Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|792
Gene name
LocationContig_128:764..3100
Strand-
Gene length (bp)2336
Transcript length (bp)2289
Coding sequence length (bp)2289
Protein length (aa) 763

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00218 IGPS Indole-3-glycerol phosphate synthase 1.8E-93 251 513
PF00697 PRAI N-(5'phosphoribosyl)anthranilate (PRA) isomerase 2.1E-45 571 756
PF00117 GATase Glutamine amidotransferase class-I 6.2E-46 29 216
PF07722 Peptidase_C26 Peptidase C26 2.1E-04 96 201

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P00908|TRPG_NEUCR Multifunctional tryptophan biosynthesis protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=trp-1 PE=3 SV=2 3 762 0.0E+00
sp|P24773|TRPG_PENCH Multifunctional tryptophan biosynthesis protein OS=Penicillium chrysogenum GN=trpC PE=3 SV=1 6 762 0.0E+00
sp|P06531|TRPG_EMENI Multifunctional tryptophan biosynthesis protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=trpC PE=2 SV=3 7 760 0.0E+00
sp|P05328|TRPG_ASPNG Multifunctional tryptophan biosynthesis protein OS=Aspergillus niger GN=trpC PE=3 SV=1 7 761 0.0E+00
sp|P18483|TRPG_ASPAW Multifunctional tryptophan biosynthesis protein OS=Aspergillus awamori GN=trpC PE=3 SV=1 7 761 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P00908|TRPG_NEUCR Multifunctional tryptophan biosynthesis protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=trp-1 PE=3 SV=2 3 762 0.0E+00
sp|P24773|TRPG_PENCH Multifunctional tryptophan biosynthesis protein OS=Penicillium chrysogenum GN=trpC PE=3 SV=1 6 762 0.0E+00
sp|P06531|TRPG_EMENI Multifunctional tryptophan biosynthesis protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=trpC PE=2 SV=3 7 760 0.0E+00
sp|P05328|TRPG_ASPNG Multifunctional tryptophan biosynthesis protein OS=Aspergillus niger GN=trpC PE=3 SV=1 7 761 0.0E+00
sp|P18483|TRPG_ASPAW Multifunctional tryptophan biosynthesis protein OS=Aspergillus awamori GN=trpC PE=3 SV=1 7 761 0.0E+00
sp|Q92411|TRPG_COCHE Multifunctional tryptophan biosynthesis protein OS=Cochliobolus heterostrophus GN=TRP1 PE=3 SV=1 1 761 0.0E+00
sp|Q92370|TRPG_SCHPO Multifunctional tryptophan biosynthesis protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trp1 PE=2 SV=2 27 761 0.0E+00
sp|P20409|TRPG_PHYBL Multifunctional tryptophan biosynthesis protein OS=Phycomyces blakesleeanus GN=trp1 PE=3 SV=1 28 761 0.0E+00
sp|P0CN86|TRPG_CRYNJ Multifunctional tryptophan biosynthesis protein OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TRP1 PE=3 SV=1 28 759 0.0E+00
sp|P0CN87|TRPG_CRYNB Multifunctional tryptophan biosynthesis protein OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TRP1 PE=3 SV=1 28 759 0.0E+00
sp|P27710|TRPG_CRYNH Multifunctional tryptophan biosynthesis protein OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=TRP1 PE=3 SV=2 28 760 0.0E+00
sp|P25170|TRPG_PHACH Multifunctional tryptophan biosynthesis protein OS=Phanerochaete chrysosporium GN=TRPC PE=3 SV=1 26 761 0.0E+00
sp|P00937|TRPG_YEAST Multifunctional tryptophan biosynthesis protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRP3 PE=1 SV=2 22 514 0.0E+00
sp|P09575|TRPG_PICAN Multifunctional tryptophan biosynthesis protein (Fragment) OS=Pichia angusta PE=3 SV=1 21 401 8.0E-147
sp|P24920|TRPC_PHYPR Tryptophan biosynthesis protein TRP1 OS=Phytophthora parasitica GN=TRP1 PE=3 SV=1 249 759 2.0E-81
sp|P00901|TRPG_PSEPU Anthranilate synthase component 2 OS=Pseudomonas putida GN=trpG PE=1 SV=2 27 221 3.0E-66
sp|P20576|TRPG_PSEAE Anthranilate synthase component 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=trpG PE=3 SV=2 27 225 4.0E-63
sp|P06193|PABA_SALTY Aminodeoxychorismate synthase component 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pabA PE=3 SV=1 27 216 2.0E-60
sp|P00903|PABA_ECOLI Aminodeoxychorismate synthase component 2 OS=Escherichia coli (strain K12) GN=pabA PE=1 SV=1 27 217 2.0E-59
sp|P06194|PABA_ENTAE Aminodeoxychorismate synthase component 2 OS=Enterobacter aerogenes GN=pabA PE=3 SV=1 27 217 1.0E-58
sp|P06195|PABA_SERMA Aminodeoxychorismate synthase component 2 OS=Serratia marcescens GN=pabA PE=3 SV=1 27 216 7.0E-58
sp|Q08654|TRPGD_THEMA Bifunctional protein TrpGD OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=trpGD PE=3 SV=2 27 219 3.0E-56
sp|P28819|PABA_BACSU Aminodeoxychorismate/anthranilate synthase component 2 OS=Bacillus subtilis (strain 168) GN=pabA PE=2 SV=1 27 216 8.0E-56
sp|P00902|TRPG_ACIAD Anthranilate synthase component 2 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=trpG PE=3 SV=1 27 218 4.0E-55
sp|A6X0L0|TRPC_OCHA4 Indole-3-glycerol phosphate synthase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=trpC PE=3 SV=1 248 516 4.0E-51
sp|A6Q3P0|TRPC_NITSB Indole-3-glycerol phosphate synthase OS=Nitratiruptor sp. (strain SB155-2) GN=trpC PE=3 SV=1 250 502 6.0E-50
sp|P20441|TRPG_LEPBI Anthranilate synthase component 2 OS=Leptospira biflexa GN=trpG PE=3 SV=2 27 217 7.0E-50
sp|A5VQR5|TRPC_BRUO2 Indole-3-glycerol phosphate synthase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=trpC PE=3 SV=1 248 519 2.0E-49
sp|P66989|TRPC_BRUSU Indole-3-glycerol phosphate synthase OS=Brucella suis biovar 1 (strain 1330) GN=trpC PE=3 SV=1 248 519 3.0E-49
sp|P66988|TRPC_BRUME Indole-3-glycerol phosphate synthase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=trpC PE=3 SV=1 248 519 3.0E-49
sp|C0RJB1|TRPC_BRUMB Indole-3-glycerol phosphate synthase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=trpC PE=3 SV=1 248 519 3.0E-49
sp|A9M5F4|TRPC_BRUC2 Indole-3-glycerol phosphate synthase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=trpC PE=3 SV=1 248 519 3.0E-49
sp|Q57CZ8|TRPC_BRUAB Indole-3-glycerol phosphate synthase OS=Brucella abortus biovar 1 (strain 9-941) GN=trpC PE=3 SV=1 248 519 3.0E-49
sp|Q2YRR4|TRPC_BRUA2 Indole-3-glycerol phosphate synthase OS=Brucella abortus (strain 2308) GN=trpC PE=1 SV=1 248 519 3.0E-49
sp|B2S5Z1|TRPC_BRUA1 Indole-3-glycerol phosphate synthase OS=Brucella abortus (strain S19) GN=trpC PE=3 SV=1 248 519 3.0E-49
sp|B0CGT9|TRPC_BRUSI Indole-3-glycerol phosphate synthase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=trpC PE=3 SV=1 248 519 4.0E-49
sp|P48261|TRPG_CYAPA Anthranilate synthase component 2 OS=Cyanophora paradoxa GN=trpG PE=3 SV=1 27 217 5.0E-49
sp|Q3Z6G5|TRPC_DEHM1 Indole-3-glycerol phosphate synthase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=trpC PE=3 SV=1 287 513 6.0E-49
sp|Q3ZZ14|TRPC_DEHMC Indole-3-glycerol phosphate synthase OS=Dehalococcoides mccartyi (strain CBDB1) GN=trpC PE=3 SV=1 302 513 9.0E-49
sp|A6WC91|TRPC_KINRD Indole-3-glycerol phosphate synthase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=trpC PE=3 SV=1 302 525 1.0E-48
sp|A5FPM3|TRPC_DEHMB Indole-3-glycerol phosphate synthase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=trpC PE=3 SV=1 302 513 5.0E-48
sp|A1VYK3|TRPC_CAMJJ Indole-3-glycerol phosphate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=trpC PE=3 SV=1 250 507 1.0E-47
sp|Q5HVR3|TRPC_CAMJR Indole-3-glycerol phosphate synthase OS=Campylobacter jejuni (strain RM1221) GN=trpC PE=3 SV=1 250 507 2.0E-47
sp|Q9PI11|TRPC_CAMJE Indole-3-glycerol phosphate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=trpC PE=3 SV=1 250 507 2.0E-47
sp|A8FKS2|TRPC_CAMJ8 Indole-3-glycerol phosphate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=trpC PE=3 SV=1 250 507 2.0E-47
sp|A7H4P0|TRPC_CAMJD Indole-3-glycerol phosphate synthase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=trpC PE=3 SV=1 250 507 2.0E-47
sp|Q7UKJ7|TRPC_RHOBA Indole-3-glycerol phosphate synthase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=trpC PE=3 SV=1 302 508 2.0E-47
sp|B1GZC0|TRPC_UNCTG Indole-3-glycerol phosphate synthase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=trpC PE=3 SV=1 250 513 3.0E-47
sp|B8I0V0|TRPC_CLOCE Indole-3-glycerol phosphate synthase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=trpC PE=3 SV=1 293 513 4.0E-47
sp|Q42565|ASB1_ARATH Anthranilate synthase beta subunit 1, chloroplastic OS=Arabidopsis thaliana GN=ASB1 PE=1 SV=1 27 229 4.0E-47
sp|P33974|TRPG_HALVD Anthranilate synthase component 2 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=trpG PE=3 SV=2 27 221 7.0E-47
sp|Q7XUS2|ASB1_ORYSJ Anthranilate synthase beta subunit 1, chloroplastic OS=Oryza sativa subsp. japonica GN=ASB1 PE=1 SV=1 27 218 8.0E-47
sp|A1VTG7|TRPC_POLNA Indole-3-glycerol phosphate synthase OS=Polaromonas naphthalenivorans (strain CJ2) GN=trpC PE=3 SV=1 303 513 1.0E-46
sp|Q21SE8|TRPC_RHOFT Indole-3-glycerol phosphate synthase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=trpC PE=3 SV=1 248 513 2.0E-46
sp|A7GYQ7|TRPC_CAMC5 Indole-3-glycerol phosphate synthase OS=Campylobacter curvus (strain 525.92) GN=trpC PE=3 SV=1 304 516 3.0E-46
sp|A9VJW0|TRPC_BACWK Indole-3-glycerol phosphate synthase OS=Bacillus weihenstephanensis (strain KBAB4) GN=trpC PE=3 SV=1 291 512 4.0E-46
sp|A7NMZ8|TRPC_ROSCS Indole-3-glycerol phosphate synthase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=trpC PE=3 SV=1 248 513 5.0E-46
sp|A9KL43|TRPC_CLOPH Indole-3-glycerol phosphate synthase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=trpC PE=3 SV=1 302 515 6.0E-46
sp|Q9FJM5|ASB2_ARATH Anthranilate synthase beta subunit 2, chloroplastic OS=Arabidopsis thaliana GN=ASB2 PE=2 SV=1 27 229 7.0E-46
sp|P05379|TRPG_THET8 Anthranilate synthase component 2 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=trpG PE=3 SV=1 27 216 8.0E-46
sp|B7JES8|TRPC_BACC0 Indole-3-glycerol phosphate synthase OS=Bacillus cereus (strain AH820) GN=trpC PE=3 SV=1 291 512 8.0E-46
sp|Q81TM0|TRPC_BACAN Indole-3-glycerol phosphate synthase OS=Bacillus anthracis GN=trpC PE=3 SV=1 291 512 8.0E-46
sp|C3LAW0|TRPC_BACAC Indole-3-glycerol phosphate synthase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=trpC PE=3 SV=1 291 512 8.0E-46
