PE=3 SV=1	304	518	2.0E-42
sp\|O68814\|TRPC1_STRCO	Indole-3-glycerol phosphate synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trpC1 PE=3 SV=3	302	525	2.0E-42
sp\|Q1MGE1\|TRPC_RHIL3	Indole-3-glycerol phosphate synthase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=trpC PE=3 SV=1	248	516	2.0E-42
sp\|Q5P2G1\|TRPC_AROAE	Indole-3-glycerol phosphate synthase OS=Aromatoleum aromaticum (strain EbN1) GN=trpC PE=3 SV=1	248	507	3.0E-42
sp\|A1TJQ2\|TRPC_ACIAC	Indole-3-glycerol phosphate synthase OS=Acidovorax citrulli (strain AAC00-1) GN=trpC PE=3 SV=1	248	513	3.0E-42
sp\|Q9A727\|TRPC_CAUCR	Indole-3-glycerol phosphate synthase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=trpC PE=3 SV=1	248	505	4.0E-42
sp\|B8GWP9\|TRPC_CAUCN	Indole-3-glycerol phosphate synthase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=trpC PE=3 SV=1	248	505	4.0E-42
sp\|A8I836\|TRPC_AZOC5	Indole-3-glycerol phosphate synthase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=trpC PE=3 SV=1	303	516	5.0E-42
sp\|B5ZPY7\|TRPC_RHILW	Indole-3-glycerol phosphate synthase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=trpC PE=3 SV=1	248	505	6.0E-42
sp\|P94327\|TRPC_BRADU	Indole-3-glycerol phosphate synthase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=trpC PE=3 SV=2	248	524	7.0E-42
sp\|Q6AMS4\|TRPC_DESPS	Indole-3-glycerol phosphate synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=trpC PE=3 SV=1	248	513	8.0E-42
sp\|C1AT55\|TRPC_RHOOB	Indole-3-glycerol phosphate synthase OS=Rhodococcus opacus (strain B4) GN=trpC PE=3 SV=1	302	525	8.0E-42
sp\|C1D7J7\|TRPC_LARHH	Indole-3-glycerol phosphate synthase OS=Laribacter hongkongensis (strain HLHK9) GN=trpC PE=3 SV=1	248	513	8.0E-42
sp\|Q97EF3\|TRPC_CLOAB	Indole-3-glycerol phosphate synthase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=trpC PE=3 SV=1	301	519	1.0E-41
sp\|Q0SHZ5\|TRPC_RHOJR	Indole-3-glycerol phosphate synthase OS=Rhodococcus jostii (strain RHA1) GN=trpC PE=3 SV=1	302	525	1.0E-41
sp\|P22098\|TRPC_VIBPA	Tryptophan biosynthesis protein TrpCF OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=trpC PE=3 SV=2	304	762	2.0E-41
sp\|Q07NF6\|TRPC_RHOP5	Indole-3-glycerol phosphate synthase OS=Rhodopseudomonas palustris (strain BisA53) GN=trpC PE=3 SV=1	248	505	2.0E-41
sp\|B2SL03\|TRPC_XANOP	Indole-3-glycerol phosphate synthase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=trpC PE=3 SV=1	301	513	2.0E-41
sp\|Q7NUI6\|TRPC_CHRVO	Indole-3-glycerol phosphate synthase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=trpC PE=3 SV=1	294	513	2.0E-41
sp\|Q215B9\|TRPC_RHOPB	Indole-3-glycerol phosphate synthase OS=Rhodopseudomonas palustris (strain BisB18) GN=trpC PE=3 SV=1	248	505	2.0E-41
sp\|Q1B7H6\|TRPC_MYCSS	Indole-3-glycerol phosphate synthase OS=Mycobacterium sp. (strain MCS) GN=trpC PE=3 SV=1	249	525	2.0E-41
sp\|A1UHJ6\|TRPC_MYCSK	Indole-3-glycerol phosphate synthase OS=Mycobacterium sp. (strain KMS) GN=trpC PE=3 SV=1	249	525	2.0E-41
sp\|A3Q119\|TRPC_MYCSJ	Indole-3-glycerol phosphate synthase OS=Mycobacterium sp. (strain JLS) GN=trpC PE=3 SV=1	249	525	2.0E-41
sp\|Q1QMJ9\|TRPC_NITHX	Indole-3-glycerol phosphate synthase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=trpC PE=3 SV=1	249	505	2.0E-41
sp\|Q82A84\|TRPC_STRAW	Indole-3-glycerol phosphate synthase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=trpC PE=3 SV=1	302	525	2.0E-41
sp\|A4SG41\|TRPC_CHLPM	Indole-3-glycerol phosphate synthase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=trpC PE=3 SV=1	258	500	2.0E-41
sp\|P51362\|TRPG_PORPU	Anthranilate synthase component 2 OS=Porphyra purpurea GN=trpG PE=3 SV=1	27	216	3.0E-41
sp\|Q5NQ36\|TRPC_ZYMMO	Indole-3-glycerol phosphate synthase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=trpC PE=3 SV=1	248	505	4.0E-41
sp\|Q3BYB5\|TRPC_XANC5	Indole-3-glycerol phosphate synthase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=trpC PE=3 SV=1	301	513	4.0E-41
sp\|Q03CY1\|TRPC_LACC3	Indole-3-glycerol phosphate synthase OS=Lactobacillus casei (strain ATCC 334) GN=trpC PE=3 SV=1	291	503	4.0E-41
sp\|B3W6W8\|TRPC_LACCB	Indole-3-glycerol phosphate synthase OS=Lactobacillus casei (strain BL23) GN=trpC PE=3 SV=1	291	503	5.0E-41
sp\|Q2NYD7\|TRPC_XANOM	Indole-3-glycerol phosphate synthase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=trpC PE=3 SV=1	301	513	6.0E-41
sp\|B2IKL7\|TRPC_BEII9	Indole-3-glycerol phosphate synthase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=trpC PE=3 SV=1	249	505	7.0E-41
sp\|P00905\|TRPGD_SALTY	Bifunctional protein TrpGD OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=trpGD PE=1 SV=4	25	278	1.0E-40
sp\|A7HXZ6\|TRPC_PARL1	Indole-3-glycerol phosphate synthase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=trpC PE=3 SV=1	303	505	1.0E-40
sp\|P17217\|TRPC_LACCA	Indole-3-glycerol phosphate synthase OS=Lactobacillus casei GN=trpC PE=3 SV=1	294	503	1.0E-40
sp\|Q8PQ47\|TRPC_XANAC	Indole-3-glycerol phosphate synthase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=trpC PE=3 SV=1	301	513	1.0E-40
sp\|Q9XBM3\|TRPC_ZYMMT	Indole-3-glycerol phosphate synthase OS=Zymomonas mobilis subsp. pomaceae (strain ATCC 29192 / JCM 10191 / NBRC 13757 / NCIMB 11200 / NRRL B-4491) GN=trpC PE=3 SV=2	248	505	1.0E-40
sp\|B1MBV4\|TRPC_MYCA9	Indole-3-glycerol phosphate synthase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=trpC PE=3 SV=1	302	525	1.0E-40
sp\|Q73BQ9\|TRPC_BACC1	Indole-3-glycerol phosphate synthase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=trpC PE=3 SV=1	291	512	1.0E-40
sp\|B3QZD6\|TRPC_CHLT3	Indole-3-glycerol phosphate synthase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=trpC PE=3 SV=1	296	501	2.0E-40
sp\|B3Q6M9\|TRPC_RHOPT	Indole-3-glycerol phosphate synthase OS=Rhodopseudomonas palustris (strain TIE-1) GN=trpC PE=3 SV=1	248	505	2.0E-40
sp\|Q10ZM7\|TRPC_TRIEI	Indole-3-glycerol phosphate synthase OS=Trichodesmium erythraeum (strain IMS101) GN=trpC PE=3 SV=1	244	518	2.0E-40
sp\|B0JTM2\|TRPC_MICAN	Indole-3-glycerol phosphate synthase OS=Microcystis aeruginosa (strain NIES-843) GN=trpC PE=3 SV=1	283	513	2.0E-40
sp\|Q3B2C7\|TRPC_CHLL7	Indole-3-glycerol phosphate synthase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=trpC PE=3 SV=1	251	500	2.0E-40
sp\|B6JG29\|TRPC_OLICO	Indole-3-glycerol phosphate synthase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=trpC PE=3 SV=1	248	505	2.0E-40
sp\|A1T8X3\|TRPC_MYCVP	Indole-3-glycerol phosphate synthase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=trpC PE=3 SV=1	285	527	2.0E-40
sp\|A5N7N8\|TRPC_CLOK5	Indole-3-glycerol phosphate synthase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=trpC PE=3 SV=1	301	502	2.0E-40
sp\|B9E149\|TRPC_CLOK1	Indole-3-glycerol phosphate synthase OS=Clostridium kluyveri (strain NBRC 12016) GN=trpC PE=3 SV=1	301	502	2.0E-40
sp\|Q92B79\|TRPC_LISIN	Indole-3-glycerol phosphate synthase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=trpC PE=3 SV=1	251	502	2.0E-40
sp\|Q3SRJ3\|TRPC_NITWN	Indole-3-glycerol phosphate synthase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=trpC PE=3 SV=1	301	505	3.0E-40
sp\|A0PP28\|TRPC_MYCUA	Indole-3-glycerol phosphate synthase OS=Mycobacterium ulcerans (strain Agy99) GN=trpC PE=3 SV=1	302	525	3.0E-40
sp\|A4T9N5\|TRPC_MYCGI	Indole-3-glycerol phosphate synthase OS=Mycobacterium gilvum (strain PYR-GCK) GN=trpC PE=3 SV=1	249	525	3.0E-40
sp\|B4SDV8\|TRPC_PELPB	Indole-3-glycerol phosphate synthase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=trpC PE=3 SV=1	267	507	3.0E-40
sp\|Q9JSN4\|TRPC_NEIMA	Indole-3-glycerol phosphate synthase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=trpC PE=3 SV=1	248	505	4.0E-40
sp\|Q3AV87\|TRPC_SYNS9	Indole-3-glycerol phosphate synthase OS=Synechococcus sp. (strain CC9902) GN=trpC PE=3 SV=1	240	505	4.0E-40
sp\|Q9KCB2\|TRPC_BACHD	Indole-3-glycerol phosphate synthase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=trpC PE=3 SV=1	289	508	4.0E-40
sp\|Q2KU99\|TRPC_BORA1	Indole-3-glycerol phosphate synthase OS=Bordetella avium (strain 197N) GN=trpC PE=3 SV=1	248	515	4.0E-40
sp\|P00910\|TRPC_SALTY	Tryptophan biosynthesis protein TrpCF OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=trpC PE=3 SV=1	303	741	5.0E-40
sp\|Q9K192\|TRPC_NEIMB	Indole-3-glycerol phosphate synthase OS=Neisseria meningitidis serogroup B (strain MC58) GN=trpC PE=3 SV=1	248	505	5.0E-40
sp\|B2HQX7\|TRPC_MYCMM	Indole-3-glycerol phosphate synthase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=trpC PE=3 SV=1	302	525	6.0E-40
sp\|Q3AL94\|TRPC_SYNSC	Indole-3-glycerol phosphate synthase OS=Synechococcus sp. (strain CC9605) GN=trpC PE=3 SV=1	240	505	6.0E-40
sp\|B0SYZ4\|TRPC_CAUSK	Indole-3-glycerol phosphate synthase OS=Caulobacter sp. (strain K31) GN=trpC PE=3 SV=1	248	505	7.0E-40
sp\|A0QX95\|TRPC_MYCS2	Indole-3-glycerol phosphate synthase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=trpC PE=1 SV=1	249	525	7.0E-40
sp\|Q2S1Z5\|TRPC_SALRD	Indole-3-glycerol phosphate synthase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=trpC PE=3 SV=1	302	524	8.0E-40
sp\|P00906\|TRPG_SHIDY	Anthranilate synthase component II (Fragment) OS=Shigella dysenteriae GN=trpG-TRPD PE=3 SV=2	25	227	8.0E-40
sp\|Q136D2\|TRPC_RHOPS	Indole-3-glycerol phosphate synthase OS=Rhodopseudomonas palustris (strain BisB5) GN=trpC PE=3 SV=1	294	505	8.0E-40
sp\|Q55508\|TRPC_SYNY3	Indole-3-glycerol phosphate synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=trpC PE=3 SV=1	237	505	1.0E-39
sp\|Q740P4\|TRPC_MYCPA	Indole-3-glycerol phosphate synthase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=trpC PE=3 SV=1	302	525	1.0E-39
sp\|A0QHH0\|TRPC_MYCA1	Indole-3-glycerol phosphate synthase OS=Mycobacterium avium (strain 104) GN=trpC PE=3 SV=1	302	525	1.0E-39
sp\|A1BDW1\|TRPC_CHLPD	Indole-3-glycerol phosphate synthase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=trpC PE=3 SV=1	295	505	1.0E-39
sp\|B3R703\|TRPC_CUPTR	Indole-3-glycerol phosphate synthase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=trpC PE=3 SV=1	248	513	1.0E-39
sp\|A1W2Z8\|TRPC_ACISJ	Indole-3-glycerol phosphate synthase OS=Acidovorax sp. (strain JS42) GN=trpC PE=3 SV=1	304	513	1.0E-39
sp\|A7I2Y2\|TRPC_CAMHC	Indole-3-glycerol phosphate synthase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=trpC PE=3 SV=1	250	523	2.0E-39
sp\|B9MBS5\|TRPC_ACIET	Indole-3-glycerol phosphate synthase OS=Acidovorax ebreus (strain TPSY) GN=trpC PE=3 SV=1	304	513	2.0E-39
sp\|A9BBR3\|TRPC_PROM4	Indole-3-glycerol phosphate synthase OS=Prochlorococcus marinus (strain MIT 9211) GN=trpC PE=3 SV=1	240	513	2.0E-39
sp\|A7INK2\|TRPC_XANP2	Indole-3-glycerol phosphate synthase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=trpC PE=3 SV=1	303	515	2.0E-39
sp\|A1SL44\|TRPC_NOCSJ	Indole-3-glycerol phosphate synthase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=trpC PE=3 SV=1	249	505	2.0E-39
sp\|Q47AC7\|TRPC_DECAR	Indole-3-glycerol phosphate synthase OS=Dechloromonas aromatica (strain RCB) GN=trpC PE=3 SV=1	248	513	2.0E-39
sp\|B1Y7I2\|TRPC_LEPCP	Indole-3-glycerol phosphate synthase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=trpC PE=3 SV=1	303	513	2.0E-39
sp\|Q5F645\|TRPC_NEIG1	Indole-3-glycerol phosphate synthase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=trpC PE=3 SV=1	248	513	3.0E-39
sp\|A4G1P4\|TRPC_HERAR	Indole-3-glycerol phosphate synthase OS=Herminiimonas arsenicoxydans GN=trpC PE=3 SV=1	248	515	3.0E-39
sp\|Q44603\|TRPC_BUCSC	Tryptophan biosynthesis protein TrpCF OS=Buchnera aphidicola subsp. Schlechtendalia chinensis GN=trpC PE=3 SV=1	249	762	3.0E-39
sp\|Q9ZFA7\|TRPC_RHOS4	Indole-3-glycerol phosphate synthase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=trpC PE=3 SV=1	304	505	4.0E-39
sp\|P00904\|TRPGD_ECOLI	Bifunctional protein TrpGD OS=Escherichia coli (strain K12) GN=trpGD PE=1 SV=3	25	278	4.0E-39
sp\|B4RPF1\|TRPC_NEIG2	Indole-3-glycerol phosphate synthase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=trpC PE=3 SV=1	248	513	4.0E-39
sp\|Q8Z7D9\|TRPC_SALTI	Tryptophan biosynthesis protein TrpCF OS=Salmonella typhi GN=trpC PE=3 SV=1	303	741	4.0E-39
sp\|A5EK25\|TRPC_BRASB	Indole-3-glycerol phosphate synthase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=trpC PE=3 SV=1	248	505	5.0E-39
sp\|Q9KST5\|TRPC_VIBCH	Tryptophan biosynthesis protein TrpCF OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=trpCF PE=3 SV=1	301	741	5.0E-39
sp\|A3CLL9\|TRPC_STRSV	Indole-3-glycerol phosphate synthase OS=Streptococcus sanguinis (strain SK36) GN=trpC PE=3 SV=1	291	513	5.0E-39
sp\|A8AW03\|TRPC_STRGC	Indole-3-glycerol phosphate synthase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=trpC PE=3 SV=1	291	513	5.0E-39
sp\|C1CT53\|TRPC_STRZT	Indole-3-glycerol phosphate synthase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=trpC PE=3 SV=1	304	513	5.0E-39
sp\|Q5ZX99\|TRPC_LEGPH	Indole-3-glycerol phosphate synthase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=trpC PE=3 SV=1	248	515	5.0E-39
sp\|Q5X6S0\|TRPC_LEGPA	Indole-3-glycerol phosphate synthase OS=Legionella pneumophila (strain Paris) GN=trpC PE=3 SV=1	248	515	5.0E-39
sp\|A4YVD6\|TRPC_BRASO	Indole-3-glycerol phosphate synthase OS=Bradyrhizobium sp. (strain ORS278) GN=trpC PE=3 SV=1	248	505	6.0E-39
sp\|C1CMD5\|TRPC_STRZP	Indole-3-glycerol phosphate synthase OS=Streptococcus pneumoniae (strain P1031) GN=trpC PE=3 SV=1	304	513	6.0E-39
sp\|B2ISS3\|TRPC_STRPS	Indole-3-glycerol phosphate synthase OS=Streptococcus pneumoniae (strain CGSP14) GN=trpC PE=3 SV=1	304	513	6.0E-39
sp\|Q97P30\|TRPC_STRPN	Indole-3-glycerol phosphate synthase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=trpC PE=3 SV=1	304	513	6.0E-39
sp\|B8ZN61\|TRPC_STRPJ	Indole-3-glycerol phosphate synthase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=trpC PE=3 SV=1	304	513	6.0E-39
sp\|B5E7M5\|TRPC_STRP4	Indole-3-glycerol phosphate synthase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=trpC PE=3 SV=1	304	513	6.0E-39
sp\|B1WQE4\|TRPC_CYAA5	Indole-3-glycerol phosphate synthase OS=Cyanothece sp. (strain ATCC 51142) GN=trpC PE=3 SV=1	246	515	6.0E-39
sp\|Q8ESU2\|TRPC_OCEIH	Indole-3-glycerol phosphate synthase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=trpC PE=3 SV=1	287	503	6.0E-39
sp\|Q3SGS2\|TRPC_THIDA	Indole-3-glycerol phosphate synthase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=trpC PE=3 SV=1	248	513	7.0E-39
sp\|C4KZ66\|TRPC_EXISA	Indole-3-glycerol phosphate synthase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=trpC PE=3 SV=1	304	515	8.0E-39
sp\|Q02YB4\|TRPC_LACLS	Indole-3-glycerol phosphate synthase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=trpC PE=3 SV=1	250	513	1.0E-38
sp\|A2RK21\|TRPC_LACLM	Indole-3-glycerol phosphate synthase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=trpC PE=3 SV=1	250	513	1.0E-38
sp\|C1C968\|TRPC_STRP7	Indole-3-glycerol phosphate synthase OS=Streptococcus pneumoniae (strain 70585) GN=trpC PE=3 SV=1	304	513	1.0E-38
sp\|B1W0N8\|TRPC_STRGG	Indole-3-glycerol phosphate synthase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=trpC PE=3 SV=1	302	525	1.0E-38
sp\|A5IG82\|TRPC_LEGPC	Indole-3-glycerol phosphate synthase OS=Legionella pneumophila (strain Corby) GN=trpC PE=3 SV=1	248	515	1.0E-38
sp\|A0JVL1\|TRPC_ARTS2	Indole-3-glycerol phosphate synthase OS=Arthrobacter sp. (strain FB24) GN=trpC PE=3 SV=1	304	501	1.0E-38
sp\|P26922\|TRPG_AZOBR	Anthranilate synthase component 2 OS=Azospirillum brasilense GN=trpG PE=1 SV=1	27	216	2.0E-38
sp\|A1KRV4\|TRPC_NEIMF	Indole-3-glycerol phosphate synthase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=trpC PE=3 SV=1	248	505	2.0E-38
sp\|Q5WGS3\|TRPC_BACSK	Indole-3-glycerol phosphate synthase OS=Bacillus clausii (strain KSM-K16) GN=trpC PE=3 SV=1	250	515	2.0E-38
sp\|C1CG44\|TRPC_STRZJ	Indole-3-glycerol phosphate synthase OS=Streptococcus pneumoniae (strain JJA) GN=trpC PE=3 SV=1	304	513	2.0E-38
sp\|Q8DNM6\|TRPC_STRR6	Indole-3-glycerol phosphate synthase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=trpC PE=3 SV=1	304	513	2.0E-38
sp\|Q04IY7\|TRPC_STRP2	Indole-3-glycerol phosphate synthase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=trpC PE=3 SV=1	304	513	2.0E-38
sp\|Q9X7C7\|TRPC_MYCLE	Indole-3-glycerol phosphate synthase OS=Mycobacterium leprae (strain TN) GN=trpC PE=3 SV=1	302	525	2.0E-38
sp\|B8ZRB9\|TRPC_MYCLB	Indole-3-glycerol phosphate synthase OS=Mycobacterium leprae (strain Br4923) GN=trpC PE=3 SV=1	302	525	2.0E-38
sp\|A3PHK7\|TRPC_RHOS1	Indole-3-glycerol phosphate synthase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=trpC PE=3 SV=1	304	505	2.0E-38
sp\|B9KMV0\|TRPC_RHOSK	Indole-3-glycerol phosphate synthase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=trpC PE=3 SV=1	304	505	2.0E-38
sp\|Q01999\|TRPC_LACLA	Indole-3-glycerol phosphate synthase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=trpC PE=3 SV=1	246	505	2.0E-38
sp\|B1I7S9\|TRPC_STRPI	Indole-3-glycerol phosphate synthase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=trpC PE=3 SV=1	304	513	2.0E-38