sp|C3P3T8|TRPC_BACAA Indole-3-glycerol phosphate synthase OS=Bacillus anthracis (strain A0248) GN=trpC PE=3 SV=1 291 512 8.0E-46
sp|Q6HLU6|TRPC_BACHK Indole-3-glycerol phosphate synthase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=trpC PE=3 SV=1 291 512 9.0E-46
sp|Q81GG7|TRPC_BACCR Indole-3-glycerol phosphate synthase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=trpC PE=3 SV=1 267 512 1.0E-45
sp|B7HGZ9|TRPC_BACC4 Indole-3-glycerol phosphate synthase OS=Bacillus cereus (strain B4264) GN=trpC PE=3 SV=1 267 512 1.0E-45
sp|A5USQ4|TRPC_ROSS1 Indole-3-glycerol phosphate synthase OS=Roseiflexus sp. (strain RS-1) GN=trpC PE=3 SV=1 248 517 1.0E-45
sp|B9JX64|TRPC_AGRVS Indole-3-glycerol phosphate synthase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=trpC PE=3 SV=1 248 505 1.0E-45
sp|A8LGR8|TRPC_FRASN Indole-3-glycerol phosphate synthase OS=Frankia sp. (strain EAN1pec) GN=trpC PE=3 SV=1 302 525 2.0E-45
sp|Q63EC9|TRPC_BACCZ Indole-3-glycerol phosphate synthase OS=Bacillus cereus (strain ZK / E33L) GN=trpC PE=3 SV=1 267 512 2.0E-45
sp|B7IM74|TRPC_BACC2 Indole-3-glycerol phosphate synthase OS=Bacillus cereus (strain G9842) GN=trpC PE=3 SV=1 267 512 2.0E-45
sp|C1ELE8|TRPC_BACC3 Indole-3-glycerol phosphate synthase OS=Bacillus cereus (strain 03BB102) GN=trpC PE=3 SV=1 291 512 3.0E-45
sp|A0RB62|TRPC_BACAH Indole-3-glycerol phosphate synthase OS=Bacillus thuringiensis (strain Al Hakam) GN=trpC PE=3 SV=1 291 512 3.0E-45
sp|B1YLS2|TRPC_EXIS2 Indole-3-glycerol phosphate synthase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=trpC PE=3 SV=1 249 519 4.0E-45
sp|Q98ME3|TRPC_RHILO Indole-3-glycerol phosphate synthase OS=Rhizobium loti (strain MAFF303099) GN=trpC PE=3 SV=1 248 516 4.0E-45
sp|B2FKL1|TRPC_STRMK Indole-3-glycerol phosphate synthase OS=Stenotrophomonas maltophilia (strain K279a) GN=trpC PE=3 SV=1 248 507 5.0E-45
sp|Q123F4|TRPC_POLSJ Indole-3-glycerol phosphate synthase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=trpC PE=3 SV=1 303 513 6.0E-45
sp|Q5V214|TRPG1_HALMA Anthranilate synthase component II OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=trpG1 PE=3 SV=1 14 216 6.0E-45
sp|B9IU36|TRPC_BACCQ Indole-3-glycerol phosphate synthase OS=Bacillus cereus (strain Q1) GN=trpC PE=3 SV=1 267 512 7.0E-45
sp|B7I0F0|TRPC_BACC7 Indole-3-glycerol phosphate synthase OS=Bacillus cereus (strain AH187) GN=trpC PE=3 SV=1 267 512 7.0E-45
sp|Q9HPG6|TRPG_HALSA Anthranilate synthase component 2 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=trpG PE=3 SV=1 26 216 1.0E-44
sp|B3EG28|TRPC_CHLL2 Indole-3-glycerol phosphate synthase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=trpC PE=3 SV=1 251 505 1.0E-44
sp|Q3ABS1|TRPC_CARHZ Indole-3-glycerol phosphate synthase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=trpC PE=3 SV=1 251 507 2.0E-44
sp|Q7TTU3|TRPC_SYNPX Indole-3-glycerol phosphate synthase OS=Synechococcus sp. (strain WH8102) GN=trpC PE=3 SV=1 240 516 2.0E-44
sp|A0RNN3|TRPC_CAMFF Indole-3-glycerol phosphate synthase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=trpC PE=3 SV=1 292 502 2.0E-44
sp|A0AJ82|TRPC_LISW6 Indole-3-glycerol phosphate synthase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=trpC PE=3 SV=1 249 502 2.0E-44
sp|Q764B9|ASB2_ORYSJ Anthranilate synthase beta subunit 2, chloroplastic OS=Oryza sativa subsp. japonica GN=ASB2 PE=2 SV=1 27 226 2.0E-44
sp|A9HY11|TRPC_BORPD Indole-3-glycerol phosphate synthase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=trpC PE=3 SV=1 248 513 3.0E-44
sp|Q2IWB0|TRPC_RHOP2 Indole-3-glycerol phosphate synthase OS=Rhodopseudomonas palustris (strain HaA2) GN=trpC PE=3 SV=1 248 505 3.0E-44
sp|C3MCF2|TRPC_RHISN Indole-3-glycerol phosphate synthase OS=Rhizobium sp. (strain NGR234) GN=trpC PE=3 SV=1 248 524 3.0E-44
sp|Q03X00|TRPC_LEUMM Indole-3-glycerol phosphate synthase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=trpC PE=3 SV=1 296 513 3.0E-44
sp|A3DDS7|TRPC_CLOTH Indole-3-glycerol phosphate synthase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=trpC PE=3 SV=1 301 503 3.0E-44
sp|B4SLE8|TRPC_STRM5 Indole-3-glycerol phosphate synthase OS=Stenotrophomonas maltophilia (strain R551-3) GN=trpC PE=3 SV=1 248 507 3.0E-44
sp|Q7M831|TRPC_WOLSU Indole-3-glycerol phosphate synthase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=trpC PE=3 SV=1 304 506 3.0E-44
sp|B4RBX5|TRPC_PHEZH Indole-3-glycerol phosphate synthase OS=Phenylobacterium zucineum (strain HLK1) GN=trpC PE=3 SV=1 248 505 4.0E-44
sp|B9LAF4|TRPC_NAUPA Indole-3-glycerol phosphate synthase OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=trpC PE=3 SV=1 304 502 4.0E-44
sp|B3QLY7|TRPC_CHLP8 Indole-3-glycerol phosphate synthase OS=Chlorobaculum parvum (strain NCIB 8327) GN=trpC PE=3 SV=1 251 501 5.0E-44
sp|Q2G6R0|TRPC_NOVAD Indole-3-glycerol phosphate synthase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=trpC PE=3 SV=1 303 505 5.0E-44
sp|B1XSZ1|TRPC_POLNS Indole-3-glycerol phosphate synthase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=trpC PE=3 SV=1 303 515 5.0E-44
sp|Q11HU1|TRPC_CHESB Indole-3-glycerol phosphate synthase OS=Chelativorans sp. (strain BNC1) GN=trpC PE=3 SV=1 249 505 9.0E-44
sp|B2JHI8|TRPC_BURP8 Indole-3-glycerol phosphate synthase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=trpC PE=3 SV=1 248 513 1.0E-43
sp|Q1XDC5|TRPG_PYRYE Anthranilate synthase component 2 OS=Pyropia yezoensis GN=trpG PE=3 SV=1 27 216 1.0E-43
sp|Q30SM1|TRPC_SULDN Indole-3-glycerol phosphate synthase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=trpC PE=3 SV=1 297 517 1.0E-43
sp|Q87EX2|TRPC_XYLFT Indole-3-glycerol phosphate synthase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=trpC PE=3 SV=1 301 513 1.0E-43
sp|B2I6S5|TRPC_XYLF2 Indole-3-glycerol phosphate synthase OS=Xylella fastidiosa (strain M23) GN=trpC PE=3 SV=1 301 513 1.0E-43
sp|Q7CYR2|TRPC_AGRFC Indole-3-glycerol phosphate synthase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=trpC PE=3 SV=2 248 516 1.0E-43
sp|B0K8T4|TRPC_THEP3 Indole-3-glycerol phosphate synthase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=trpC PE=3 SV=1 302 501 1.0E-43
sp|B9JFD8|TRPC_AGRRK Indole-3-glycerol phosphate synthase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=trpC PE=3 SV=1 248 516 2.0E-43
sp|B3Q0L3|TRPC_RHIE6 Indole-3-glycerol phosphate synthase OS=Rhizobium etli (strain CIAT 652) GN=trpC PE=3 SV=1 248 505 2.0E-43
sp|Q9PGT5|TRPC_XYLFA Indole-3-glycerol phosphate synthase OS=Xylella fastidiosa (strain 9a5c) GN=trpC PE=3 SV=1 301 513 2.0E-43
sp|A6U9C5|TRPC_SINMW Indole-3-glycerol phosphate synthase OS=Sinorhizobium medicae (strain WSM419) GN=trpC PE=3 SV=1 248 517 2.0E-43
sp|B0K2U1|TRPC_THEPX Indole-3-glycerol phosphate synthase OS=Thermoanaerobacter sp. (strain X514) GN=trpC PE=3 SV=1 302 501 3.0E-43
sp|A4SV52|TRPC_POLSQ Indole-3-glycerol phosphate synthase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=trpC PE=3 SV=1 304 513 3.0E-43
sp|Q8KBW1|TRPC_CHLTE Indole-3-glycerol phosphate synthase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=trpC PE=3 SV=1 251 509 4.0E-43
sp|B0U1P0|TRPC_XYLFM Indole-3-glycerol phosphate synthase OS=Xylella fastidiosa (strain M12) GN=trpC PE=3 SV=1 301 513 4.0E-43
sp|Q7VU67|TRPC_BORPE Indole-3-glycerol phosphate synthase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=trpC PE=3 SV=1 248 515 4.0E-43
sp|Q7W387|TRPC_BORPA Indole-3-glycerol phosphate synthase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=trpC PE=3 SV=1 248 515 4.0E-43
sp|Q7WEK6|TRPC_BORBR Indole-3-glycerol phosphate synthase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=trpC PE=3 SV=1 248 515 4.0E-43
sp|C4Z138|TRPC_EUBE2 Indole-3-glycerol phosphate synthase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=trpC PE=3 SV=1 293 513 5.0E-43
sp|Q92PR9|TRPC_RHIME Indole-3-glycerol phosphate synthase OS=Rhizobium meliloti (strain 1021) GN=trpC PE=3 SV=1 248 517 5.0E-43
sp|A8ET36|TRPC_ARCB4 Indole-3-glycerol phosphate synthase OS=Arcobacter butzleri (strain RM4018) GN=trpC PE=3 SV=1 282 504 5.0E-43
sp|A8ZZX0|TRPC_DESOH Indole-3-glycerol phosphate synthase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=trpC PE=3 SV=1 290 515 5.0E-43
sp|Q6AF68|TRPC_LEIXX Indole-3-glycerol phosphate synthase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=trpC PE=3 SV=1 298 501 6.0E-43
sp|B8DHB2|TRPC_LISMH Indole-3-glycerol phosphate synthase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=trpC PE=3 SV=1 249 507 7.0E-43
sp|Q71Z38|TRPC_LISMF Indole-3-glycerol phosphate synthase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=trpC PE=3 SV=1 249 507 9.0E-43
sp|C1KVS7|TRPC_LISMC Indole-3-glycerol phosphate synthase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=trpC PE=3 SV=1 249 507 9.0E-43
sp|Q2K879|TRPC_RHIEC Indole-3-glycerol phosphate synthase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=trpC PE=3 SV=1 248 505 9.0E-43
sp|Q0K6I0|TRPC_CUPNH Indole-3-glycerol phosphate synthase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=trpC PE=3 SV=1 248 513 9.0E-43
sp|Q3AU73|TRPC_CHLCH Indole-3-glycerol phosphate synthase OS=Chlorobium chlorochromatii (strain CaD3) GN=trpC PE=3 SV=1 251 500 1.0E-42
sp|Q8PD70|TRPC_XANCP Indole-3-glycerol phosphate synthase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=trpC PE=3 SV=1 303 513 1.0E-42
sp|Q4UZF8|TRPC_XANC8 Indole-3-glycerol phosphate synthase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=trpC PE=3 SV=1 303 513 1.0E-42
sp|B8EJS1|TRPC_METSB Indole-3-glycerol phosphate synthase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=trpC PE=3 SV=1 302 516 1.0E-42
sp|A8Z6K1|TRPC_CAMC1 Indole-3-glycerol phosphate synthase OS=Campylobacter concisus (strain 13826) GN=trpC PE=3 SV=1 262 516 1.0E-42
sp|Q8Y6Q4|TRPC_LISMO Indole-3-glycerol phosphate synthase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=trpC PE=3 SV=1 249 502 1.0E-42