sp\|A4WX67\|TRPC_RHOS5	Indole-3-glycerol phosphate synthase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=trpC PE=3 SV=1	304	505	3.0E-38
sp\|P26938\|TRPC_AZOBR	Indole-3-glycerol phosphate synthase OS=Azospirillum brasilense GN=trpC PE=3 SV=1	248	505	3.0E-38
sp\|A5GRL0\|TRPC_SYNR3	Indole-3-glycerol phosphate synthase OS=Synechococcus sp. (strain RCC307) GN=trpC PE=3 SV=1	240	516	3.0E-38
sp\|A9BS06\|TRPC_DELAS	Indole-3-glycerol phosphate synthase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=trpC PE=3 SV=1	304	513	4.0E-38
sp\|O67657\|TRPC_AQUAE	Indole-3-glycerol phosphate synthase OS=Aquifex aeolicus (strain VF5) GN=trpC PE=3 SV=1	304	505	4.0E-38
sp\|B2UDK9\|TRPC_RALPJ	Indole-3-glycerol phosphate synthase OS=Ralstonia pickettii (strain 12J) GN=trpC PE=3 SV=1	301	513	5.0E-38
sp\|C5CBK6\|TRPC_MICLC	Indole-3-glycerol phosphate synthase OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=trpC PE=3 SV=1	265	502	5.0E-38
sp\|A1R5S7\|TRPC_ARTAT	Indole-3-glycerol phosphate synthase OS=Arthrobacter aurescens (strain TC1) GN=trpC PE=3 SV=1	301	501	5.0E-38
sp\|C5CKE4\|TRPC_VARPS	Indole-3-glycerol phosphate synthase OS=Variovorax paradoxus (strain S110) GN=trpC PE=3 SV=1	249	513	6.0E-38
sp\|P9WFX7\|TRPC_MYCTU	Indole-3-glycerol phosphate synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=trpC PE=1 SV=1	302	525	8.0E-38
sp\|A5U2W7\|TRPC_MYCTA	Indole-3-glycerol phosphate synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=trpC PE=3 SV=1	302	525	8.0E-38
sp\|C1ANN3\|TRPC_MYCBT	Indole-3-glycerol phosphate synthase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=trpC PE=3 SV=1	302	525	8.0E-38
sp\|A1KJ27\|TRPC_MYCBP	Indole-3-glycerol phosphate synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=trpC PE=3 SV=1	302	525	8.0E-38
sp\|P0A633\|TRPC_MYCBO	Indole-3-glycerol phosphate synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=trpC PE=3 SV=1	302	525	8.0E-38
sp\|P57855\|TRPC_PASMU	Tryptophan biosynthesis protein TrpCF OS=Pasteurella multocida (strain Pm70) GN=trpC PE=3 SV=1	303	741	8.0E-38
sp\|P00911\|TRPC_ACIAD	Indole-3-glycerol phosphate synthase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=trpC PE=3 SV=2	285	513	9.0E-38
sp\|A4JB67\|TRPC_BURVG	Indole-3-glycerol phosphate synthase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=trpC PE=3 SV=1	248	513	9.0E-38
sp\|C1DHY7\|TRPC_AZOVD	Indole-3-glycerol phosphate synthase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=trpC PE=3 SV=1	249	513	9.0E-38
sp\|Q5WY75\|TRPC_LEGPL	Indole-3-glycerol phosphate synthase OS=Legionella pneumophila (strain Lens) GN=trpC PE=3 SV=1	248	515	1.0E-37
sp\|Q8DVF5\|TRPC_STRMU	Indole-3-glycerol phosphate synthase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=trpC PE=3 SV=1	277	514	1.0E-37
sp\|Q8ZEG8\|TRPC_YERPE	Tryptophan biosynthesis protein TrpCF OS=Yersinia pestis GN=trpC PE=3 SV=1	304	741	1.0E-37
sp\|P00900\|TRPG_SERMA	Anthranilate synthase component 2 OS=Serratia marcescens GN=trpG PE=1 SV=2	25	224	2.0E-37
sp\|B0VBS1\|TRPC_ACIBY	Indole-3-glycerol phosphate synthase OS=Acinetobacter baumannii (strain AYE) GN=trpC PE=3 SV=1	304	504	2.0E-37
sp\|A3M785\|TRPC_ACIBT	Indole-3-glycerol phosphate synthase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=trpC PE=3 SV=2	304	504	2.0E-37
sp\|B7I441\|TRPC_ACIB5	Indole-3-glycerol phosphate synthase OS=Acinetobacter baumannii (strain AB0057) GN=trpC PE=3 SV=1	304	504	2.0E-37
sp\|Q8XS01\|TRPC2_RALSO	Indole-3-glycerol phosphate synthase 2 OS=Ralstonia solanacearum (strain GMI1000) GN=trpC2 PE=3 SV=1	302	503	2.0E-37
sp\|B0VUS0\|TRPC_ACIBS	Indole-3-glycerol phosphate synthase OS=Acinetobacter baumannii (strain SDF) GN=trpC PE=3 SV=1	304	504	2.0E-37
sp\|A6SUH5\|TRPC_JANMA	Indole-3-glycerol phosphate synthase OS=Janthinobacterium sp. (strain Marseille) GN=trpC PE=3 SV=1	304	513	2.0E-37
sp\|C5BV85\|TRPC_BEUC1	Indole-3-glycerol phosphate synthase OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=trpC PE=3 SV=1	302	501	2.0E-37
sp\|P9WFX6\|TRPC_MYCTO	Indole-3-glycerol phosphate synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=trpC PE=3 SV=1	302	525	2.0E-37
sp\|B2HVE7\|TRPC_ACIBC	Indole-3-glycerol phosphate synthase OS=Acinetobacter baumannii (strain ACICU) GN=trpC PE=3 SV=1	304	504	3.0E-37
sp\|B1ZW79\|TRPC_OPITP	Indole-3-glycerol phosphate synthase OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=trpC PE=3 SV=1	281	513	3.0E-37
sp\|Q46WU7\|TRPC_CUPPJ	Indole-3-glycerol phosphate synthase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=trpC PE=3 SV=1	248	513	3.0E-37
sp\|A8FEK0\|TRPC_BACP2	Indole-3-glycerol phosphate synthase OS=Bacillus pumilus (strain SAFR-032) GN=trpC PE=3 SV=1	302	504	3.0E-37
sp\|Q8ZEG6\|TRPG_YERPE	Anthranilate synthase component 2 OS=Yersinia pestis GN=trpG PE=3 SV=1	25	224	5.0E-37
sp\|B1YSF5\|TRPC_BURA4	Indole-3-glycerol phosphate synthase OS=Burkholderia ambifaria (strain MC40-6) GN=trpC PE=3 SV=1	248	507	5.0E-37
sp\|A4IQ84\|TRPC_GEOTN	Indole-3-glycerol phosphate synthase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=trpC PE=3 SV=1	304	505	5.0E-37
sp\|B5ERI2\|TRPC_ACIF5	Indole-3-glycerol phosphate synthase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=trpC PE=3 SV=1	248	507	6.0E-37
sp\|B7JBC0\|TRPC_ACIF2	Indole-3-glycerol phosphate synthase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=trpC PE=3 SV=1	248	507	6.0E-37
sp\|P26923\|TRPG_METTM	Anthranilate synthase component 2 OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=trpG PE=3 SV=1	27	218	7.0E-37
sp\|P13997\|TRPF_KLULA	N-(5'-phosphoribosyl)anthranilate isomerase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TRP1 PE=3 SV=1	530	758	7.0E-37
sp\|Q1ISJ1\|TRPC_KORVE	Indole-3-glycerol phosphate synthase OS=Koribacter versatilis (strain Ellin345) GN=trpC PE=3 SV=1	302	513	7.0E-37
sp\|Q0BIM8\|TRPC_BURCM	Indole-3-glycerol phosphate synthase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=trpC PE=3 SV=1	248	507	9.0E-37
sp\|A4J147\|TRPC_DESRM	Indole-3-glycerol phosphate synthase OS=Desulfotomaculum reducens (strain MI-1) GN=trpC PE=3 SV=1	289	514	9.0E-37
sp\|Q8X7B7\|TRPC_ECO57	Tryptophan biosynthesis protein TrpCF OS=Escherichia coli O157:H7 GN=trpC PE=3 SV=3	303	741	1.0E-36
sp\|A4XZC5\|TRPC_PSEMY	Indole-3-glycerol phosphate synthase OS=Pseudomonas mendocina (strain ymp) GN=trpC PE=3 SV=1	296	513	1.0E-36
sp\|A1KAT2\|TRPC_AZOSB	Indole-3-glycerol phosphate synthase OS=Azoarcus sp. (strain BH72) GN=trpC PE=3 SV=1	248	507	1.0E-36
sp\|P20577\|TRPC_PSEAE	Indole-3-glycerol phosphate synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=trpC PE=3 SV=1	291	513	1.0E-36
sp\|B7V609\|TRPC_PSEA8	Indole-3-glycerol phosphate synthase OS=Pseudomonas aeruginosa (strain LESB58) GN=trpC PE=3 SV=1	291	513	1.0E-36
sp\|Q8AAD6\|TRPC_BACTN	Indole-3-glycerol phosphate synthase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=trpC PE=3 SV=1	248	507	2.0E-36
sp\|Q5KXU9\|TRPC_GEOKA	Indole-3-glycerol phosphate synthase OS=Geobacillus kaustophilus (strain HTA426) GN=trpC PE=3 SV=1	290	505	2.0E-36
sp\|Q02TB5\|TRPC_PSEAB	Indole-3-glycerol phosphate synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=trpC PE=3 SV=1	291	513	2.0E-36
sp\|A6UZF2\|TRPC_PSEA7	Indole-3-glycerol phosphate synthase OS=Pseudomonas aeruginosa (strain PA7) GN=trpC PE=3 SV=1	291	513	2.0E-36
sp\|Q06121\|TRPC_SULSO	Indole-3-glycerol phosphate synthase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=trpC PE=1 SV=1	279	505	2.0E-36
sp\|C5D3D6\|TRPC_GEOSW	Indole-3-glycerol phosphate synthase OS=Geobacillus sp. (strain WCH70) GN=trpC PE=3 SV=1	282	522	2.0E-36
sp\|Q57690\|TRPG_METJA	Anthranilate synthase component 2 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=trpG PE=3 SV=1	27	219	3.0E-36
sp\|Q48NP7\|TRPC_PSE14	Indole-3-glycerol phosphate synthase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=trpC PE=3 SV=1	303	525	3.0E-36
sp\|Q7TU64\|TRPC_PROMP	Indole-3-glycerol phosphate synthase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=trpC PE=3 SV=1	227	505	3.0E-36
sp\|Q01128\|TRPF_LIPST	N-(5'-phosphoribosyl)anthranilate isomerase OS=Lipomyces starkeyi GN=TRP1 PE=3 SV=1	531	750	3.0E-36
sp\|O27693\|TRPG_METTH	Anthranilate synthase component 2 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=trpG PE=3 SV=1	27	218	3.0E-36
sp\|Q88A03\|TRPC_PSESM	Indole-3-glycerol phosphate synthase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=trpC PE=3 SV=1	249	525	3.0E-36
sp\|Q8XVE6\|TRPC1_RALSO	Indole-3-glycerol phosphate synthase 1 OS=Ralstonia solanacearum (strain GMI1000) GN=trpC1 PE=3 SV=1	303	513	4.0E-36
sp\|Q47QR5\|TRPC_THEFY	Indole-3-glycerol phosphate synthase OS=Thermobifida fusca (strain YX) GN=trpC PE=3 SV=1	302	501	4.0E-36
sp\|P71381\|TRPG_HAEIN	Anthranilate synthase component 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=trpG PE=3 SV=1	25	213	5.0E-36
sp\|A5EVG3\|TRPC_DICNV	Indole-3-glycerol phosphate synthase OS=Dichelobacter nodosus (strain VCS1703A) GN=trpC PE=3 SV=1	248	518	5.0E-36
sp\|B7K0H0\|TRPC_CYAP8	Indole-3-glycerol phosphate synthase OS=Cyanothece sp. (strain PCC 8801) GN=trpC PE=3 SV=1	303	513	5.0E-36
sp\|Q8R9M7\|TRPC_CALS4	Indole-3-glycerol phosphate synthase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=trpC PE=3 SV=1	302	516	6.0E-36
sp\|Q65I33\|TRPC_BACLD	Indole-3-glycerol phosphate synthase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=trpC PE=3 SV=1	302	502	9.0E-36
sp\|Q3K5V4\|TRPC_PSEPF	Indole-3-glycerol phosphate synthase OS=Pseudomonas fluorescens (strain Pf0-1) GN=trpC PE=3 SV=1	303	513	1.0E-35
sp\|Q39JZ7\|TRPC_BURL3	Indole-3-glycerol phosphate synthase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=trpC PE=3 SV=1	248	507	1.0E-35
sp\|Q02584\|TRPC_RHOCB	Indole-3-glycerol phosphate synthase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=trpC PE=3 SV=2	248	505	1.0E-35
sp\|A0K458\|TRPC_BURCH	Indole-3-glycerol phosphate synthase OS=Burkholderia cenocepacia (strain HI2424) GN=trpC PE=3 SV=1	248	507	2.0E-35
sp\|B1JUU5\|TRPC_BURCC	Indole-3-glycerol phosphate synthase OS=Burkholderia cenocepacia (strain MC0-3) GN=trpC PE=3 SV=1	248	507	2.0E-35
sp\|Q1BSD2\|TRPC_BURCA	Indole-3-glycerol phosphate synthase OS=Burkholderia cenocepacia (strain AU 1054) GN=trpC PE=3 SV=1	248	507	2.0E-35
sp\|A4FLL0\|TRPC_SACEN	Indole-3-glycerol phosphate synthase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=trpC PE=3 SV=1	302	527	2.0E-35
sp\|P00909\|TRPC_ECOLI	Tryptophan biosynthesis protein TrpCF OS=Escherichia coli (strain K12) GN=trpC PE=1 SV=4	303	741	3.0E-35
sp\|B1JE34\|TRPC_PSEPW	Indole-3-glycerol phosphate synthase OS=Pseudomonas putida (strain W619) GN=trpC PE=3 SV=1	296	513	3.0E-35
sp\|A5VBA0\|TRPC_SPHWW	Indole-3-glycerol phosphate synthase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=trpC PE=3 SV=1	248	516	6.0E-35
sp\|P22101\|TRPG_VIBPA	Anthranilate synthase component 2 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=trpG PE=3 SV=1	25	214	7.0E-35
sp\|Q5M348\|TRPC_STRT2	Indole-3-glycerol phosphate synthase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=trpC PE=3 SV=1	295	513	7.0E-35
sp\|Q5LYI5\|TRPC_STRT1	Indole-3-glycerol phosphate synthase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=trpC PE=3 SV=1	295	513	7.0E-35
sp\|Q2SUI0\|TRPC_BURTA	Indole-3-glycerol phosphate synthase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=trpC PE=3 SV=1	248	513	8.0E-35
sp\|P9WN35\|TRPG_MYCTU	Anthranilate synthase component 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=trpG PE=1 SV=1	27	231	9.0E-35
sp\|P9WN34\|TRPG_MYCTO	Anthranilate synthase component 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=trpG PE=3 SV=1	27	231	9.0E-35
sp\|Q03JB9\|TRPC_STRTD	Indole-3-glycerol phosphate synthase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=trpC PE=3 SV=1	295	513	9.0E-35
sp\|P20578\|TRPC_PSEPU	Indole-3-glycerol phosphate synthase OS=Pseudomonas putida GN=trpC PE=3 SV=1	296	525	1.0E-34
sp\|A2BY04\|TRPC_PROM5	Indole-3-glycerol phosphate synthase OS=Prochlorococcus marinus (strain MIT 9515) GN=trpC PE=3 SV=1	227	505	1.0E-34
sp\|A9AJ43\|TRPC_BURM1	Indole-3-glycerol phosphate synthase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=trpC PE=3 SV=1	248	507	1.0E-34
sp\|Q319J2\|TRPC_PROM9	Indole-3-glycerol phosphate synthase OS=Prochlorococcus marinus (strain MIT 9312) GN=trpC PE=3 SV=1	227	505	2.0E-34
sp\|Q4K503\|TRPC_PSEF5	Indole-3-glycerol phosphate synthase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=trpC PE=3 SV=1	303	507	2.0E-34
sp\|Q88QR6\|TRPC_PSEPK	Indole-3-glycerol phosphate synthase OS=Pseudomonas putida (strain KT2440) GN=trpC PE=3 SV=1	296	513	2.0E-34
sp\|A5VXL5\|TRPC_PSEP1	Indole-3-glycerol phosphate synthase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=trpC PE=3 SV=1	296	513	2.0E-34
sp\|A8G6A7\|TRPC_PROM2	Indole-3-glycerol phosphate synthase OS=Prochlorococcus marinus (strain MIT 9215) GN=trpC PE=3 SV=1	227	505	2.0E-34
sp\|B0CEU2\|TRPC_ACAM1	Indole-3-glycerol phosphate synthase OS=Acaryochloris marina (strain MBIC 11017) GN=trpC PE=3 SV=1	249	502	3.0E-34
sp\|P46451\|TRPC_HAEIN	Tryptophan biosynthesis protein TrpCF OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=trpC PE=3 SV=1	240	741	3.0E-34
sp\|Q44696\|TRPG_BUCAI	Anthranilate synthase component 2 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=trpG PE=3 SV=2	25	228	3.0E-34
sp\|Q9KST3\|TRPG_VIBCH	Anthranilate synthase component 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=trpG PE=3 SV=2	25	214	3.0E-34
sp\|Q5V632\|TRPG2_HALMA	Anthranilate synthase component II OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=trpG2 PE=3 SV=1	27	215	3.0E-34
sp\|C3K307\|TRPC_PSEFS	Indole-3-glycerol phosphate synthase OS=Pseudomonas fluorescens (strain SBW25) GN=trpC PE=3 SV=1	303	513	4.0E-34
sp\|A2CB59\|TRPC_PROM3	Indole-3-glycerol phosphate synthase OS=Prochlorococcus marinus (strain MIT 9303) GN=trpC PE=3 SV=1	245	519	4.0E-34
sp\|A3NDZ3\|TRPC_BURP6	Indole-3-glycerol phosphate synthase OS=Burkholderia pseudomallei (strain 668) GN=trpC PE=3 SV=1	248	513	4.0E-34
sp\|Q4L677\|TRPC_STAHJ	Indole-3-glycerol phosphate synthase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=trpC PE=3 SV=1	301	513	4.0E-34
sp\|A2BSL8\|TRPC_PROMS	Indole-3-glycerol phosphate synthase OS=Prochlorococcus marinus (strain AS9601) GN=trpC PE=3 SV=1	227	505	5.0E-34
sp\|A0LJ58\|TRPC_SYNFM	Indole-3-glycerol phosphate synthase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=trpC PE=3 SV=1	302	513	5.0E-34
sp\|Q1IFZ9\|TRPC_PSEE4	Indole-3-glycerol phosphate synthase OS=Pseudomonas entomophila (strain L48) GN=trpC PE=3 SV=1	296	513	6.0E-34
sp\|Q7VAT3\|TRPC_PROMA	Indole-3-glycerol phosphate synthase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=trpC PE=3 SV=1	240	513	6.0E-34
sp\|Q63QH0\|TRPC_BURPS	Indole-3-glycerol phosphate synthase OS=Burkholderia pseudomallei (strain K96243) GN=trpC PE=3 SV=1	248	513	6.0E-34
sp\|A3NZP6\|TRPC_BURP0	Indole-3-glycerol phosphate synthase OS=Burkholderia pseudomallei (strain 1106a) GN=trpC PE=3 SV=1	248	513	6.0E-34
sp\|Q7TV44\|TRPC_PROMM	Indole-3-glycerol phosphate synthase OS=Prochlorococcus marinus (strain MIT 9313) GN=trpC PE=3 SV=1	245	519	6.0E-34
sp\|Q0RFX9\|TRPC_FRAAA	Indole-3-glycerol phosphate synthase OS=Frankia alni (strain ACN14a) GN=trpC PE=3 SV=1	249	499	7.0E-34
sp\|A3PED0\|TRPC_PROM0	Indole-3-glycerol phosphate synthase OS=Prochlorococcus marinus (strain MIT 9301) GN=trpC PE=3 SV=1	227	505	9.0E-34
sp\|B0KK35\|TRPC_PSEPG	Indole-3-glycerol phosphate synthase OS=Pseudomonas putida (strain GB-1) GN=trpC PE=3 SV=1	296	525	9.0E-34
sp\|Q8F7V2\|TRPC_LEPIN	Indole-3-glycerol phosphate synthase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=trpC PE=3 SV=1	303	505	1.0E-33
sp\|Q72NP6\|TRPC_LEPIC	Indole-3-glycerol phosphate synthase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=trpC PE=3 SV=1	303	505	1.0E-33
sp\|P32483\|PABS_STRGR	Para-aminobenzoate synthase OS=Streptomyces griseus GN=pab PE=3 SV=1	28	215	1.0E-33
sp\|A0LA39\|TRPC_MAGMM	Indole-3-glycerol phosphate synthase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=trpC PE=3 SV=1	249	513	2.0E-33
sp\|Q13TW4\|TRPC_BURXL	Indole-3-glycerol phosphate synthase OS=Burkholderia xenovorans (strain LB400) GN=trpC PE=3 SV=1	248	513	2.0E-33
sp\|Q3JNB0\|TRPC_BURP1	Indole-3-glycerol phosphate synthase OS=Burkholderia pseudomallei (strain 1710b) GN=trpC PE=3 SV=1	303	513	2.0E-33
sp\|A1WH73\|TRPC_VEREI	Indole-3-glycerol phosphate synthase OS=Verminephrobacter eiseniae (strain EF01-2) GN=trpC PE=3 SV=1	303	513	2.0E-33
sp\|A1UWA0\|TRPC_BURMS	Indole-3-glycerol phosphate synthase OS=Burkholderia mallei (strain SAVP1) GN=trpC PE=3 SV=1	248	513	2.0E-33
sp\|Q62DD0\|TRPC_BURMA	Indole-3-glycerol phosphate synthase OS=Burkholderia mallei (strain ATCC 23344) GN=trpC PE=3 SV=1	248	513	2.0E-33
sp\|A2RYI3\|TRPC_BURM9	Indole-3-glycerol phosphate synthase OS=Burkholderia mallei (strain NCTC 10229) GN=trpC PE=3 SV=1	248	513	2.0E-33