sp|Q88WI2|TRPC_LACPL Indole-3-glycerol phosphate synthase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=trpC PE=3 SV=1 304 518 2.0E-42
sp|O68814|TRPC1_STRCO Indole-3-glycerol phosphate synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trpC1 PE=3 SV=3 302 525 2.0E-42
sp|Q1MGE1|TRPC_RHIL3 Indole-3-glycerol phosphate synthase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=trpC PE=3 SV=1 248 516 2.0E-42
sp|Q5P2G1|TRPC_AROAE Indole-3-glycerol phosphate synthase OS=Aromatoleum aromaticum (strain EbN1) GN=trpC PE=3 SV=1 248 507 3.0E-42
sp|A1TJQ2|TRPC_ACIAC Indole-3-glycerol phosphate synthase OS=Acidovorax citrulli (strain AAC00-1) GN=trpC PE=3 SV=1 248 513 3.0E-42
sp|Q9A727|TRPC_CAUCR Indole-3-glycerol phosphate synthase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=trpC PE=3 SV=1 248 505 4.0E-42
sp|B8GWP9|TRPC_CAUCN Indole-3-glycerol phosphate synthase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=trpC PE=3 SV=1 248 505 4.0E-42
sp|A8I836|TRPC_AZOC5 Indole-3-glycerol phosphate synthase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=trpC PE=3 SV=1 303 516 5.0E-42
sp|B5ZPY7|TRPC_RHILW Indole-3-glycerol phosphate synthase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=trpC PE=3 SV=1 248 505 6.0E-42
sp|P94327|TRPC_BRADU Indole-3-glycerol phosphate synthase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=trpC PE=3 SV=2 248 524 7.0E-42
sp|Q6AMS4|TRPC_DESPS Indole-3-glycerol phosphate synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=trpC PE=3 SV=1 248 513 8.0E-42
sp|C1AT55|TRPC_RHOOB Indole-3-glycerol phosphate synthase OS=Rhodococcus opacus (strain B4) GN=trpC PE=3 SV=1 302 525 8.0E-42
sp|C1D7J7|TRPC_LARHH Indole-3-glycerol phosphate synthase OS=Laribacter hongkongensis (strain HLHK9) GN=trpC PE=3 SV=1 248 513 8.0E-42
sp|Q97EF3|TRPC_CLOAB Indole-3-glycerol phosphate synthase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=trpC PE=3 SV=1 301 519 1.0E-41
sp|Q0SHZ5|TRPC_RHOJR Indole-3-glycerol phosphate synthase OS=Rhodococcus jostii (strain RHA1) GN=trpC PE=3 SV=1 302 525 1.0E-41
sp|P22098|TRPC_VIBPA Tryptophan biosynthesis protein TrpCF OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=trpC PE=3 SV=2 304 762 2.0E-41
sp|Q07NF6|TRPC_RHOP5 Indole-3-glycerol phosphate synthase OS=Rhodopseudomonas palustris (strain BisA53) GN=trpC PE=3 SV=1 248 505 2.0E-41
sp|B2SL03|TRPC_XANOP Indole-3-glycerol phosphate synthase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=trpC PE=3 SV=1 301 513 2.0E-41
sp|Q7NUI6|TRPC_CHRVO Indole-3-glycerol phosphate synthase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=trpC PE=3 SV=1 294 513 2.0E-41
sp|Q215B9|TRPC_RHOPB Indole-3-glycerol phosphate synthase OS=Rhodopseudomonas palustris (strain BisB18) GN=trpC PE=3 SV=1 248 505 2.0E-41
sp|Q1B7H6|TRPC_MYCSS Indole-3-glycerol phosphate synthase OS=Mycobacterium sp. (strain MCS) GN=trpC PE=3 SV=1 249 525 2.0E-41
sp|A1UHJ6|TRPC_MYCSK Indole-3-glycerol phosphate synthase OS=Mycobacterium sp. (strain KMS) GN=trpC PE=3 SV=1 249 525 2.0E-41
sp|A3Q119|TRPC_MYCSJ Indole-3-glycerol phosphate synthase OS=Mycobacterium sp. (strain JLS) GN=trpC PE=3 SV=1 249 525 2.0E-41
sp|Q1QMJ9|TRPC_NITHX Indole-3-glycerol phosphate synthase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=trpC PE=3 SV=1 249 505 2.0E-41
sp|Q82A84|TRPC_STRAW Indole-3-glycerol phosphate synthase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=trpC PE=3 SV=1 302 525 2.0E-41
sp|A4SG41|TRPC_CHLPM Indole-3-glycerol phosphate synthase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=trpC PE=3 SV=1 258 500 2.0E-41
sp|P51362|TRPG_PORPU Anthranilate synthase component 2 OS=Porphyra purpurea GN=trpG PE=3 SV=1 27 216 3.0E-41
sp|Q5NQ36|TRPC_ZYMMO Indole-3-glycerol phosphate synthase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=trpC PE=3 SV=1 248 505 4.0E-41
sp|Q3BYB5|TRPC_XANC5 Indole-3-glycerol phosphate synthase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=trpC PE=3 SV=1 301 513 4.0E-41
sp|Q03CY1|TRPC_LACC3 Indole-3-glycerol phosphate synthase OS=Lactobacillus casei (strain ATCC 334) GN=trpC PE=3 SV=1 291 503 4.0E-41
sp|B3W6W8|TRPC_LACCB Indole-3-glycerol phosphate synthase OS=Lactobacillus casei (strain BL23) GN=trpC PE=3 SV=1 291 503 5.0E-41
sp|Q2NYD7|TRPC_XANOM Indole-3-glycerol phosphate synthase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=trpC PE=3 SV=1 301 513 6.0E-41
sp|B2IKL7|TRPC_BEII9 Indole-3-glycerol phosphate synthase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=trpC PE=3 SV=1 249 505 7.0E-41
sp|P00905|TRPGD_SALTY Bifunctional protein TrpGD OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=trpGD PE=1 SV=4 25 278 1.0E-40
sp|A7HXZ6|TRPC_PARL1 Indole-3-glycerol phosphate synthase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=trpC PE=3 SV=1 303 505 1.0E-40
sp|P17217|TRPC_LACCA Indole-3-glycerol phosphate synthase OS=Lactobacillus casei GN=trpC PE=3 SV=1 294 503 1.0E-40
sp|Q8PQ47|TRPC_XANAC Indole-3-glycerol phosphate synthase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=trpC PE=3 SV=1 301 513 1.0E-40
sp|Q9XBM3|TRPC_ZYMMT Indole-3-glycerol phosphate synthase OS=Zymomonas mobilis subsp. pomaceae (strain ATCC 29192 / JCM 10191 / NBRC 13757 / NCIMB 11200 / NRRL B-4491) GN=trpC PE=3 SV=2 248 505 1.0E-40
sp|B1MBV4|TRPC_MYCA9 Indole-3-glycerol phosphate synthase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=trpC PE=3 SV=1 302 525 1.0E-40
sp|Q73BQ9|TRPC_BACC1 Indole-3-glycerol phosphate synthase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=trpC PE=3 SV=1 291 512 1.0E-40
sp|B3QZD6|TRPC_CHLT3 Indole-3-glycerol phosphate synthase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=trpC PE=3 SV=1 296 501 2.0E-40
sp|B3Q6M9|TRPC_RHOPT Indole-3-glycerol phosphate synthase OS=Rhodopseudomonas palustris (strain TIE-1) GN=trpC PE=3 SV=1 248 505 2.0E-40
sp|Q10ZM7|TRPC_TRIEI Indole-3-glycerol phosphate synthase OS=Trichodesmium erythraeum (strain IMS101) GN=trpC PE=3 SV=1 244 518 2.0E-40
sp|B0JTM2|TRPC_MICAN Indole-3-glycerol phosphate synthase OS=Microcystis aeruginosa (strain NIES-843) GN=trpC PE=3 SV=1 283 513 2.0E-40
sp|Q3B2C7|TRPC_CHLL7 Indole-3-glycerol phosphate synthase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=trpC PE=3 SV=1 251 500 2.0E-40
sp|B6JG29|TRPC_OLICO Indole-3-glycerol phosphate synthase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=trpC PE=3 SV=1 248 505 2.0E-40
sp|A1T8X3|TRPC_MYCVP Indole-3-glycerol phosphate synthase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=trpC PE=3 SV=1 285 527 2.0E-40
sp|A5N7N8|TRPC_CLOK5 Indole-3-glycerol phosphate synthase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=trpC PE=3 SV=1 301 502 2.0E-40
sp|B9E149|TRPC_CLOK1 Indole-3-glycerol phosphate synthase OS=Clostridium kluyveri (strain NBRC 12016) GN=trpC PE=3 SV=1 301 502 2.0E-40
sp|Q92B79|TRPC_LISIN Indole-3-glycerol phosphate synthase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=trpC PE=3 SV=1 251 502 2.0E-40
sp|Q3SRJ3|TRPC_NITWN Indole-3-glycerol phosphate synthase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=trpC PE=3 SV=1 301 505 3.0E-40
sp|A0PP28|TRPC_MYCUA Indole-3-glycerol phosphate synthase OS=Mycobacterium ulcerans (strain Agy99) GN=trpC PE=3 SV=1 302 525 3.0E-40
sp|A4T9N5|TRPC_MYCGI Indole-3-glycerol phosphate synthase OS=Mycobacterium gilvum (strain PYR-GCK) GN=trpC PE=3 SV=1 249 525 3.0E-40
sp|B4SDV8|TRPC_PELPB Indole-3-glycerol phosphate synthase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=trpC PE=3 SV=1 267 507 3.0E-40
sp|Q9JSN4|TRPC_NEIMA Indole-3-glycerol phosphate synthase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=trpC PE=3 SV=1 248 505 4.0E-40
sp|Q3AV87|TRPC_SYNS9 Indole-3-glycerol phosphate synthase OS=Synechococcus sp. (strain CC9902) GN=trpC PE=3 SV=1 240 505 4.0E-40
sp|Q9KCB2|TRPC_BACHD Indole-3-glycerol phosphate synthase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=trpC PE=3 SV=1 289 508 4.0E-40
sp|Q2KU99|TRPC_BORA1 Indole-3-glycerol phosphate synthase OS=Bordetella avium (strain 197N) GN=trpC PE=3 SV=1 248 515 4.0E-40
sp|P00910|TRPC_SALTY Tryptophan biosynthesis protein TrpCF OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=trpC PE=3 SV=1 303 741 5.0E-40
sp|Q9K192|TRPC_NEIMB Indole-3-glycerol phosphate synthase OS=Neisseria meningitidis serogroup B (strain MC58) GN=trpC PE=3 SV=1 248 505 5.0E-40
sp|B2HQX7|TRPC_MYCMM Indole-3-glycerol phosphate synthase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=trpC PE=3 SV=1 302 525 6.0E-40
sp|Q3AL94|TRPC_SYNSC Indole-3-glycerol phosphate synthase OS=Synechococcus sp. (strain CC9605) GN=trpC PE=3 SV=1 240 505 6.0E-40
sp|B0SYZ4|TRPC_CAUSK Indole-3-glycerol phosphate synthase OS=Caulobacter sp. (strain K31) GN=trpC PE=3 SV=1 248 505 7.0E-40
sp|A0QX95|TRPC_MYCS2 Indole-3-glycerol phosphate synthase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=trpC PE=1 SV=1 249 525 7.0E-40
sp|Q2S1Z5|TRPC_SALRD Indole-3-glycerol phosphate synthase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=trpC PE=3 SV=1 302 524 8.0E-40
sp|P00906|TRPG_SHIDY Anthranilate synthase component II (Fragment) OS=Shigella dysenteriae GN=trpG-TRPD PE=3 SV=2 25 227 8.0E-40
sp|Q136D2|TRPC_RHOPS Indole-3-glycerol phosphate synthase OS=Rhodopseudomonas palustris (strain BisB5) GN=trpC PE=3 SV=1 294 505 8.0E-40
sp|Q55508|TRPC_SYNY3 Indole-3-glycerol phosphate synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=trpC PE=3 SV=1 237 505 1.0E-39
sp|Q740P4|TRPC_MYCPA Indole-3-glycerol phosphate synthase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=trpC PE=3 SV=1 302 525 1.0E-39
sp|A0QHH0|TRPC_MYCA1 Indole-3-glycerol phosphate synthase OS=Mycobacterium avium (strain 104) GN=trpC PE=3 SV=1 302 525 1.0E-39
sp|A1BDW1|TRPC_CHLPD Indole-3-glycerol phosphate synthase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=trpC PE=3 SV=1 295 505 1.0E-39