sp\|A3MFQ4\|TRPC_BURM7	Indole-3-glycerol phosphate synthase OS=Burkholderia mallei (strain NCTC 10247) GN=trpC PE=3 SV=1	248	513	2.0E-33
sp\|Q89A30\|TRPG_BUCBP	Anthranilate synthase component 2 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=trpG PE=3 SV=1	26	217	4.0E-33
sp\|A6TM74\|TRPC_ALKMQ	Indole-3-glycerol phosphate synthase OS=Alkaliphilus metalliredigens (strain QYMF) GN=trpC PE=3 SV=1	302	516	4.0E-33
sp\|P42388\|TRPG_BUCAP	Anthranilate synthase component 2 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=trpG PE=3 SV=1	25	217	4.0E-33
sp\|Q9YGB2\|TRPG_THEKO	Anthranilate synthase component 2 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=trpG PE=3 SV=1	27	218	7.0E-33
sp\|Q7NHI0\|TRPC_GLOVI	Indole-3-glycerol phosphate synthase OS=Gloeobacter violaceus (strain PCC 7421) GN=trpC PE=3 SV=1	249	517	7.0E-33
sp\|Q5N575\|TRPC_SYNP6	Indole-3-glycerol phosphate synthase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=trpC PE=3 SV=1	295	513	1.0E-32
sp\|Q8KPR4\|TRPC_SYNE7	Indole-3-glycerol phosphate synthase OS=Synechococcus elongatus (strain PCC 7942) GN=trpC PE=3 SV=2	295	513	1.0E-32
sp\|Q9Z4X0\|TRPC2_STRCO	Indole-3-glycerol phosphate synthase 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trpC2 PE=3 SV=1	284	513	3.0E-32
sp\|Q2RT48\|TRPC_RHORT	Indole-3-glycerol phosphate synthase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=trpC PE=3 SV=1	248	513	4.0E-32
sp\|Q06129\|TRPG_SULSO	Anthranilate synthase component 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=trpG PE=1 SV=2	28	217	4.0E-32
sp\|O68427\|TRPC_BUCDN	Tryptophan biosynthesis protein TrpCF OS=Buchnera aphidicola subsp. Diuraphis noxia GN=trpC PE=3 SV=1	303	741	4.0E-32
sp\|Q02003\|TRPG_LACLA	Anthranilate synthase component 2 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=trpG PE=3 SV=1	27	217	5.0E-32
sp\|B2SZ04\|TRPC_BURPP	Indole-3-glycerol phosphate synthase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=trpC PE=3 SV=1	248	513	7.0E-32
sp\|A7Z618\|TRPC_BACMF	Indole-3-glycerol phosphate synthase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=trpC PE=3 SV=1	302	502	1.0E-31
sp\|A4VHK1\|TRPC_PSEU5	Indole-3-glycerol phosphate synthase OS=Pseudomonas stutzeri (strain A1501) GN=trpC PE=3 SV=1	303	513	1.0E-31
sp\|P26939\|TRPC_METTM	Indole-3-glycerol phosphate synthase OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=trpC PE=3 SV=1	302	520	2.0E-31
sp\|O25867\|TRPC_HELPY	Tryptophan biosynthesis protein TrpCF OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=trpC PE=3 SV=1	303	741	2.0E-31
sp\|A5GMK4\|TRPC_SYNPW	Indole-3-glycerol phosphate synthase OS=Synechococcus sp. (strain WH7803) GN=trpC PE=3 SV=1	248	502	3.0E-31
sp\|P70937\|TRPC_BACMQ	Indole-3-glycerol phosphate synthase OS=Bacillus megaterium (strain ATCC 12872 / QMB1551) GN=trpC PE=3 SV=1	301	520	4.0E-31
sp\|A9BHQ5\|TRPC_PETMO	Indole-3-glycerol phosphate synthase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=trpC PE=3 SV=1	302	513	4.0E-31
sp\|P42393\|TRPC_BUCAP	Tryptophan biosynthesis protein TrpCF OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=trpC PE=3 SV=1	297	742	6.0E-31
sp\|P57366\|TRPC_BUCAI	Tryptophan biosynthesis protein TrpCF OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=trpC PE=3 SV=1	303	759	7.0E-31
sp\|B8HP79\|TRPC_CYAP4	Indole-3-glycerol phosphate synthase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=trpC PE=3 SV=1	245	502	1.0E-30
sp\|Q49XH6\|TRPC_STAS1	Indole-3-glycerol phosphate synthase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=trpC PE=3 SV=1	302	510	1.0E-30
sp\|P03964\|TRPC_BACSU	Indole-3-glycerol phosphate synthase OS=Bacillus subtilis (strain 168) GN=trpC PE=3 SV=3	302	502	2.0E-30
sp\|Q972A1\|TRPC_SULTO	Indole-3-glycerol phosphate synthase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=trpC PE=3 SV=1	287	505	2.0E-30
sp\|Q5XQP9\|TRPF_SACK1	N-(5'-phosphoribosyl)anthranilate isomerase OS=Saccharomyces kudriavzevii (strain ATCC MYA-4449 / AS 2.2408 / CBS 8840 / NBRC 1802 / NCYC 2889) GN=TRP1 PE=3 SV=1	532	759	3.0E-30
sp\|Q8CPB2\|TRPC_STAES	Indole-3-glycerol phosphate synthase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=trpC PE=3 SV=1	302	513	3.0E-30
sp\|P49572\|TRPC_ARATH	Indole-3-glycerol phosphate synthase, chloroplastic OS=Arabidopsis thaliana GN=At2g04400 PE=2 SV=2	249	509	3.0E-30
sp\|Q5HPH2\|TRPC_STAEQ	Indole-3-glycerol phosphate synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=trpC PE=3 SV=1	302	513	5.0E-30
sp\|P18304\|TRPC_HALVD	Indole-3-glycerol phosphate synthase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=trpC PE=3 SV=1	302	501	8.0E-30
sp\|O19914\|TRPG_CYACA	Anthranilate synthase component 2 OS=Cyanidium caldarium GN=trpG PE=3 SV=1	27	221	8.0E-30
sp\|Q9ZJU8\|TRPC_HELPJ	Tryptophan biosynthesis protein TrpCF OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=trpC PE=3 SV=1	277	741	1.0E-29
sp\|Q56319\|TRPC_THEMA	Indole-3-glycerol phosphate synthase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=trpC PE=1 SV=3	302	513	2.0E-29
sp\|O28670\|TRPG_ARCFU	Anthranilate synthase component 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=trpG PE=3 SV=1	27	218	3.0E-29
sp\|Q4J8X3\|TRPC_SULAC	Indole-3-glycerol phosphate synthase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=trpC PE=3 SV=1	304	502	3.0E-29
sp\|O13504\|TRPF_PICPA	N-(5'-phosphoribosyl)anthranilate isomerase OS=Komagataella pastoris GN=TRP1 PE=3 SV=1	531	758	5.0E-29
sp\|A6QGS2\|TRPC_STAAE	Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain Newman) GN=trpC PE=3 SV=1	302	513	5.0E-29
sp\|Q9RL78\|TRPC_STAAC	Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain COL) GN=trpC PE=3 SV=1	302	513	5.0E-29
sp\|P27627\|PABA_STRLI	Aminodeoxychorismate synthase component 2 OS=Streptomyces lividans PE=3 SV=1	25	217	6.0E-29
sp\|Q8NWU3\|TRPC_STAAW	Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain MW2) GN=trpC PE=3 SV=1	302	513	1.0E-28
sp\|A8Z242\|TRPC_STAAT	Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=trpC PE=3 SV=1	302	513	1.0E-28
sp\|Q6G9I9\|TRPC_STAAS	Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain MSSA476) GN=trpC PE=3 SV=1	302	513	1.0E-28
sp\|Q2FYR6\|TRPC_STAA8	Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain NCTC 8325) GN=trpC PE=3 SV=1	302	513	1.0E-28
sp\|Q2FH66\|TRPC_STAA3	Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain USA300) GN=trpC PE=3 SV=1	302	513	1.0E-28
sp\|P50857\|TRPF_CANGA	N-(5'-phosphoribosyl)anthranilate isomerase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TRP1 PE=3 SV=2	527	759	2.0E-28
sp\|P09786\|PHNB_PSEAE	Anthranilate synthase component 2, pyocyanine specific OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=phnB PE=1 SV=3	27	230	2.0E-28
sp\|P00912\|TRPF_YEAST	N-(5'-phosphoribosyl)anthranilate isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRP1 PE=1 SV=2	531	759	2.0E-28
sp\|Q6GH35\|TRPC_STAAR	Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain MRSA252) GN=trpC PE=3 SV=1	302	513	4.0E-28
sp\|P66991\|TRPC_STAAN	Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain N315) GN=trpC PE=3 SV=1	302	513	5.0E-28
sp\|P66990\|TRPC_STAAM	Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=trpC PE=3 SV=1	302	513	5.0E-28
sp\|A5ISQ2\|TRPC_STAA9	Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain JH9) GN=trpC PE=3 SV=1	302	513	5.0E-28
sp\|A6U1J2\|TRPC_STAA2	Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain JH1) GN=trpC PE=3 SV=1	302	513	5.0E-28
sp\|A7X234\|TRPC_STAA1	Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=trpC PE=3 SV=1	302	513	5.0E-28
sp\|Q0C1A2\|TRPC_HYPNA	Indole-3-glycerol phosphate synthase OS=Hyphomonas neptunium (strain ATCC 15444) GN=trpC PE=3 SV=1	303	502	5.0E-28
sp\|Q2YXU9\|TRPC_STAAB	Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=trpC PE=3 SV=1	302	513	8.0E-28
sp\|Q0IC57\|TRPC_SYNS3	Indole-3-glycerol phosphate synthase OS=Synechococcus sp. (strain CC9311) GN=trpC PE=3 SV=1	248	516	1.0E-27
sp\|P59459\|TRPC_BUCBP	Tryptophan biosynthesis protein TrpCF OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=trpC PE=3 SV=1	287	759	3.0E-27
sp\|A4YHD8\|TRPC_METS5	Indole-3-glycerol phosphate synthase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=trpC PE=3 SV=1	288	516	4.0E-27
sp\|Q9ZJU6\|TRPG_HELPJ	Anthranilate synthase component 2 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=trpG PE=3 SV=1	27	213	5.0E-27
sp\|Q875I3\|TRPF_WICAO	N-(5'-phosphoribosyl)anthranilate isomerase OS=Wickerhamomyces anomalus GN=TRP1 PE=3 SV=1	530	758	7.0E-27