sp|B3R703|TRPC_CUPTR Indole-3-glycerol phosphate synthase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=trpC PE=3 SV=1 248 513 1.0E-39
sp|A1W2Z8|TRPC_ACISJ Indole-3-glycerol phosphate synthase OS=Acidovorax sp. (strain JS42) GN=trpC PE=3 SV=1 304 513 1.0E-39
sp|A7I2Y2|TRPC_CAMHC Indole-3-glycerol phosphate synthase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=trpC PE=3 SV=1 250 523 2.0E-39
sp|B9MBS5|TRPC_ACIET Indole-3-glycerol phosphate synthase OS=Acidovorax ebreus (strain TPSY) GN=trpC PE=3 SV=1 304 513 2.0E-39
sp|A9BBR3|TRPC_PROM4 Indole-3-glycerol phosphate synthase OS=Prochlorococcus marinus (strain MIT 9211) GN=trpC PE=3 SV=1 240 513 2.0E-39
sp|A7INK2|TRPC_XANP2 Indole-3-glycerol phosphate synthase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=trpC PE=3 SV=1 303 515 2.0E-39
sp|A1SL44|TRPC_NOCSJ Indole-3-glycerol phosphate synthase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=trpC PE=3 SV=1 249 505 2.0E-39
sp|Q47AC7|TRPC_DECAR Indole-3-glycerol phosphate synthase OS=Dechloromonas aromatica (strain RCB) GN=trpC PE=3 SV=1 248 513 2.0E-39
sp|B1Y7I2|TRPC_LEPCP Indole-3-glycerol phosphate synthase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=trpC PE=3 SV=1 303 513 2.0E-39
sp|Q5F645|TRPC_NEIG1 Indole-3-glycerol phosphate synthase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=trpC PE=3 SV=1 248 513 3.0E-39
sp|A4G1P4|TRPC_HERAR Indole-3-glycerol phosphate synthase OS=Herminiimonas arsenicoxydans GN=trpC PE=3 SV=1 248 515 3.0E-39
sp|Q44603|TRPC_BUCSC Tryptophan biosynthesis protein TrpCF OS=Buchnera aphidicola subsp. Schlechtendalia chinensis GN=trpC PE=3 SV=1 249 762 3.0E-39
sp|Q9ZFA7|TRPC_RHOS4 Indole-3-glycerol phosphate synthase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=trpC PE=3 SV=1 304 505 4.0E-39
sp|P00904|TRPGD_ECOLI Bifunctional protein TrpGD OS=Escherichia coli (strain K12) GN=trpGD PE=1 SV=3 25 278 4.0E-39
sp|B4RPF1|TRPC_NEIG2 Indole-3-glycerol phosphate synthase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=trpC PE=3 SV=1 248 513 4.0E-39
sp|Q8Z7D9|TRPC_SALTI Tryptophan biosynthesis protein TrpCF OS=Salmonella typhi GN=trpC PE=3 SV=1 303 741 4.0E-39
sp|A5EK25|TRPC_BRASB Indole-3-glycerol phosphate synthase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=trpC PE=3 SV=1 248 505 5.0E-39
sp|Q9KST5|TRPC_VIBCH Tryptophan biosynthesis protein TrpCF OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=trpCF PE=3 SV=1 301 741 5.0E-39
sp|A3CLL9|TRPC_STRSV Indole-3-glycerol phosphate synthase OS=Streptococcus sanguinis (strain SK36) GN=trpC PE=3 SV=1 291 513 5.0E-39
sp|A8AW03|TRPC_STRGC Indole-3-glycerol phosphate synthase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=trpC PE=3 SV=1 291 513 5.0E-39
sp|C1CT53|TRPC_STRZT Indole-3-glycerol phosphate synthase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=trpC PE=3 SV=1 304 513 5.0E-39
sp|Q5ZX99|TRPC_LEGPH Indole-3-glycerol phosphate synthase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=trpC PE=3 SV=1 248 515 5.0E-39
sp|Q5X6S0|TRPC_LEGPA Indole-3-glycerol phosphate synthase OS=Legionella pneumophila (strain Paris) GN=trpC PE=3 SV=1 248 515 5.0E-39
sp|A4YVD6|TRPC_BRASO Indole-3-glycerol phosphate synthase OS=Bradyrhizobium sp. (strain ORS278) GN=trpC PE=3 SV=1 248 505 6.0E-39
sp|C1CMD5|TRPC_STRZP Indole-3-glycerol phosphate synthase OS=Streptococcus pneumoniae (strain P1031) GN=trpC PE=3 SV=1 304 513 6.0E-39
sp|B2ISS3|TRPC_STRPS Indole-3-glycerol phosphate synthase OS=Streptococcus pneumoniae (strain CGSP14) GN=trpC PE=3 SV=1 304 513 6.0E-39
sp|Q97P30|TRPC_STRPN Indole-3-glycerol phosphate synthase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=trpC PE=3 SV=1 304 513 6.0E-39
sp|B8ZN61|TRPC_STRPJ Indole-3-glycerol phosphate synthase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=trpC PE=3 SV=1 304 513 6.0E-39
sp|B5E7M5|TRPC_STRP4 Indole-3-glycerol phosphate synthase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=trpC PE=3 SV=1 304 513 6.0E-39
sp|B1WQE4|TRPC_CYAA5 Indole-3-glycerol phosphate synthase OS=Cyanothece sp. (strain ATCC 51142) GN=trpC PE=3 SV=1 246 515 6.0E-39
sp|Q8ESU2|TRPC_OCEIH Indole-3-glycerol phosphate synthase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=trpC PE=3 SV=1 287 503 6.0E-39
sp|Q3SGS2|TRPC_THIDA Indole-3-glycerol phosphate synthase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=trpC PE=3 SV=1 248 513 7.0E-39
sp|C4KZ66|TRPC_EXISA Indole-3-glycerol phosphate synthase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=trpC PE=3 SV=1 304 515 8.0E-39
sp|Q02YB4|TRPC_LACLS Indole-3-glycerol phosphate synthase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=trpC PE=3 SV=1 250 513 1.0E-38
sp|A2RK21|TRPC_LACLM Indole-3-glycerol phosphate synthase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=trpC PE=3 SV=1 250 513 1.0E-38
sp|C1C968|TRPC_STRP7 Indole-3-glycerol phosphate synthase OS=Streptococcus pneumoniae (strain 70585) GN=trpC PE=3 SV=1 304 513 1.0E-38
sp|B1W0N8|TRPC_STRGG Indole-3-glycerol phosphate synthase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=trpC PE=3 SV=1 302 525 1.0E-38
sp|A5IG82|TRPC_LEGPC Indole-3-glycerol phosphate synthase OS=Legionella pneumophila (strain Corby) GN=trpC PE=3 SV=1 248 515 1.0E-38
sp|A0JVL1|TRPC_ARTS2 Indole-3-glycerol phosphate synthase OS=Arthrobacter sp. (strain FB24) GN=trpC PE=3 SV=1 304 501 1.0E-38
sp|P26922|TRPG_AZOBR Anthranilate synthase component 2 OS=Azospirillum brasilense GN=trpG PE=1 SV=1 27 216 2.0E-38
sp|A1KRV4|TRPC_NEIMF Indole-3-glycerol phosphate synthase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=trpC PE=3 SV=1 248 505 2.0E-38
sp|Q5WGS3|TRPC_BACSK Indole-3-glycerol phosphate synthase OS=Bacillus clausii (strain KSM-K16) GN=trpC PE=3 SV=1 250 515 2.0E-38
sp|C1CG44|TRPC_STRZJ Indole-3-glycerol phosphate synthase OS=Streptococcus pneumoniae (strain JJA) GN=trpC PE=3 SV=1 304 513 2.0E-38
sp|Q8DNM6|TRPC_STRR6 Indole-3-glycerol phosphate synthase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=trpC PE=3 SV=1 304 513 2.0E-38
sp|Q04IY7|TRPC_STRP2 Indole-3-glycerol phosphate synthase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=trpC PE=3 SV=1 304 513 2.0E-38
sp|Q9X7C7|TRPC_MYCLE Indole-3-glycerol phosphate synthase OS=Mycobacterium leprae (strain TN) GN=trpC PE=3 SV=1 302 525 2.0E-38
sp|B8ZRB9|TRPC_MYCLB Indole-3-glycerol phosphate synthase OS=Mycobacterium leprae (strain Br4923) GN=trpC PE=3 SV=1 302 525 2.0E-38
sp|A3PHK7|TRPC_RHOS1 Indole-3-glycerol phosphate synthase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=trpC PE=3 SV=1 304 505 2.0E-38
sp|B9KMV0|TRPC_RHOSK Indole-3-glycerol phosphate synthase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=trpC PE=3 SV=1 304 505 2.0E-38
sp|Q01999|TRPC_LACLA Indole-3-glycerol phosphate synthase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=trpC PE=3 SV=1 246 505 2.0E-38
sp|B1I7S9|TRPC_STRPI Indole-3-glycerol phosphate synthase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=trpC PE=3 SV=1 304 513 2.0E-38
sp|A4WX67|TRPC_RHOS5 Indole-3-glycerol phosphate synthase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=trpC PE=3 SV=1 304 505 3.0E-38
sp|P26938|TRPC_AZOBR Indole-3-glycerol phosphate synthase OS=Azospirillum brasilense GN=trpC PE=3 SV=1 248 505 3.0E-38
sp|A5GRL0|TRPC_SYNR3 Indole-3-glycerol phosphate synthase OS=Synechococcus sp. (strain RCC307) GN=trpC PE=3 SV=1 240 516 3.0E-38
sp|A9BS06|TRPC_DELAS Indole-3-glycerol phosphate synthase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=trpC PE=3 SV=1 304 513 4.0E-38
sp|O67657|TRPC_AQUAE Indole-3-glycerol phosphate synthase OS=Aquifex aeolicus (strain VF5) GN=trpC PE=3 SV=1 304 505 4.0E-38
sp|B2UDK9|TRPC_RALPJ Indole-3-glycerol phosphate synthase OS=Ralstonia pickettii (strain 12J) GN=trpC PE=3 SV=1 301 513 5.0E-38
sp|C5CBK6|TRPC_MICLC Indole-3-glycerol phosphate synthase OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=trpC PE=3 SV=1 265 502 5.0E-38
sp|A1R5S7|TRPC_ARTAT Indole-3-glycerol phosphate synthase OS=Arthrobacter aurescens (strain TC1) GN=trpC PE=3 SV=1 301 501 5.0E-38
sp|C5CKE4|TRPC_VARPS Indole-3-glycerol phosphate synthase OS=Variovorax paradoxus (strain S110) GN=trpC PE=3 SV=1 249 513 6.0E-38
sp|P9WFX7|TRPC_MYCTU Indole-3-glycerol phosphate synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=trpC PE=1 SV=1 302 525 8.0E-38
sp|A5U2W7|TRPC_MYCTA Indole-3-glycerol phosphate synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=trpC PE=3 SV=1 302 525 8.0E-38
sp|C1ANN3|TRPC_MYCBT Indole-3-glycerol phosphate synthase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=trpC PE=3 SV=1 302 525 8.0E-38
sp|A1KJ27|TRPC_MYCBP Indole-3-glycerol phosphate synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=trpC PE=3 SV=1 302 525 8.0E-38
sp|P0A633|TRPC_MYCBO Indole-3-glycerol phosphate synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=trpC PE=3 SV=1 302 525 8.0E-38
sp|P57855|TRPC_PASMU Tryptophan biosynthesis protein TrpCF OS=Pasteurella multocida (strain Pm70) GN=trpC PE=3 SV=1 303 741 8.0E-38
sp|P00911|TRPC_ACIAD Indole-3-glycerol phosphate synthase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=trpC PE=3 SV=2 285 513 9.0E-38
sp|A4JB67|TRPC_BURVG Indole-3-glycerol phosphate synthase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=trpC PE=3 SV=1 248 513 9.0E-38
sp|C1DHY7|TRPC_AZOVD Indole-3-glycerol phosphate synthase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=trpC PE=3 SV=1 249 513 9.0E-38
sp|Q5WY75|TRPC_LEGPL Indole-3-glycerol phosphate synthase OS=Legionella pneumophila (strain Lens) GN=trpC PE=3 SV=1 248 515 1.0E-37
sp|Q8DVF5|TRPC_STRMU Indole-3-glycerol phosphate synthase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=trpC PE=3 SV=1 277 514 1.0E-37
sp|Q8ZEG8|TRPC_YERPE Tryptophan biosynthesis protein TrpCF OS=Yersinia pestis GN=trpC PE=3 SV=1 304 741 1.0E-37
sp|P00900|TRPG_SERMA Anthranilate synthase component 2 OS=Serratia marcescens GN=trpG PE=1 SV=2 25 224 2.0E-37