sp\|Q8TVJ8\|TRPC_METKA	Indole-3-glycerol phosphate synthase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=trpC PE=3 SV=1	302	518	2.0E-26
sp\|O25868\|TRPG_HELPY	Anthranilate synthase component 2 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=trpG PE=3 SV=1	27	212	4.0E-26
sp\|P50872\|TRPE_AZOBR	Anthranilate synthase OS=Azospirillum brasilense GN=trpE(G) PE=3 SV=1	18	208	7.0E-26
sp\|O27694\|TRPC_METTH	Indole-3-glycerol phosphate synthase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=trpC PE=3 SV=1	302	520	9.0E-26
sp\|A2C462\|TRPC_PROM1	Indole-3-glycerol phosphate synthase OS=Prochlorococcus marinus (strain NATL1A) GN=trpC PE=3 SV=1	245	523	1.0E-25
sp\|Q46JH4\|TRPC_PROMT	Indole-3-glycerol phosphate synthase OS=Prochlorococcus marinus (strain NATL2A) GN=trpC PE=3 SV=1	245	505	1.0E-25
sp\|Q9HFW8\|TRPF_ZYGBA	N-(5'-phosphoribosyl)anthranilate isomerase OS=Zygosaccharomyces bailii GN=TRP1 PE=3 SV=1	530	759	1.0E-25
sp\|Q9HSC1\|TRPC_HALSA	Indole-3-glycerol phosphate synthase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=trpC PE=3 SV=1	304	504	2.0E-25
sp\|P06560\|TRPC_CORGL	Tryptophan biosynthesis protein TrpCF OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=trpC PE=3 SV=2	291	741	6.0E-25
sp\|Q6TAS3\|ADCS_SOLLC	Aminodeoxychorismate synthase, chloroplastic OS=Solanum lycopersicum GN=ADCS PE=2 SV=1	16	262	8.0E-25
sp\|P06558\|TRPG_CORGL	Anthranilate synthase component 2 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=trpG PE=3 SV=2	25	208	2.0E-24
sp\|Q58328\|TRPC_METJA	Indole-3-glycerol phosphate synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=trpC PE=3 SV=1	250	505	2.0E-24
sp\|Q5V138\|TRPC_HALMA	Indole-3-glycerol phosphate synthase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=trpC PE=3 SV=1	304	501	3.0E-24
sp\|P14952\|TRPG_CLOTM	Anthranilate synthase component 2 (Fragment) OS=Clostridium thermocellum GN=trpG PE=3 SV=1	26	111	5.0E-24
sp\|Q02002\|TRPF_LACLA	N-(5'-phosphoribosyl)anthranilate isomerase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=trpF PE=3 SV=1	532	758	7.0E-24
sp\|Q9YGB5\|TRPC_THEKO	Indole-3-glycerol phosphate synthase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=trpC PE=3 SV=2	291	513	1.0E-23
sp\|P15395\|TRPE_RHIME	Anthranilate synthase OS=Rhizobium meliloti (strain 1021) GN=trpE(G) PE=3 SV=1	26	216	3.0E-23
sp\|Q8ESU3\|TRPF_OCEIH	N-(5'-phosphoribosyl)anthranilate isomerase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=trpF PE=3 SV=1	530	755	5.0E-23
sp\|P43073\|TRPF_CANAL	N-(5'-phosphoribosyl)anthranilate isomerase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TRP1 PE=3 SV=2	532	760	5.0E-23
sp\|Q9Y8T7\|TRPC_AERPE	Indole-3-glycerol phosphate synthase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=trpC PE=3 SV=1	303	504	2.0E-22
sp\|Q8LPN3\|ADCS_ARATH	Aminodeoxychorismate synthase, chloroplastic OS=Arabidopsis thaliana GN=ADCS PE=1 SV=1	28	224	4.0E-21
sp\|B1YBK5\|TRPC_PYRNV	Indole-3-glycerol phosphate synthase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=trpC PE=3 SV=1	301	504	5.0E-21
sp\|Q9V1G3\|TRPC_PYRAB	Indole-3-glycerol phosphate synthase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=trpC PE=3 SV=1	292	505	1.0E-20
sp\|Q9RUG0\|TRPC_DEIRA	Indole-3-glycerol phosphate synthase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=trpC PE=3 SV=1	295	500	2.0E-20
sp\|Q8ZYX2\|TRPC_PYRAE	Indole-3-glycerol phosphate synthase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=trpC PE=3 SV=1	287	513	8.0E-20
sp\|A4WN19\|TRPC_PYRAR	Indole-3-glycerol phosphate synthase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=trpC PE=3 SV=1	301	504	1.0E-19
sp\|Q757J9\|TRPF_ASHGO	N-(5'-phosphoribosyl)anthranilate isomerase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TRP1 PE=3 SV=1	533	761	2.0E-19
sp\|Q3ZZ13\|TRPF_DEHMC	N-(5'-phosphoribosyl)anthranilate isomerase OS=Dehalococcoides mccartyi (strain CBDB1) GN=trpF PE=3 SV=1	533	759	4.0E-19
sp\|Q3Z6G4\|TRPF_DEHM1	N-(5'-phosphoribosyl)anthranilate isomerase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=trpF PE=3 SV=1	533	759	4.0E-19
sp\|P44339\|Y1171_HAEIN	Putative anthranilate synthase component II OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1171 PE=3 SV=1	27	216	5.0E-19
sp\|Q5Z856\|ADCS_ORYSJ	Probable aminodeoxychorismate synthase, chloroplastic OS=Oryza sativa subsp. japonica GN=ADCS PE=2 SV=1	28	215	5.0E-19
sp\|Q8U088\|TRPC_PYRFU	Indole-3-glycerol phosphate synthase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=trpC PE=3 SV=1	292	505	1.0E-18
sp\|P17218\|TRPF_LACCA	N-(5'-phosphoribosyl)anthranilate isomerase OS=Lactobacillus casei GN=trpF PE=3 SV=1	530	759	1.0E-17
sp\|Q56320\|TRPF_THEMA	N-(5'-phosphoribosyl)anthranilate isomerase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=trpF PE=1 SV=1	532	761	4.0E-17
sp\|Q03CY2\|TRPF_LACC3	N-(5'-phosphoribosyl)anthranilate isomerase OS=Lactobacillus casei (strain ATCC 334) GN=trpF PE=3 SV=1	530	759	6.0E-17
sp\|B1LA13\|TRPF_THESQ	N-(5'-phosphoribosyl)anthranilate isomerase OS=Thermotoga sp. (strain RQ2) GN=trpF PE=3 SV=1	532	761	7.0E-17
sp\|A5IKT2\|TRPF_THEP1	N-(5'-phosphoribosyl)anthranilate isomerase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=trpF PE=3 SV=1	532	761	7.0E-17
sp\|O94277\|PABS_SCHPO	Putative aminodeoxychorismate synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP8B7.29 PE=3 SV=1	27	218	7.0E-17
sp\|B3W6W7\|TRPF_LACCB	N-(5'-phosphoribosyl)anthranilate isomerase OS=Lactobacillus casei (strain BL23) GN=trpF PE=3 SV=1	530	759	9.0E-17
sp\|Q8TXV8\|GUAAA_METKA	GMP synthase [glutamine-hydrolyzing] subunit A OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=guaAA PE=3 SV=1	27	220	8.0E-16
sp\|Q67PJ5\|TRPF_SYMTH	N-(5'-phosphoribosyl)anthranilate isomerase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=trpF PE=3 SV=1	530	761	3.0E-15
sp\|Q2RIT8\|TRPF_MOOTA	N-(5'-phosphoribosyl)anthranilate isomerase OS=Moorella thermoacetica (strain ATCC 39073) GN=trpF PE=3 SV=1	532	759	6.0E-15
sp\|Q39SQ9\|TRPF_GEOMG	N-(5'-phosphoribosyl)anthranilate isomerase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=trpF PE=3 SV=1	532	760	7.0E-15
sp\|A5UK20\|GUAAA_METS3	GMP synthase [glutamine-hydrolyzing] subunit A OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=guaAA PE=3 SV=1	57	215	2.0E-14
sp\|Q8DVF4\|TRPF_STRMU	N-(5'-phosphoribosyl)anthranilate isomerase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=trpF PE=3 SV=1	532	759	2.0E-14
sp\|B8DHB3\|TRPF_LISMH	N-(5'-phosphoribosyl)anthranilate isomerase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=trpF PE=3 SV=1	530	761	3.0E-14
sp\|Q8Y6Q5\|TRPF_LISMO	N-(5'-phosphoribosyl)anthranilate isomerase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=trpF PE=3 SV=1	530	761	4.0E-14
sp\|A8AW04\|TRPF_STRGC	N-(5'-phosphoribosyl)anthranilate isomerase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=trpF PE=3 SV=1	532	759	7.0E-14
sp\|Q2NER5\|GUAAA_METST	GMP synthase [glutamine-hydrolyzing] subunit A OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=guaAA PE=3 SV=1	26	215	7.0E-14
sp\|O28668\|TRPCD_ARCFU	Tryptophan biosynthesis protein TrpCD OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=trpCD PE=3 SV=1	303	518	8.0E-14
sp\|Q92B80\|TRPF_LISIN	N-(5'-phosphoribosyl)anthranilate isomerase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=trpF PE=3 SV=1	530	761	1.0E-13
sp\|O59071\|GUAAA_PYRHO	GMP synthase [glutamine-hydrolyzing] subunit A OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=guaAA PE=1 SV=1	27	220	1.0E-13
sp\|Q71Z39\|TRPF_LISMF	N-(5'-phosphoribosyl)anthranilate isomerase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=trpF PE=3 SV=1	530	761	2.0E-13
sp\|B1I3Z6\|TRPF_DESAP	N-(5'-phosphoribosyl)anthranilate isomerase OS=Desulforudis audaxviator (strain MP104C) GN=trpF PE=3 SV=1	531	759	2.0E-13
sp\|C1KVS6\|TRPF_LISMC	N-(5'-phosphoribosyl)anthranilate isomerase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=trpF PE=3 SV=1	530	761	2.0E-13
sp\|Q6L277\|TRPC_PICTO	Indole-3-glycerol phosphate synthase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=trpC PE=3 SV=1	302	501	2.0E-13
sp\|A0AJ81\|TRPF_LISW6	N-(5'-phosphoribosyl)anthranilate isomerase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=trpF PE=3 SV=1	530	761	3.0E-13
sp\|Q8R9M8\|TRPF_CALS4	N-(5'-phosphoribosyl)anthranilate isomerase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=trpF PE=3 SV=1	532	761	3.0E-13
sp\|Q9HK02\|TRPC_THEAC	Indole-3-glycerol phosphate synthase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=trpC PE=3 SV=1	303	502	5.0E-13