sp|B0VBS1|TRPC_ACIBY Indole-3-glycerol phosphate synthase OS=Acinetobacter baumannii (strain AYE) GN=trpC PE=3 SV=1 304 504 2.0E-37
sp|A3M785|TRPC_ACIBT Indole-3-glycerol phosphate synthase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=trpC PE=3 SV=2 304 504 2.0E-37
sp|B7I441|TRPC_ACIB5 Indole-3-glycerol phosphate synthase OS=Acinetobacter baumannii (strain AB0057) GN=trpC PE=3 SV=1 304 504 2.0E-37
sp|Q8XS01|TRPC2_RALSO Indole-3-glycerol phosphate synthase 2 OS=Ralstonia solanacearum (strain GMI1000) GN=trpC2 PE=3 SV=1 302 503 2.0E-37
sp|B0VUS0|TRPC_ACIBS Indole-3-glycerol phosphate synthase OS=Acinetobacter baumannii (strain SDF) GN=trpC PE=3 SV=1 304 504 2.0E-37
sp|A6SUH5|TRPC_JANMA Indole-3-glycerol phosphate synthase OS=Janthinobacterium sp. (strain Marseille) GN=trpC PE=3 SV=1 304 513 2.0E-37
sp|C5BV85|TRPC_BEUC1 Indole-3-glycerol phosphate synthase OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=trpC PE=3 SV=1 302 501 2.0E-37
sp|P9WFX6|TRPC_MYCTO Indole-3-glycerol phosphate synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=trpC PE=3 SV=1 302 525 2.0E-37
sp|B2HVE7|TRPC_ACIBC Indole-3-glycerol phosphate synthase OS=Acinetobacter baumannii (strain ACICU) GN=trpC PE=3 SV=1 304 504 3.0E-37
sp|B1ZW79|TRPC_OPITP Indole-3-glycerol phosphate synthase OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=trpC PE=3 SV=1 281 513 3.0E-37
sp|Q46WU7|TRPC_CUPPJ Indole-3-glycerol phosphate synthase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=trpC PE=3 SV=1 248 513 3.0E-37
sp|A8FEK0|TRPC_BACP2 Indole-3-glycerol phosphate synthase OS=Bacillus pumilus (strain SAFR-032) GN=trpC PE=3 SV=1 302 504 3.0E-37
sp|Q8ZEG6|TRPG_YERPE Anthranilate synthase component 2 OS=Yersinia pestis GN=trpG PE=3 SV=1 25 224 5.0E-37
sp|B1YSF5|TRPC_BURA4 Indole-3-glycerol phosphate synthase OS=Burkholderia ambifaria (strain MC40-6) GN=trpC PE=3 SV=1 248 507 5.0E-37
sp|A4IQ84|TRPC_GEOTN Indole-3-glycerol phosphate synthase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=trpC PE=3 SV=1 304 505 5.0E-37
sp|B5ERI2|TRPC_ACIF5 Indole-3-glycerol phosphate synthase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=trpC PE=3 SV=1 248 507 6.0E-37
sp|B7JBC0|TRPC_ACIF2 Indole-3-glycerol phosphate synthase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=trpC PE=3 SV=1 248 507 6.0E-37
sp|P26923|TRPG_METTM Anthranilate synthase component 2 OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=trpG PE=3 SV=1 27 218 7.0E-37
sp|P13997|TRPF_KLULA N-(5'-phosphoribosyl)anthranilate isomerase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TRP1 PE=3 SV=1 530 758 7.0E-37
sp|Q1ISJ1|TRPC_KORVE Indole-3-glycerol phosphate synthase OS=Koribacter versatilis (strain Ellin345) GN=trpC PE=3 SV=1 302 513 7.0E-37
sp|Q0BIM8|TRPC_BURCM Indole-3-glycerol phosphate synthase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=trpC PE=3 SV=1 248 507 9.0E-37
sp|A4J147|TRPC_DESRM Indole-3-glycerol phosphate synthase OS=Desulfotomaculum reducens (strain MI-1) GN=trpC PE=3 SV=1 289 514 9.0E-37
sp|Q8X7B7|TRPC_ECO57 Tryptophan biosynthesis protein TrpCF OS=Escherichia coli O157:H7 GN=trpC PE=3 SV=3 303 741 1.0E-36
sp|A4XZC5|TRPC_PSEMY Indole-3-glycerol phosphate synthase OS=Pseudomonas mendocina (strain ymp) GN=trpC PE=3 SV=1 296 513 1.0E-36
sp|A1KAT2|TRPC_AZOSB Indole-3-glycerol phosphate synthase OS=Azoarcus sp. (strain BH72) GN=trpC PE=3 SV=1 248 507 1.0E-36
sp|P20577|TRPC_PSEAE Indole-3-glycerol phosphate synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=trpC PE=3 SV=1 291 513 1.0E-36
sp|B7V609|TRPC_PSEA8 Indole-3-glycerol phosphate synthase OS=Pseudomonas aeruginosa (strain LESB58) GN=trpC PE=3 SV=1 291 513 1.0E-36
sp|Q8AAD6|TRPC_BACTN Indole-3-glycerol phosphate synthase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=trpC PE=3 SV=1 248 507 2.0E-36
sp|Q5KXU9|TRPC_GEOKA Indole-3-glycerol phosphate synthase OS=Geobacillus kaustophilus (strain HTA426) GN=trpC PE=3 SV=1 290 505 2.0E-36
sp|Q02TB5|TRPC_PSEAB Indole-3-glycerol phosphate synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=trpC PE=3 SV=1 291 513 2.0E-36
sp|A6UZF2|TRPC_PSEA7 Indole-3-glycerol phosphate synthase OS=Pseudomonas aeruginosa (strain PA7) GN=trpC PE=3 SV=1 291 513 2.0E-36
sp|Q06121|TRPC_SULSO Indole-3-glycerol phosphate synthase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=trpC PE=1 SV=1 279 505 2.0E-36
sp|C5D3D6|TRPC_GEOSW Indole-3-glycerol phosphate synthase OS=Geobacillus sp. (strain WCH70) GN=trpC PE=3 SV=1 282 522 2.0E-36
sp|Q57690|TRPG_METJA Anthranilate synthase component 2 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=trpG PE=3 SV=1 27 219 3.0E-36
sp|Q48NP7|TRPC_PSE14 Indole-3-glycerol phosphate synthase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=trpC PE=3 SV=1 303 525 3.0E-36
sp|Q7TU64|TRPC_PROMP Indole-3-glycerol phosphate synthase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=trpC PE=3 SV=1 227 505 3.0E-36
sp|Q01128|TRPF_LIPST N-(5'-phosphoribosyl)anthranilate isomerase OS=Lipomyces starkeyi GN=TRP1 PE=3 SV=1 531 750 3.0E-36
sp|O27693|TRPG_METTH Anthranilate synthase component 2 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=trpG PE=3 SV=1 27 218 3.0E-36
sp|Q88A03|TRPC_PSESM Indole-3-glycerol phosphate synthase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=trpC PE=3 SV=1 249 525 3.0E-36
sp|Q8XVE6|TRPC1_RALSO Indole-3-glycerol phosphate synthase 1 OS=Ralstonia solanacearum (strain GMI1000) GN=trpC1 PE=3 SV=1 303 513 4.0E-36
sp|Q47QR5|TRPC_THEFY Indole-3-glycerol phosphate synthase OS=Thermobifida fusca (strain YX) GN=trpC PE=3 SV=1 302 501 4.0E-36
sp|P71381|TRPG_HAEIN Anthranilate synthase component 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=trpG PE=3 SV=1 25 213 5.0E-36
sp|A5EVG3|TRPC_DICNV Indole-3-glycerol phosphate synthase OS=Dichelobacter nodosus (strain VCS1703A) GN=trpC PE=3 SV=1 248 518 5.0E-36
sp|B7K0H0|TRPC_CYAP8 Indole-3-glycerol phosphate synthase OS=Cyanothece sp. (strain PCC 8801) GN=trpC PE=3 SV=1 303 513 5.0E-36
sp|Q8R9M7|TRPC_CALS4 Indole-3-glycerol phosphate synthase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=trpC PE=3 SV=1 302 516 6.0E-36
sp|Q65I33|TRPC_BACLD Indole-3-glycerol phosphate synthase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=trpC PE=3 SV=1 302 502 9.0E-36
sp|Q3K5V4|TRPC_PSEPF Indole-3-glycerol phosphate synthase OS=Pseudomonas fluorescens (strain Pf0-1) GN=trpC PE=3 SV=1 303 513 1.0E-35
sp|Q39JZ7|TRPC_BURL3 Indole-3-glycerol phosphate synthase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=trpC PE=3 SV=1 248 507 1.0E-35
sp|Q02584|TRPC_RHOCB Indole-3-glycerol phosphate synthase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=trpC PE=3 SV=2 248 505 1.0E-35
sp|A0K458|TRPC_BURCH Indole-3-glycerol phosphate synthase OS=Burkholderia cenocepacia (strain HI2424) GN=trpC PE=3 SV=1 248 507 2.0E-35
sp|B1JUU5|TRPC_BURCC Indole-3-glycerol phosphate synthase OS=Burkholderia cenocepacia (strain MC0-3) GN=trpC PE=3 SV=1 248 507 2.0E-35
sp|Q1BSD2|TRPC_BURCA Indole-3-glycerol phosphate synthase OS=Burkholderia cenocepacia (strain AU 1054) GN=trpC PE=3 SV=1 248 507 2.0E-35
sp|A4FLL0|TRPC_SACEN Indole-3-glycerol phosphate synthase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=trpC PE=3 SV=1 302 527 2.0E-35
sp|P00909|TRPC_ECOLI Tryptophan biosynthesis protein TrpCF OS=Escherichia coli (strain K12) GN=trpC PE=1 SV=4 303 741 3.0E-35
sp|B1JE34|TRPC_PSEPW Indole-3-glycerol phosphate synthase OS=Pseudomonas putida (strain W619) GN=trpC PE=3 SV=1 296 513 3.0E-35
sp|A5VBA0|TRPC_SPHWW Indole-3-glycerol phosphate synthase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=trpC PE=3 SV=1 248 516 6.0E-35
sp|P22101|TRPG_VIBPA Anthranilate synthase component 2 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=trpG PE=3 SV=1 25 214 7.0E-35
sp|Q5M348|TRPC_STRT2 Indole-3-glycerol phosphate synthase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=trpC PE=3 SV=1 295 513 7.0E-35
sp|Q5LYI5|TRPC_STRT1 Indole-3-glycerol phosphate synthase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=trpC PE=3 SV=1 295 513 7.0E-35
sp|Q2SUI0|TRPC_BURTA Indole-3-glycerol phosphate synthase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=trpC PE=3 SV=1 248 513 8.0E-35
sp|P9WN35|TRPG_MYCTU Anthranilate synthase component 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=trpG PE=1 SV=1 27 231 9.0E-35
sp|P9WN34|TRPG_MYCTO Anthranilate synthase component 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=trpG PE=3 SV=1 27 231 9.0E-35
sp|Q03JB9|TRPC_STRTD Indole-3-glycerol phosphate synthase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=trpC PE=3 SV=1 295 513 9.0E-35
sp|P20578|TRPC_PSEPU Indole-3-glycerol phosphate synthase OS=Pseudomonas putida GN=trpC PE=3 SV=1 296 525 1.0E-34
sp|A2BY04|TRPC_PROM5 Indole-3-glycerol phosphate synthase OS=Prochlorococcus marinus (strain MIT 9515) GN=trpC PE=3 SV=1 227 505 1.0E-34
sp|A9AJ43|TRPC_BURM1 Indole-3-glycerol phosphate synthase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=trpC PE=3 SV=1 248 507 1.0E-34
sp|Q319J2|TRPC_PROM9 Indole-3-glycerol phosphate synthase OS=Prochlorococcus marinus (strain MIT 9312) GN=trpC PE=3 SV=1 227 505 2.0E-34
sp|Q4K503|TRPC_PSEF5 Indole-3-glycerol phosphate synthase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=trpC PE=3 SV=1 303 507 2.0E-34
sp|Q88QR6|TRPC_PSEPK Indole-3-glycerol phosphate synthase OS=Pseudomonas putida (strain KT2440) GN=trpC PE=3 SV=1 296 513 2.0E-34
sp|A5VXL5|TRPC_PSEP1 Indole-3-glycerol phosphate synthase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=trpC PE=3 SV=1 296 513 2.0E-34
sp|A8G6A7|TRPC_PROM2 Indole-3-glycerol phosphate synthase OS=Prochlorococcus marinus (strain MIT 9215) GN=trpC PE=3 SV=1 227 505 2.0E-34
sp|B0CEU2|TRPC_ACAM1 Indole-3-glycerol phosphate synthase OS=Acaryochloris marina (strain MBIC 11017) GN=trpC PE=3 SV=1 249 502 3.0E-34
sp|P46451|TRPC_HAEIN Tryptophan biosynthesis protein TrpCF OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=trpC PE=3 SV=1 240 741 3.0E-34
sp|Q44696|TRPG_BUCAI Anthranilate synthase component 2 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=trpG PE=3 SV=2 25 228 3.0E-34
sp|Q9KST3|TRPG_VIBCH Anthranilate synthase component 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=trpG PE=3 SV=2 25 214 3.0E-34
sp|Q5V632|TRPG2_HALMA Anthranilate synthase component II OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=trpG2 PE=3 SV=1 27 215 3.0E-34
sp|C3K307|TRPC_PSEFS Indole-3-glycerol phosphate synthase OS=Pseudomonas fluorescens (strain SBW25) GN=trpC PE=3 SV=1 303 513 4.0E-34
sp|A2CB59|TRPC_PROM3 Indole-3-glycerol phosphate synthase OS=Prochlorococcus marinus (strain MIT 9303) GN=trpC PE=3 SV=1 245 519 4.0E-34
sp|A3NDZ3|TRPC_BURP6 Indole-3-glycerol phosphate synthase OS=Burkholderia pseudomallei (strain 668) GN=trpC PE=3 SV=1 248 513 4.0E-34
sp|Q4L677|TRPC_STAHJ Indole-3-glycerol phosphate synthase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=trpC PE=3 SV=1 301 513 4.0E-34
sp|A2BSL8|TRPC_PROMS Indole-3-glycerol phosphate synthase OS=Prochlorococcus marinus (strain AS9601) GN=trpC PE=3 SV=1 227 505 5.0E-34
sp|A0LJ58|TRPC_SYNFM Indole-3-glycerol phosphate synthase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=trpC PE=3 SV=1 302 513 5.0E-34
sp|Q1IFZ9|TRPC_PSEE4 Indole-3-glycerol phosphate synthase OS=Pseudomonas entomophila (strain L48) GN=trpC PE=3 SV=1 296 513 6.0E-34
sp|Q7VAT3|TRPC_PROMA Indole-3-glycerol phosphate synthase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=trpC PE=3 SV=1 240 513 6.0E-34
sp|Q63QH0|TRPC_BURPS Indole-3-glycerol phosphate synthase OS=Burkholderia pseudomallei (strain K96243) GN=trpC PE=3 SV=1 248 513 6.0E-34
sp|A3NZP6|TRPC_BURP0 Indole-3-glycerol phosphate synthase OS=Burkholderia pseudomallei (strain 1106a) GN=trpC PE=3 SV=1 248 513 6.0E-34
sp|Q7TV44|TRPC_PROMM Indole-3-glycerol phosphate synthase OS=Prochlorococcus marinus (strain MIT 9313) GN=trpC PE=3 SV=1 245 519 6.0E-34
sp|Q0RFX9|TRPC_FRAAA Indole-3-glycerol phosphate synthase OS=Frankia alni (strain ACN14a) GN=trpC PE=3 SV=1 249 499 7.0E-34
sp|A3PED0|TRPC_PROM0 Indole-3-glycerol phosphate synthase OS=Prochlorococcus marinus (strain MIT 9301) GN=trpC PE=3 SV=1 227 505 9.0E-34
sp|B0KK35|TRPC_PSEPG Indole-3-glycerol phosphate synthase OS=Pseudomonas putida (strain GB-1) GN=trpC PE=3 SV=1 296 525 9.0E-34
sp|Q8F7V2|TRPC_LEPIN Indole-3-glycerol phosphate synthase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=trpC PE=3 SV=1 303 505 1.0E-33
sp|Q72NP6|TRPC_LEPIC Indole-3-glycerol phosphate synthase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=trpC PE=3 SV=1 303 505 1.0E-33
sp|P32483|PABS_STRGR Para-aminobenzoate synthase OS=Streptomyces griseus GN=pab PE=3 SV=1 28 215 1.0E-33
sp|A0LA39|TRPC_MAGMM Indole-3-glycerol phosphate synthase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=trpC PE=3 SV=1 249 513 2.0E-33
sp|Q13TW4|TRPC_BURXL Indole-3-glycerol phosphate synthase OS=Burkholderia xenovorans (strain LB400) GN=trpC PE=3 SV=1 248 513 2.0E-33
sp|Q3JNB0|TRPC_BURP1 Indole-3-glycerol phosphate synthase OS=Burkholderia pseudomallei (strain 1710b) GN=trpC PE=3 SV=1 303 513 2.0E-33
sp|A1WH73|TRPC_VEREI Indole-3-glycerol phosphate synthase OS=Verminephrobacter eiseniae (strain EF01-2) GN=trpC PE=3 SV=1 303 513 2.0E-33
sp|A1UWA0|TRPC_BURMS Indole-3-glycerol phosphate synthase OS=Burkholderia mallei (strain SAVP1) GN=trpC PE=3 SV=1 248 513 2.0E-33
sp|Q62DD0|TRPC_BURMA Indole-3-glycerol phosphate synthase OS=Burkholderia mallei (strain ATCC 23344) GN=trpC PE=3 SV=1 248 513 2.0E-33
sp|A2RYI3|TRPC_BURM9 Indole-3-glycerol phosphate synthase OS=Burkholderia mallei (strain NCTC 10229) GN=trpC PE=3 SV=1 248 513 2.0E-33
sp|A3MFQ4|TRPC_BURM7 Indole-3-glycerol phosphate synthase OS=Burkholderia mallei (strain NCTC 10247) GN=trpC PE=3 SV=1 248 513 2.0E-33
sp|Q89A30|TRPG_BUCBP Anthranilate synthase component 2 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=trpG PE=3 SV=1 26 217 4.0E-33
sp|A6TM74|TRPC_ALKMQ Indole-3-glycerol phosphate synthase OS=Alkaliphilus metalliredigens (strain QYMF) GN=trpC PE=3 SV=1 302 516 4.0E-33
sp|P42388|TRPG_BUCAP Anthranilate synthase component 2 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=trpG PE=3 SV=1 25 217 4.0E-33
sp|Q9YGB2|TRPG_THEKO Anthranilate synthase component 2 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=trpG PE=3 SV=1 27 218 7.0E-33
sp|Q7NHI0|TRPC_GLOVI Indole-3-glycerol phosphate synthase OS=Gloeobacter violaceus (strain PCC 7421) GN=trpC PE=3 SV=1 249 517 7.0E-33
sp|Q5N575|TRPC_SYNP6 Indole-3-glycerol phosphate synthase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=trpC PE=3 SV=1 295 513 1.0E-32
sp|Q8KPR4|TRPC_SYNE7 Indole-3-glycerol phosphate synthase OS=Synechococcus elongatus (strain PCC 7942) GN=trpC PE=3 SV=2 295 513 1.0E-32
sp|Q9Z4X0|TRPC2_STRCO Indole-3-glycerol phosphate synthase 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trpC2 PE=3 SV=1 284 513 3.0E-32
sp|Q2RT48|TRPC_RHORT Indole-3-glycerol phosphate synthase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=trpC PE=3 SV=1 248 513 4.0E-32
sp|Q06129|TRPG_SULSO Anthranilate synthase component 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=trpG PE=1 SV=2 28 217 4.0E-32
sp|O68427|TRPC_BUCDN Tryptophan biosynthesis protein TrpCF OS=Buchnera aphidicola subsp. Diuraphis noxia GN=trpC PE=3 SV=1 303 741 4.0E-32
sp|Q02003|TRPG_LACLA Anthranilate synthase component 2 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=trpG PE=3 SV=1 27 217 5.0E-32
sp|B2SZ04|TRPC_BURPP Indole-3-glycerol phosphate synthase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=trpC PE=3 SV=1 248 513 7.0E-32
sp|A7Z618|TRPC_BACMF Indole-3-glycerol phosphate synthase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=trpC PE=3 SV=1 302 502 1.0E-31
sp|A4VHK1|TRPC_PSEU5 Indole-3-glycerol phosphate synthase OS=Pseudomonas stutzeri (strain A1501) GN=trpC PE=3 SV=1 303 513 1.0E-31
sp|P26939|TRPC_METTM Indole-3-glycerol phosphate synthase OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=trpC PE=3 SV=1 302 520 2.0E-31
sp|O25867|TRPC_HELPY Tryptophan biosynthesis protein TrpCF OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=trpC PE=3 SV=1 303 741 2.0E-31
sp|A5GMK4|TRPC_SYNPW Indole-3-glycerol phosphate synthase OS=Synechococcus sp. (strain WH7803) GN=trpC PE=3 SV=1 248 502 3.0E-31
sp|P70937|TRPC_BACMQ Indole-3-glycerol phosphate synthase OS=Bacillus megaterium (strain ATCC 12872 / QMB1551) GN=trpC PE=3 SV=1 301 520 4.0E-31
sp|A9BHQ5|TRPC_PETMO Indole-3-glycerol phosphate synthase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=trpC PE=3 SV=1 302 513 4.0E-31
sp|P42393|TRPC_BUCAP Tryptophan biosynthesis protein TrpCF OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=trpC PE=3 SV=1 297 742 6.0E-31
sp|P57366|TRPC_BUCAI Tryptophan biosynthesis protein TrpCF OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=trpC PE=3 SV=1 303 759 7.0E-31
sp|B8HP79|TRPC_CYAP4 Indole-3-glycerol phosphate synthase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=trpC PE=3 SV=1 245 502 1.0E-30
sp|Q49XH6|TRPC_STAS1 Indole-3-glycerol phosphate synthase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=trpC PE=3 SV=1 302 510 1.0E-30
sp|P03964|TRPC_BACSU Indole-3-glycerol phosphate synthase OS=Bacillus subtilis (strain 168) GN=trpC PE=3 SV=3 302 502 2.0E-30
sp|Q972A1|TRPC_SULTO Indole-3-glycerol phosphate synthase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=trpC PE=3 SV=1 287 505 2.0E-30
sp|Q5XQP9|TRPF_SACK1 N-(5'-phosphoribosyl)anthranilate isomerase OS=Saccharomyces kudriavzevii (strain ATCC MYA-4449 / AS 2.2408 / CBS 8840 / NBRC 1802 / NCYC 2889) GN=TRP1 PE=3 SV=1 532 759 3.0E-30
sp|Q8CPB2|TRPC_STAES Indole-3-glycerol phosphate synthase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=trpC PE=3 SV=1 302 513 3.0E-30
sp|P49572|TRPC_ARATH Indole-3-glycerol phosphate synthase, chloroplastic OS=Arabidopsis thaliana GN=At2g04400 PE=2 SV=2 249 509 3.0E-30
sp|Q5HPH2|TRPC_STAEQ Indole-3-glycerol phosphate synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=trpC PE=3 SV=1 302 513 5.0E-30
sp|P18304|TRPC_HALVD Indole-3-glycerol phosphate synthase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=trpC PE=3 SV=1 302 501 8.0E-30
sp|O19914|TRPG_CYACA Anthranilate synthase component 2 OS=Cyanidium caldarium GN=trpG PE=3 SV=1 27 221 8.0E-30
sp|Q9ZJU8|TRPC_HELPJ Tryptophan biosynthesis protein TrpCF OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=trpC PE=3 SV=1 277 741 1.0E-29
sp|Q56319|TRPC_THEMA Indole-3-glycerol phosphate synthase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=trpC PE=1 SV=3 302 513 2.0E-29
sp|O28670|TRPG_ARCFU Anthranilate synthase component 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=trpG PE=3 SV=1 27 218 3.0E-29
sp|Q4J8X3|TRPC_SULAC Indole-3-glycerol phosphate synthase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=trpC PE=3 SV=1 304 502 3.0E-29
sp|O13504|TRPF_PICPA N-(5'-phosphoribosyl)anthranilate isomerase OS=Komagataella pastoris GN=TRP1 PE=3 SV=1 531 758 5.0E-29
sp|A6QGS2|TRPC_STAAE Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain Newman) GN=trpC PE=3 SV=1 302 513 5.0E-29
sp|Q9RL78|TRPC_STAAC Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain COL) GN=trpC PE=3 SV=1 302 513 5.0E-29
sp|P27627|PABA_STRLI Aminodeoxychorismate synthase component 2 OS=Streptomyces lividans PE=3 SV=1 25 217 6.0E-29
sp|Q8NWU3|TRPC_STAAW Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain MW2) GN=trpC PE=3 SV=1 302 513 1.0E-28
sp|A8Z242|TRPC_STAAT Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=trpC PE=3 SV=1 302 513 1.0E-28
sp|Q6G9I9|TRPC_STAAS Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain MSSA476) GN=trpC PE=3 SV=1 302 513 1.0E-28