[Show less]

GO

GO Term	Description	Terminal node
GO:0004425	indole-3-glycerol-phosphate synthase activity	Yes
GO:0006568	tryptophan metabolic process	Yes
GO:0016787	hydrolase activity	Yes
GO:0004640	phosphoribosylanthranilate isomerase activity	Yes
GO:0019752	carboxylic acid metabolic process	No
GO:0016861	intramolecular oxidoreductase activity, interconverting aldoses and ketoses	No
GO:0016829	lyase activity	No
GO:0006725	cellular aromatic compound metabolic process	No
GO:0009072	aromatic amino acid family metabolic process	No
GO:0016831	carboxy-lyase activity	No
GO:0043436	oxoacid metabolic process	No
GO:0006082	organic acid metabolic process	No
GO:0016830	carbon-carbon lyase activity	No
GO:0006586	indolalkylamine metabolic process	No
GO:0008152	metabolic process	No
GO:0009987	cellular process	No
GO:0003824	catalytic activity	No
GO:0044238	primary metabolic process	No
GO:0044237	cellular metabolic process	No
GO:1901564	organonitrogen compound metabolic process	No
GO:0044106	cellular amine metabolic process	No
GO:0006576	cellular biogenic amine metabolic process	No
GO:1901605	alpha-amino acid metabolic process	No
GO:0071704	organic substance metabolic process	No
GO:0044281	small molecule metabolic process	No
GO:1901360	organic cyclic compound metabolic process	No
GO:0008150	biological_process	No
GO:0046483	heterocycle metabolic process	No
GO:0016853	isomerase activity	No
GO:0016860	intramolecular oxidoreductase activity	No
GO:0034641	cellular nitrogen compound metabolic process	No
GO:0006520	cellular amino acid metabolic process	No
GO:0003674	molecular_function	No
GO:0042430	indole-containing compound metabolic process	No
GO:0009308	amine metabolic process	No
GO:0006807	nitrogen compound metabolic process	No

SignalP

[Help with interpreting these statistics]

SignalP signal predicted	Location (based on Ymax)	D score (significance: > 0.45)
No	1 - 23	0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequence	Sequence
Locus	Download genbank file of locus The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein	>Ophun1\|792 MPSSLDIIDHSPHQPEPSPPIPTASNLILIDNYDSFTWNIYQYLVLEGATVHVFRNDQISLQELISKNPTQLIIS PGPGHPTTDSGISRDAIRHFAGKIPVFGVCMGLQCIFDVYGGDVNSAGEWLHGKTSPLTHDSRGVFAGLEQNLPV TRYHSLAGTHVTLPDCLEITSWVAKADGSPGIIQGVRHKQLTVEGVQFHPESILTSQGRRMIRNFLHMQGGTWAE NEKLQKAAPLNGPPIAQDKAKGNNILQRIYASRRAAVAAQKEIPSQRMADLLAAYRLNAAPPLVPLVRRLRQSPF DVALMAEIKRASPSKGVFALDMDAPTQARKYALAGASVISVLTEPEWFKGSIEDLRSVRQVLDGMPNRPAILRKE FIFDEYQILEARLAGADTVLLIVKMLEPEALKRLYEYSLSLGMEPLVEVQNGQEMTTAVELGSRVIGVNNRNLES FEVDLDTTGRLRGMVPEGTLLCALSGINSHKDVLMNKRDGVNAVLVGEAIMRAPDAGVFISELCSGTKQAAGTQP PKAPLFVKICGTRSVEAAHEAIKSKADFIGICLVPGAKRCISHETALGISDAVHSCSGTTSEARGQMSSSSATDY FTAAGWRLESHRPRLVGIFQNQPLSEVLQMQRTYQLDVVQLHGDEPIEWSRQIPVPVIRCFKPGQVGIGLRGYHT IPLLDSGSGSGKLLDVSSVRAALETDPDLRVFLAGGLNPENVAAAVTALGQLGERVLGVDVSSGVEEDGKQSLAK IKAFVEAAKAIR*
Coding	>Ophun1\|792 ATGCCGTCTTCTCTCGATATCATCGATCACTCTCCCCATCAGCCGGAGCCGTCACCTCCAATCCCTACGGCGTCC AACCTGATCCTGATCGACAACTACGACTCCTTCACCTGGAACATCTATCAGTACCTCGTCCTCGAGGGAGCTACC GTTCATGTCTTCCGTAACGATCAGATCAGCTTGCAGGAGCTCATCAGCAAGAACCCAACGCAGCTCATCATCAGC CCCGGCCCAGGCCATCCCACGACCGACTCGGGCATCAGCCGAGATGCCATCCGCCACTTTGCGGGAAAGATCCCC GTTTTTGGCGTCTGCATGGGCCTGCAATGCATCTTTGATGTTTACGGCGGGGACGTCAACTCTGCCGGAGAGTGG CTGCACGGCAAAACGTCGCCCCTGACGCACGATAGCAGGGGTGTCTTTGCCGGTCTGGAGCAGAATCTACCGGTG ACGAGATATCACTCCCTCGCGGGCACTCACGTCACATTGCCGGACTGCCTGGAGATTACTTCGTGGGTTGCCAAG GCTGACGGCTCGCCAGGCATCATCCAGGGTGTCCGTCACAAGCAGCTCACTGTCGAGGGGGTTCAGTTTCACCCA GAGAGTATCCTCACGTCTCAGGGACGAAGAATGATACGCAACTTTCTGCACATGCAAGGGGGCACCTGGGCGGAA AACGAGAAGCTGCAGAAAGCCGCGCCGCTCAACGGTCCCCCCATTGCGCAGGACAAGGCAAAGGGCAACAACATA CTGCAGCGGATATACGCCAGCCGCAGGGCTGCCGTTGCCGCCCAAAAGGAGATTCCCTCACAACGGATGGCCGAT TTACTGGCAGCCTATCGCCTCAACGCGGCGCCTCCTCTTGTTCCGCTGGTGAGGCGTCTACGGCAGTCGCCTTTT GACGTGGCTCTCATGGCCGAGATCAAGCGTGCGTCCCCTTCAAAGGGCGTGTTTGCGCTCGACATGGACGCTCCG ACTCAGGCGCGCAAGTACGCCTTGGCCGGAGCCAGCGTCATCTCAGTCCTCACAGAGCCGGAATGGTTCAAGGGG AGCATTGAGGATCTGCGCTCCGTCCGCCAGGTGCTGGACGGGATGCCCAATAGGCCAGCTATTCTACGCAAGGAG TTCATCTTTGACGAGTACCAGATCCTGGAGGCCAGACTTGCAGGCGCCGACACCGTCTTGCTCATCGTCAAGATG CTGGAGCCGGAAGCTCTCAAGCGCCTCTACGAATACTCGCTGTCGCTGGGGATGGAGCCGCTCGTCGAGGTTCAA AACGGCCAAGAGATGACGACGGCCGTCGAGTTGGGATCCAGGGTCATCGGCGTCAACAACCGCAACCTGGAGAGC TTCGAAGTCGATCTCGATACCACAGGCCGGCTGAGGGGCATGGTGCCGGAGGGCACACTGCTCTGCGCTCTCAGC GGCATCAACAGCCACAAAGACGTGCTGATGAACAAGAGAGATGGAGTCAACGCAGTCCTCGTCGGCGAGGCCATC ATGCGAGCGCCGGACGCCGGCGTCTTCATCAGCGAGCTCTGCTCAGGCACGAAACAGGCAGCCGGGACGCAGCCT CCCAAAGCACCGCTCTTCGTCAAGATCTGCGGAACGCGGTCGGTGGAGGCCGCGCACGAGGCCATCAAGTCCAAG GCCGACTTTATTGGCATCTGCCTGGTGCCCGGAGCGAAGCGCTGTATCAGCCACGAGACGGCACTCGGGATTTCT GACGCTGTTCATTCGTGCTCAGGAACTACTTCTGAGGCGCGAGGACAGATGTCCAGCTCCAGCGCGACAGATTAC TTTACGGCCGCCGGCTGGAGACTCGAAAGTCACCGGCCTCGTCTGGTAGGCATCTTCCAGAACCAGCCGCTGAGC GAGGTACTGCAGATGCAAAGAACCTACCAGCTCGACGTCGTTCAACTCCACGGAGACGAGCCCATCGAGTGGTCG AGGCAAATTCCCGTGCCGGTGATCCGCTGCTTCAAGCCAGGCCAAGTCGGCATCGGCCTCCGCGGCTACCACACC ATCCCGCTCCTCGACTCCGGCTCCGGCTCAGGCAAGCTCCTAGACGTGTCGAGCGTCCGGGCCGCGCTGGAGACG GACCCGGATTTGAGGGTGTTCCTGGCGGGCGGGTTGAATCCCGAGAACGTGGCCGCGGCGGTGACGGCGCTTGGC CAGCTTGGAGAGCGAGTGCTGGGCGTCGACGTCAGCAGCGGAGTCGAGGAGGATGGGAAGCAGAGCTTGGCCAAG ATAAAGGCCTTTGTCGAGGCGGCCAAGGCGATTCGATAG
Transcript	>Ophun1\|792 ATGCCGTCTTCTCTCGATATCATCGATCACTCTCCCCATCAGCCGGAGCCGTCACCTCCAATCCCTACGGCGTCC AACCTGATCCTGATCGACAACTACGACTCCTTCACCTGGAACATCTATCAGTACCTCGTCCTCGAGGGAGCTACC GTTCATGTCTTCCGTAACGATCAGATCAGCTTGCAGGAGCTCATCAGCAAGAACCCAACGCAGCTCATCATCAGC CCCGGCCCAGGCCATCCCACGACCGACTCGGGCATCAGCCGAGATGCCATCCGCCACTTTGCGGGAAAGATCCCC GTTTTTGGCGTCTGCATGGGCCTGCAATGCATCTTTGATGTTTACGGCGGGGACGTCAACTCTGCCGGAGAGTGG CTGCACGGCAAAACGTCGCCCCTGACGCACGATAGCAGGGGTGTCTTTGCCGGTCTGGAGCAGAATCTACCGGTG ACGAGATATCACTCCCTCGCGGGCACTCACGTCACATTGCCGGACTGCCTGGAGATTACTTCGTGGGTTGCCAAG GCTGACGGCTCGCCAGGCATCATCCAGGGTGTCCGTCACAAGCAGCTCACTGTCGAGGGGGTTCAGTTTCACCCA GAGAGTATCCTCACGTCTCAGGGACGAAGAATGATACGCAACTTTCTGCACATGCAAGGGGGCACCTGGGCGGAA AACGAGAAGCTGCAGAAAGCCGCGCCGCTCAACGGTCCCCCCATTGCGCAGGACAAGGCAAAGGGCAACAACATA CTGCAGCGGATATACGCCAGCCGCAGGGCTGCCGTTGCCGCCCAAAAGGAGATTCCCTCACAACGGATGGCCGAT TTACTGGCAGCCTATCGCCTCAACGCGGCGCCTCCTCTTGTTCCGCTGGTGAGGCGTCTACGGCAGTCGCCTTTT GACGTGGCTCTCATGGCCGAGATCAAGCGTGCGTCCCCTTCAAAGGGCGTGTTTGCGCTCGACATGGACGCTCCG ACTCAGGCGCGCAAGTACGCCTTGGCCGGAGCCAGCGTCATCTCAGTCCTCACAGAGCCGGAATGGTTCAAGGGG AGCATTGAGGATCTGCGCTCCGTCCGCCAGGTGCTGGACGGGATGCCCAATAGGCCAGCTATTCTACGCAAGGAG TTCATCTTTGACGAGTACCAGATCCTGGAGGCCAGACTTGCAGGCGCCGACACCGTCTTGCTCATCGTCAAGATG CTGGAGCCGGAAGCTCTCAAGCGCCTCTACGAATACTCGCTGTCGCTGGGGATGGAGCCGCTCGTCGAGGTTCAA AACGGCCAAGAGATGACGACGGCCGTCGAGTTGGGATCCAGGGTCATCGGCGTCAACAACCGCAACCTGGAGAGC TTCGAAGTCGATCTCGATACCACAGGCCGGCTGAGGGGCATGGTGCCGGAGGGCACACTGCTCTGCGCTCTCAGC GGCATCAACAGCCACAAAGACGTGCTGATGAACAAGAGAGATGGAGTCAACGCAGTCCTCGTCGGCGAGGCCATC ATGCGAGCGCCGGACGCCGGCGTCTTCATCAGCGAGCTCTGCTCAGGCACGAAACAGGCAGCCGGGACGCAGCCT CCCAAAGCACCGCTCTTCGTCAAGATCTGCGGAACGCGGTCGGTGGAGGCCGCGCACGAGGCCATCAAGTCCAAG GCCGACTTTATTGGCATCTGCCTGGTGCCCGGAGCGAAGCGCTGTATCAGCCACGAGACGGCACTCGGGATTTCT GACGCTGTTCATTCGTGCTCAGGAACTACTTCTGAGGCGCGAGGACAGATGTCCAGCTCCAGCGCGACAGATTAC TTTACGGCCGCCGGCTGGAGACTCGAAAGTCACCGGCCTCGTCTGGTAGGCATCTTCCAGAACCAGCCGCTGAGC GAGGTACTGCAGATGCAAAGAACCTACCAGCTCGACGTCGTTCAACTCCACGGAGACGAGCCCATCGAGTGGTCG AGGCAAATTCCCGTGCCGGTGATCCGCTGCTTCAAGCCAGGCCAAGTCGGCATCGGCCTCCGCGGCTACCACACC ATCCCGCTCCTCGACTCCGGCTCCGGCTCAGGCAAGCTCCTAGACGTGTCGAGCGTCCGGGCCGCGCTGGAGACG GACCCGGATTTGAGGGTGTTCCTGGCGGGCGGGTTGAATCCCGAGAACGTGGCCGCGGCGGTGACGGCGCTTGGC CAGCTTGGAGAGCGAGTGCTGGGCGTCGACGTCAGCAGCGGAGTCGAGGAGGATGGGAAGCAGAGCTTGGCCAAG ATAAAGGCCTTTGTCGAGGCGGCCAAGGCGATTCGATAG
Gene	>Ophun1\|792 ATGCCGTCTTCTCTCGATATCATCGATCACTCTCCCCATCAGCCGGAGCCGTCACCTCCAATCCCTACGGCGTCC AACCTGATCCTGATCGACAACTACGACTCCTTCACCTGGAACATCTATCAGTACCTCGTCCTCGAGGGAGCTACC GTTCATGTCTTCCGTAACGATCAGATCAGCTTGCAGGAGCTCATCAGCAAGAACCCAACGCAGCTCATCATCAGC CCCGGCCCAGGCCATCCCACGACCGACTCGGGCATCAGCCGAGATGCCATCCGCCACTTTGCGGGAAAGATCCCC GTTTTTGGCGTCTGCATGGGCCTGTGAGCTTCTCCCGCCGTCTTTCGGGCTGGCCACTCACGCTTGTCAGGCAAT GCATCTTTGATGTTTACGGCGGGGACGTCAACTCTGCCGGAGAGTGGCTGCACGGCAAAACGTCGCCCCTGACGC ACGATAGCAGGGGTGTCTTTGCCGGTCTGGAGCAGAATCTACCGGTGACGAGATATCACTCCCTCGCGGGCACTC ACGTCACATTGCCGGACTGCCTGGAGATTACTTCGTGGGTTGCCAAGGCTGACGGCTCGCCAGGCATCATCCAGG GTGTCCGTCACAAGCAGCTCACTGTCGAGGGGGTTCAGTTTCACCCAGAGAGTATCCTCACGTCTCAGGGACGAA GAATGATACGCAACTTTCTGCACATGCAAGGGGGCACCTGGGCGGAAAACGAGAAGCTGCAGAAAGCCGCGCCGC TCAACGGTCCCCCCATTGCGCAGGACAAGGCAAAGGGCAACAACATACTGCAGCGGATATACGCCAGCCGCAGGG CTGCCGTTGCCGCCCAAAAGGAGATTCCCTCACAACGGATGGCCGATTTACTGGCAGCCTATCGCCTCAACGCGG CGCCTCCTCTTGTTCCGCTGGTGAGGCGTCTACGGCAGTCGCCTTTTGACGTGGCTCTCATGGCCGAGATCAAGC GTGCGTCCCCTTCAAAGGGCGTGTTTGCGCTCGACATGGACGCTCCGACTCAGGCGCGCAAGTACGCCTTGGCCG GAGCCAGCGTCATCTCAGTCCTCACAGAGCCGGAATGGTTCAAGGGGAGCATTGAGGATCTGCGCTCCGTCCGCC AGGTGCTGGACGGGATGCCCAATAGGCCAGCTATTCTACGCAAGGAGTTCATCTTTGACGAGTACCAGATCCTGG AGGCCAGACTTGCAGGCGCCGACACCGTCTTGCTCATCGTCAAGATGCTGGAGCCGGAAGCTCTCAAGCGCCTCT ACGAATACTCGCTGTCGCTGGGGATGGAGCCGCTCGTCGAGGTTCAAAACGGCCAAGAGATGACGACGGCCGTCG AGTTGGGATCCAGGGTCATCGGCGTCAACAACCGCAACCTGGAGAGCTTCGAAGTCGATCTCGATACCACAGGCC GGCTGAGGGGCATGGTGCCGGAGGGCACACTGCTCTGCGCTCTCAGCGGCATCAACAGCCACAAAGACGTGCTGA TGAACAAGAGAGATGGAGTCAACGCAGTCCTCGTCGGCGAGGCCATCATGCGAGCGCCGGACGCCGGCGTCTTCA TCAGCGAGCTCTGCTCAGGCACGAAACAGGCAGCCGGGACGCAGCCTCCCAAAGCACCGCTCTTCGTCAAGATCT GCGGAACGCGGTCGGTGGAGGCCGCGCACGAGGCCATCAAGTCCAAGGCCGACTTTATTGGCATCTGCCTGGTGC CCGGAGCGAAGCGCTGTATCAGCCACGAGACGGCACTCGGGATTTCTGACGCTGTTCATTCGTGCTCAGGAACTA CTTCTGAGGCGCGAGGACAGATGTCCAGCTCCAGCGCGACAGATTACTTTACGGCCGCCGGCTGGAGACTCGAAA GTCACCGGCCTCGTCTGGTAGGCATCTTCCAGAACCAGCCGCTGAGCGAGGTACTGCAGATGCAAAGAACCTACC AGCTCGACGTCGTTCAACTCCACGGAGACGAGCCCATCGAGTGGTCGAGGCAAATTCCCGTGCCGGTGATCCGCT GCTTCAAGCCAGGCCAAGTCGGCATCGGCCTCCGCGGCTACCACACCATCCCGCTCCTCGACTCCGGCTCCGGCT CAGGCAAGCTCCTAGACGTGTCGAGCGTCCGGGCCGCGCTGGAGACGGACCCGGATTTGAGGGTGTTCCTGGCGG GCGGGTTGAATCCCGAGAACGTGGCCGCGGCGGTGACGGCGCTTGGCCAGCTTGGAGAGCGAGTGCTGGGCGTCG ACGTCAGCAGCGGAGTCGAGGAGGATGGGAAGCAGAGCTTGGCCAAGATAAAGGCCTTTGTCGAGGCGGCCAAGG CGATTCGATAG

Fungal Genomics

General Properties

PFAM Domains

Swissprot hits

GO

SignalP

Transmembrane Domains

Transcription Factor Class

Expression data

Sequences