sp|Q2FYR6|TRPC_STAA8 Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain NCTC 8325) GN=trpC PE=3 SV=1 302 513 1.0E-28
sp|Q2FH66|TRPC_STAA3 Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain USA300) GN=trpC PE=3 SV=1 302 513 1.0E-28
sp|P50857|TRPF_CANGA N-(5'-phosphoribosyl)anthranilate isomerase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TRP1 PE=3 SV=2 527 759 2.0E-28
sp|P09786|PHNB_PSEAE Anthranilate synthase component 2, pyocyanine specific OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=phnB PE=1 SV=3 27 230 2.0E-28
sp|P00912|TRPF_YEAST N-(5'-phosphoribosyl)anthranilate isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRP1 PE=1 SV=2 531 759 2.0E-28
sp|Q6GH35|TRPC_STAAR Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain MRSA252) GN=trpC PE=3 SV=1 302 513 4.0E-28
sp|P66991|TRPC_STAAN Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain N315) GN=trpC PE=3 SV=1 302 513 5.0E-28
sp|P66990|TRPC_STAAM Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=trpC PE=3 SV=1 302 513 5.0E-28
sp|A5ISQ2|TRPC_STAA9 Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain JH9) GN=trpC PE=3 SV=1 302 513 5.0E-28
sp|A6U1J2|TRPC_STAA2 Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain JH1) GN=trpC PE=3 SV=1 302 513 5.0E-28
sp|A7X234|TRPC_STAA1 Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=trpC PE=3 SV=1 302 513 5.0E-28
sp|Q0C1A2|TRPC_HYPNA Indole-3-glycerol phosphate synthase OS=Hyphomonas neptunium (strain ATCC 15444) GN=trpC PE=3 SV=1 303 502 5.0E-28
sp|Q2YXU9|TRPC_STAAB Indole-3-glycerol phosphate synthase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=trpC PE=3 SV=1 302 513 8.0E-28
sp|Q0IC57|TRPC_SYNS3 Indole-3-glycerol phosphate synthase OS=Synechococcus sp. (strain CC9311) GN=trpC PE=3 SV=1 248 516 1.0E-27
sp|P59459|TRPC_BUCBP Tryptophan biosynthesis protein TrpCF OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=trpC PE=3 SV=1 287 759 3.0E-27
sp|A4YHD8|TRPC_METS5 Indole-3-glycerol phosphate synthase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=trpC PE=3 SV=1 288 516 4.0E-27
sp|Q9ZJU6|TRPG_HELPJ Anthranilate synthase component 2 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=trpG PE=3 SV=1 27 213 5.0E-27
sp|Q875I3|TRPF_WICAO N-(5'-phosphoribosyl)anthranilate isomerase OS=Wickerhamomyces anomalus GN=TRP1 PE=3 SV=1 530 758 7.0E-27
sp|Q8TVJ8|TRPC_METKA Indole-3-glycerol phosphate synthase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=trpC PE=3 SV=1 302 518 2.0E-26
sp|O25868|TRPG_HELPY Anthranilate synthase component 2 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=trpG PE=3 SV=1 27 212 4.0E-26
sp|P50872|TRPE_AZOBR Anthranilate synthase OS=Azospirillum brasilense GN=trpE(G) PE=3 SV=1 18 208 7.0E-26
sp|O27694|TRPC_METTH Indole-3-glycerol phosphate synthase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=trpC PE=3 SV=1 302 520 9.0E-26
sp|A2C462|TRPC_PROM1 Indole-3-glycerol phosphate synthase OS=Prochlorococcus marinus (strain NATL1A) GN=trpC PE=3 SV=1 245 523 1.0E-25
sp|Q46JH4|TRPC_PROMT Indole-3-glycerol phosphate synthase OS=Prochlorococcus marinus (strain NATL2A) GN=trpC PE=3 SV=1 245 505 1.0E-25
sp|Q9HFW8|TRPF_ZYGBA N-(5'-phosphoribosyl)anthranilate isomerase OS=Zygosaccharomyces bailii GN=TRP1 PE=3 SV=1 530 759 1.0E-25
sp|Q9HSC1|TRPC_HALSA Indole-3-glycerol phosphate synthase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=trpC PE=3 SV=1 304 504 2.0E-25
sp|P06560|TRPC_CORGL Tryptophan biosynthesis protein TrpCF OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=trpC PE=3 SV=2 291 741 6.0E-25
sp|Q6TAS3|ADCS_SOLLC Aminodeoxychorismate synthase, chloroplastic OS=Solanum lycopersicum GN=ADCS PE=2 SV=1 16 262 8.0E-25
sp|P06558|TRPG_CORGL Anthranilate synthase component 2 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=trpG PE=3 SV=2 25 208 2.0E-24
sp|Q58328|TRPC_METJA Indole-3-glycerol phosphate synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=trpC PE=3 SV=1 250 505 2.0E-24
sp|Q5V138|TRPC_HALMA Indole-3-glycerol phosphate synthase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=trpC PE=3 SV=1 304 501 3.0E-24
sp|P14952|TRPG_CLOTM Anthranilate synthase component 2 (Fragment) OS=Clostridium thermocellum GN=trpG PE=3 SV=1 26 111 5.0E-24
sp|Q02002|TRPF_LACLA N-(5'-phosphoribosyl)anthranilate isomerase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=trpF PE=3 SV=1 532 758 7.0E-24
sp|Q9YGB5|TRPC_THEKO Indole-3-glycerol phosphate synthase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=trpC PE=3 SV=2 291 513 1.0E-23
sp|P15395|TRPE_RHIME Anthranilate synthase OS=Rhizobium meliloti (strain 1021) GN=trpE(G) PE=3 SV=1 26 216 3.0E-23
sp|Q8ESU3|TRPF_OCEIH N-(5'-phosphoribosyl)anthranilate isomerase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=trpF PE=3 SV=1 530 755 5.0E-23
sp|P43073|TRPF_CANAL N-(5'-phosphoribosyl)anthranilate isomerase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TRP1 PE=3 SV=2 532 760 5.0E-23
sp|Q9Y8T7|TRPC_AERPE Indole-3-glycerol phosphate synthase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=trpC PE=3 SV=1 303 504 2.0E-22
sp|Q8LPN3|ADCS_ARATH Aminodeoxychorismate synthase, chloroplastic OS=Arabidopsis thaliana GN=ADCS PE=1 SV=1 28 224 4.0E-21
sp|B1YBK5|TRPC_PYRNV Indole-3-glycerol phosphate synthase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=trpC PE=3 SV=1 301 504 5.0E-21
sp|Q9V1G3|TRPC_PYRAB Indole-3-glycerol phosphate synthase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=trpC PE=3 SV=1 292 505 1.0E-20
sp|Q9RUG0|TRPC_DEIRA Indole-3-glycerol phosphate synthase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=trpC PE=3 SV=1 295 500 2.0E-20
sp|Q8ZYX2|TRPC_PYRAE Indole-3-glycerol phosphate synthase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=trpC PE=3 SV=1 287 513 8.0E-20
sp|A4WN19|TRPC_PYRAR Indole-3-glycerol phosphate synthase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=trpC PE=3 SV=1 301 504 1.0E-19
sp|Q757J9|TRPF_ASHGO N-(5'-phosphoribosyl)anthranilate isomerase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TRP1 PE=3 SV=1 533 761 2.0E-19
sp|Q3ZZ13|TRPF_DEHMC N-(5'-phosphoribosyl)anthranilate isomerase OS=Dehalococcoides mccartyi (strain CBDB1) GN=trpF PE=3 SV=1 533 759 4.0E-19
sp|Q3Z6G4|TRPF_DEHM1 N-(5'-phosphoribosyl)anthranilate isomerase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=trpF PE=3 SV=1 533 759 4.0E-19
sp|P44339|Y1171_HAEIN Putative anthranilate synthase component II OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1171 PE=3 SV=1 27 216 5.0E-19
sp|Q5Z856|ADCS_ORYSJ Probable aminodeoxychorismate synthase, chloroplastic OS=Oryza sativa subsp. japonica GN=ADCS PE=2 SV=1 28 215 5.0E-19
sp|Q8U088|TRPC_PYRFU Indole-3-glycerol phosphate synthase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=trpC PE=3 SV=1 292 505 1.0E-18
sp|P17218|TRPF_LACCA N-(5'-phosphoribosyl)anthranilate isomerase OS=Lactobacillus casei GN=trpF PE=3 SV=1 530 759 1.0E-17
sp|Q56320|TRPF_THEMA N-(5'-phosphoribosyl)anthranilate isomerase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=trpF PE=1 SV=1 532 761 4.0E-17
sp|Q03CY2|TRPF_LACC3 N-(5'-phosphoribosyl)anthranilate isomerase OS=Lactobacillus casei (strain ATCC 334) GN=trpF PE=3 SV=1 530 759 6.0E-17
sp|B1LA13|TRPF_THESQ N-(5'-phosphoribosyl)anthranilate isomerase OS=Thermotoga sp. (strain RQ2) GN=trpF PE=3 SV=1 532 761 7.0E-17
sp|A5IKT2|TRPF_THEP1 N-(5'-phosphoribosyl)anthranilate isomerase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=trpF PE=3 SV=1 532 761 7.0E-17
sp|O94277|PABS_SCHPO Putative aminodeoxychorismate synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP8B7.29 PE=3 SV=1 27 218 7.0E-17
sp|B3W6W7|TRPF_LACCB N-(5'-phosphoribosyl)anthranilate isomerase OS=Lactobacillus casei (strain BL23) GN=trpF PE=3 SV=1 530 759 9.0E-17
sp|Q8TXV8|GUAAA_METKA GMP synthase [glutamine-hydrolyzing] subunit A OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=guaAA PE=3 SV=1 27 220 8.0E-16
sp|Q67PJ5|TRPF_SYMTH N-(5'-phosphoribosyl)anthranilate isomerase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=trpF PE=3 SV=1 530 761 3.0E-15
sp|Q2RIT8|TRPF_MOOTA N-(5'-phosphoribosyl)anthranilate isomerase OS=Moorella thermoacetica (strain ATCC 39073) GN=trpF PE=3 SV=1 532 759 6.0E-15
sp|Q39SQ9|TRPF_GEOMG N-(5'-phosphoribosyl)anthranilate isomerase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=trpF PE=3 SV=1 532 760 7.0E-15
sp|A5UK20|GUAAA_METS3 GMP synthase [glutamine-hydrolyzing] subunit A OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=guaAA PE=3 SV=1 57 215 2.0E-14
sp|Q8DVF4|TRPF_STRMU N-(5'-phosphoribosyl)anthranilate isomerase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=trpF PE=3 SV=1 532 759 2.0E-14
sp|B8DHB3|TRPF_LISMH N-(5'-phosphoribosyl)anthranilate isomerase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=trpF PE=3 SV=1 530 761 3.0E-14
sp|Q8Y6Q5|TRPF_LISMO N-(5'-phosphoribosyl)anthranilate isomerase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=trpF PE=3 SV=1 530 761 4.0E-14
sp|A8AW04|TRPF_STRGC N-(5'-phosphoribosyl)anthranilate isomerase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=trpF PE=3 SV=1 532 759 7.0E-14
sp|Q2NER5|GUAAA_METST GMP synthase [glutamine-hydrolyzing] subunit A OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=guaAA PE=3 SV=1 26 215 7.0E-14
sp|O28668|TRPCD_ARCFU Tryptophan biosynthesis protein TrpCD OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=trpCD PE=3 SV=1 303 518 8.0E-14
sp|Q92B80|TRPF_LISIN N-(5'-phosphoribosyl)anthranilate isomerase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=trpF PE=3 SV=1 530 761 1.0E-13
sp|O59071|GUAAA_PYRHO GMP synthase [glutamine-hydrolyzing] subunit A OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=guaAA PE=1 SV=1 27 220 1.0E-13
sp|Q71Z39|TRPF_LISMF N-(5'-phosphoribosyl)anthranilate isomerase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=trpF PE=3 SV=1 530 761 2.0E-13
sp|B1I3Z6|TRPF_DESAP N-(5'-phosphoribosyl)anthranilate isomerase OS=Desulforudis audaxviator (strain MP104C) GN=trpF PE=3 SV=1 531 759 2.0E-13
sp|C1KVS6|TRPF_LISMC N-(5'-phosphoribosyl)anthranilate isomerase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=trpF PE=3 SV=1 530 761 2.0E-13
sp|Q6L277|TRPC_PICTO Indole-3-glycerol phosphate synthase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=trpC PE=3 SV=1 302 501 2.0E-13
sp|A0AJ81|TRPF_LISW6 N-(5'-phosphoribosyl)anthranilate isomerase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=trpF PE=3 SV=1 530 761 3.0E-13
sp|Q8R9M8|TRPF_CALS4 N-(5'-phosphoribosyl)anthranilate isomerase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=trpF PE=3 SV=1 532 761 3.0E-13
sp|Q9HK02|TRPC_THEAC Indole-3-glycerol phosphate synthase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=trpC PE=3 SV=1 303 502 5.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0004425 indole-3-glycerol-phosphate synthase activity Yes
GO:0006568 tryptophan metabolic process Yes
GO:0016787 hydrolase activity Yes
GO:0004640 phosphoribosylanthranilate isomerase activity Yes
GO:0019752 carboxylic acid metabolic process No
GO:0016861 intramolecular oxidoreductase activity, interconverting aldoses and ketoses No
GO:0016829 lyase activity No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009072 aromatic amino acid family metabolic process No
GO:0016831 carboxy-lyase activity No
GO:0043436 oxoacid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0016830 carbon-carbon lyase activity No
GO:0006586 indolalkylamine metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044106 cellular amine metabolic process No
GO:0006576 cellular biogenic amine metabolic process No
GO:1901605 alpha-amino acid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044281 small molecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:0016853 isomerase activity No
GO:0016860 intramolecular oxidoreductase activity No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006520 cellular amino acid metabolic process No
GO:0003674 molecular_function No
GO:0042430 indole-containing compound metabolic process No
GO:0009308 amine metabolic process No
GO:0006807 nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|792
MPSSLDIIDHSPHQPEPSPPIPTASNLILIDNYDSFTWNIYQYLVLEGATVHVFRNDQISLQELISKNPTQLIIS
PGPGHPTTDSGISRDAIRHFAGKIPVFGVCMGLQCIFDVYGGDVNSAGEWLHGKTSPLTHDSRGVFAGLEQNLPV
TRYHSLAGTHVTLPDCLEITSWVAKADGSPGIIQGVRHKQLTVEGVQFHPESILTSQGRRMIRNFLHMQGGTWAE
NEKLQKAAPLNGPPIAQDKAKGNNILQRIYASRRAAVAAQKEIPSQRMADLLAAYRLNAAPPLVPLVRRLRQSPF
DVALMAEIKRASPSKGVFALDMDAPTQARKYALAGASVISVLTEPEWFKGSIEDLRSVRQVLDGMPNRPAILRKE
FIFDEYQILEARLAGADTVLLIVKMLEPEALKRLYEYSLSLGMEPLVEVQNGQEMTTAVELGSRVIGVNNRNLES
FEVDLDTTGRLRGMVPEGTLLCALSGINSHKDVLMNKRDGVNAVLVGEAIMRAPDAGVFISELCSGTKQAAGTQP
PKAPLFVKICGTRSVEAAHEAIKSKADFIGICLVPGAKRCISHETALGISDAVHSCSGTTSEARGQMSSSSATDY
FTAAGWRLESHRPRLVGIFQNQPLSEVLQMQRTYQLDVVQLHGDEPIEWSRQIPVPVIRCFKPGQVGIGLRGYHT
IPLLDSGSGSGKLLDVSSVRAALETDPDLRVFLAGGLNPENVAAAVTALGQLGERVLGVDVSSGVEEDGKQSLAK
IKAFVEAAKAIR*
Coding >Ophun1|792
ATGCCGTCTTCTCTCGATATCATCGATCACTCTCCCCATCAGCCGGAGCCGTCACCTCCAATCCCTACGGCGTCC
AACCTGATCCTGATCGACAACTACGACTCCTTCACCTGGAACATCTATCAGTACCTCGTCCTCGAGGGAGCTACC
GTTCATGTCTTCCGTAACGATCAGATCAGCTTGCAGGAGCTCATCAGCAAGAACCCAACGCAGCTCATCATCAGC
CCCGGCCCAGGCCATCCCACGACCGACTCGGGCATCAGCCGAGATGCCATCCGCCACTTTGCGGGAAAGATCCCC
GTTTTTGGCGTCTGCATGGGCCTGCAATGCATCTTTGATGTTTACGGCGGGGACGTCAACTCTGCCGGAGAGTGG
CTGCACGGCAAAACGTCGCCCCTGACGCACGATAGCAGGGGTGTCTTTGCCGGTCTGGAGCAGAATCTACCGGTG
ACGAGATATCACTCCCTCGCGGGCACTCACGTCACATTGCCGGACTGCCTGGAGATTACTTCGTGGGTTGCCAAG
GCTGACGGCTCGCCAGGCATCATCCAGGGTGTCCGTCACAAGCAGCTCACTGTCGAGGGGGTTCAGTTTCACCCA
GAGAGTATCCTCACGTCTCAGGGACGAAGAATGATACGCAACTTTCTGCACATGCAAGGGGGCACCTGGGCGGAA
AACGAGAAGCTGCAGAAAGCCGCGCCGCTCAACGGTCCCCCCATTGCGCAGGACAAGGCAAAGGGCAACAACATA
CTGCAGCGGATATACGCCAGCCGCAGGGCTGCCGTTGCCGCCCAAAAGGAGATTCCCTCACAACGGATGGCCGAT
TTACTGGCAGCCTATCGCCTCAACGCGGCGCCTCCTCTTGTTCCGCTGGTGAGGCGTCTACGGCAGTCGCCTTTT
GACGTGGCTCTCATGGCCGAGATCAAGCGTGCGTCCCCTTCAAAGGGCGTGTTTGCGCTCGACATGGACGCTCCG
ACTCAGGCGCGCAAGTACGCCTTGGCCGGAGCCAGCGTCATCTCAGTCCTCACAGAGCCGGAATGGTTCAAGGGG
AGCATTGAGGATCTGCGCTCCGTCCGCCAGGTGCTGGACGGGATGCCCAATAGGCCAGCTATTCTACGCAAGGAG
TTCATCTTTGACGAGTACCAGATCCTGGAGGCCAGACTTGCAGGCGCCGACACCGTCTTGCTCATCGTCAAGATG
CTGGAGCCGGAAGCTCTCAAGCGCCTCTACGAATACTCGCTGTCGCTGGGGATGGAGCCGCTCGTCGAGGTTCAA
AACGGCCAAGAGATGACGACGGCCGTCGAGTTGGGATCCAGGGTCATCGGCGTCAACAACCGCAACCTGGAGAGC
TTCGAAGTCGATCTCGATACCACAGGCCGGCTGAGGGGCATGGTGCCGGAGGGCACACTGCTCTGCGCTCTCAGC
GGCATCAACAGCCACAAAGACGTGCTGATGAACAAGAGAGATGGAGTCAACGCAGTCCTCGTCGGCGAGGCCATC
ATGCGAGCGCCGGACGCCGGCGTCTTCATCAGCGAGCTCTGCTCAGGCACGAAACAGGCAGCCGGGACGCAGCCT
CCCAAAGCACCGCTCTTCGTCAAGATCTGCGGAACGCGGTCGGTGGAGGCCGCGCACGAGGCCATCAAGTCCAAG
GCCGACTTTATTGGCATCTGCCTGGTGCCCGGAGCGAAGCGCTGTATCAGCCACGAGACGGCACTCGGGATTTCT
GACGCTGTTCATTCGTGCTCAGGAACTACTTCTGAGGCGCGAGGACAGATGTCCAGCTCCAGCGCGACAGATTAC
TTTACGGCCGCCGGCTGGAGACTCGAAAGTCACCGGCCTCGTCTGGTAGGCATCTTCCAGAACCAGCCGCTGAGC
GAGGTACTGCAGATGCAAAGAACCTACCAGCTCGACGTCGTTCAACTCCACGGAGACGAGCCCATCGAGTGGTCG
AGGCAAATTCCCGTGCCGGTGATCCGCTGCTTCAAGCCAGGCCAAGTCGGCATCGGCCTCCGCGGCTACCACACC
ATCCCGCTCCTCGACTCCGGCTCCGGCTCAGGCAAGCTCCTAGACGTGTCGAGCGTCCGGGCCGCGCTGGAGACG
GACCCGGATTTGAGGGTGTTCCTGGCGGGCGGGTTGAATCCCGAGAACGTGGCCGCGGCGGTGACGGCGCTTGGC
CAGCTTGGAGAGCGAGTGCTGGGCGTCGACGTCAGCAGCGGAGTCGAGGAGGATGGGAAGCAGAGCTTGGCCAAG
ATAAAGGCCTTTGTCGAGGCGGCCAAGGCGATTCGATAG
Transcript >Ophun1|792
ATGCCGTCTTCTCTCGATATCATCGATCACTCTCCCCATCAGCCGGAGCCGTCACCTCCAATCCCTACGGCGTCC
AACCTGATCCTGATCGACAACTACGACTCCTTCACCTGGAACATCTATCAGTACCTCGTCCTCGAGGGAGCTACC
GTTCATGTCTTCCGTAACGATCAGATCAGCTTGCAGGAGCTCATCAGCAAGAACCCAACGCAGCTCATCATCAGC
CCCGGCCCAGGCCATCCCACGACCGACTCGGGCATCAGCCGAGATGCCATCCGCCACTTTGCGGGAAAGATCCCC
GTTTTTGGCGTCTGCATGGGCCTGCAATGCATCTTTGATGTTTACGGCGGGGACGTCAACTCTGCCGGAGAGTGG
CTGCACGGCAAAACGTCGCCCCTGACGCACGATAGCAGGGGTGTCTTTGCCGGTCTGGAGCAGAATCTACCGGTG
ACGAGATATCACTCCCTCGCGGGCACTCACGTCACATTGCCGGACTGCCTGGAGATTACTTCGTGGGTTGCCAAG
GCTGACGGCTCGCCAGGCATCATCCAGGGTGTCCGTCACAAGCAGCTCACTGTCGAGGGGGTTCAGTTTCACCCA
GAGAGTATCCTCACGTCTCAGGGACGAAGAATGATACGCAACTTTCTGCACATGCAAGGGGGCACCTGGGCGGAA
AACGAGAAGCTGCAGAAAGCCGCGCCGCTCAACGGTCCCCCCATTGCGCAGGACAAGGCAAAGGGCAACAACATA
CTGCAGCGGATATACGCCAGCCGCAGGGCTGCCGTTGCCGCCCAAAAGGAGATTCCCTCACAACGGATGGCCGAT
TTACTGGCAGCCTATCGCCTCAACGCGGCGCCTCCTCTTGTTCCGCTGGTGAGGCGTCTACGGCAGTCGCCTTTT
GACGTGGCTCTCATGGCCGAGATCAAGCGTGCGTCCCCTTCAAAGGGCGTGTTTGCGCTCGACATGGACGCTCCG
ACTCAGGCGCGCAAGTACGCCTTGGCCGGAGCCAGCGTCATCTCAGTCCTCACAGAGCCGGAATGGTTCAAGGGG
AGCATTGAGGATCTGCGCTCCGTCCGCCAGGTGCTGGACGGGATGCCCAATAGGCCAGCTATTCTACGCAAGGAG
TTCATCTTTGACGAGTACCAGATCCTGGAGGCCAGACTTGCAGGCGCCGACACCGTCTTGCTCATCGTCAAGATG
CTGGAGCCGGAAGCTCTCAAGCGCCTCTACGAATACTCGCTGTCGCTGGGGATGGAGCCGCTCGTCGAGGTTCAA
AACGGCCAAGAGATGACGACGGCCGTCGAGTTGGGATCCAGGGTCATCGGCGTCAACAACCGCAACCTGGAGAGC
TTCGAAGTCGATCTCGATACCACAGGCCGGCTGAGGGGCATGGTGCCGGAGGGCACACTGCTCTGCGCTCTCAGC
GGCATCAACAGCCACAAAGACGTGCTGATGAACAAGAGAGATGGAGTCAACGCAGTCCTCGTCGGCGAGGCCATC
ATGCGAGCGCCGGACGCCGGCGTCTTCATCAGCGAGCTCTGCTCAGGCACGAAACAGGCAGCCGGGACGCAGCCT
CCCAAAGCACCGCTCTTCGTCAAGATCTGCGGAACGCGGTCGGTGGAGGCCGCGCACGAGGCCATCAAGTCCAAG
GCCGACTTTATTGGCATCTGCCTGGTGCCCGGAGCGAAGCGCTGTATCAGCCACGAGACGGCACTCGGGATTTCT
GACGCTGTTCATTCGTGCTCAGGAACTACTTCTGAGGCGCGAGGACAGATGTCCAGCTCCAGCGCGACAGATTAC
TTTACGGCCGCCGGCTGGAGACTCGAAAGTCACCGGCCTCGTCTGGTAGGCATCTTCCAGAACCAGCCGCTGAGC
GAGGTACTGCAGATGCAAAGAACCTACCAGCTCGACGTCGTTCAACTCCACGGAGACGAGCCCATCGAGTGGTCG
AGGCAAATTCCCGTGCCGGTGATCCGCTGCTTCAAGCCAGGCCAAGTCGGCATCGGCCTCCGCGGCTACCACACC
ATCCCGCTCCTCGACTCCGGCTCCGGCTCAGGCAAGCTCCTAGACGTGTCGAGCGTCCGGGCCGCGCTGGAGACG
GACCCGGATTTGAGGGTGTTCCTGGCGGGCGGGTTGAATCCCGAGAACGTGGCCGCGGCGGTGACGGCGCTTGGC
CAGCTTGGAGAGCGAGTGCTGGGCGTCGACGTCAGCAGCGGAGTCGAGGAGGATGGGAAGCAGAGCTTGGCCAAG
ATAAAGGCCTTTGTCGAGGCGGCCAAGGCGATTCGATAG
Gene >Ophun1|792
ATGCCGTCTTCTCTCGATATCATCGATCACTCTCCCCATCAGCCGGAGCCGTCACCTCCAATCCCTACGGCGTCC
AACCTGATCCTGATCGACAACTACGACTCCTTCACCTGGAACATCTATCAGTACCTCGTCCTCGAGGGAGCTACC
GTTCATGTCTTCCGTAACGATCAGATCAGCTTGCAGGAGCTCATCAGCAAGAACCCAACGCAGCTCATCATCAGC
CCCGGCCCAGGCCATCCCACGACCGACTCGGGCATCAGCCGAGATGCCATCCGCCACTTTGCGGGAAAGATCCCC
GTTTTTGGCGTCTGCATGGGCCTGTGAGCTTCTCCCGCCGTCTTTCGGGCTGGCCACTCACGCTTGTCAGGCAAT
GCATCTTTGATGTTTACGGCGGGGACGTCAACTCTGCCGGAGAGTGGCTGCACGGCAAAACGTCGCCCCTGACGC
ACGATAGCAGGGGTGTCTTTGCCGGTCTGGAGCAGAATCTACCGGTGACGAGATATCACTCCCTCGCGGGCACTC
ACGTCACATTGCCGGACTGCCTGGAGATTACTTCGTGGGTTGCCAAGGCTGACGGCTCGCCAGGCATCATCCAGG
GTGTCCGTCACAAGCAGCTCACTGTCGAGGGGGTTCAGTTTCACCCAGAGAGTATCCTCACGTCTCAGGGACGAA
GAATGATACGCAACTTTCTGCACATGCAAGGGGGCACCTGGGCGGAAAACGAGAAGCTGCAGAAAGCCGCGCCGC
TCAACGGTCCCCCCATTGCGCAGGACAAGGCAAAGGGCAACAACATACTGCAGCGGATATACGCCAGCCGCAGGG
CTGCCGTTGCCGCCCAAAAGGAGATTCCCTCACAACGGATGGCCGATTTACTGGCAGCCTATCGCCTCAACGCGG
CGCCTCCTCTTGTTCCGCTGGTGAGGCGTCTACGGCAGTCGCCTTTTGACGTGGCTCTCATGGCCGAGATCAAGC
GTGCGTCCCCTTCAAAGGGCGTGTTTGCGCTCGACATGGACGCTCCGACTCAGGCGCGCAAGTACGCCTTGGCCG
GAGCCAGCGTCATCTCAGTCCTCACAGAGCCGGAATGGTTCAAGGGGAGCATTGAGGATCTGCGCTCCGTCCGCC
AGGTGCTGGACGGGATGCCCAATAGGCCAGCTATTCTACGCAAGGAGTTCATCTTTGACGAGTACCAGATCCTGG
AGGCCAGACTTGCAGGCGCCGACACCGTCTTGCTCATCGTCAAGATGCTGGAGCCGGAAGCTCTCAAGCGCCTCT
ACGAATACTCGCTGTCGCTGGGGATGGAGCCGCTCGTCGAGGTTCAAAACGGCCAAGAGATGACGACGGCCGTCG
AGTTGGGATCCAGGGTCATCGGCGTCAACAACCGCAACCTGGAGAGCTTCGAAGTCGATCTCGATACCACAGGCC
GGCTGAGGGGCATGGTGCCGGAGGGCACACTGCTCTGCGCTCTCAGCGGCATCAACAGCCACAAAGACGTGCTGA
TGAACAAGAGAGATGGAGTCAACGCAGTCCTCGTCGGCGAGGCCATCATGCGAGCGCCGGACGCCGGCGTCTTCA
TCAGCGAGCTCTGCTCAGGCACGAAACAGGCAGCCGGGACGCAGCCTCCCAAAGCACCGCTCTTCGTCAAGATCT
GCGGAACGCGGTCGGTGGAGGCCGCGCACGAGGCCATCAAGTCCAAGGCCGACTTTATTGGCATCTGCCTGGTGC
CCGGAGCGAAGCGCTGTATCAGCCACGAGACGGCACTCGGGATTTCTGACGCTGTTCATTCGTGCTCAGGAACTA
CTTCTGAGGCGCGAGGACAGATGTCCAGCTCCAGCGCGACAGATTACTTTACGGCCGCCGGCTGGAGACTCGAAA
GTCACCGGCCTCGTCTGGTAGGCATCTTCCAGAACCAGCCGCTGAGCGAGGTACTGCAGATGCAAAGAACCTACC
AGCTCGACGTCGTTCAACTCCACGGAGACGAGCCCATCGAGTGGTCGAGGCAAATTCCCGTGCCGGTGATCCGCT
GCTTCAAGCCAGGCCAAGTCGGCATCGGCCTCCGCGGCTACCACACCATCCCGCTCCTCGACTCCGGCTCCGGCT
CAGGCAAGCTCCTAGACGTGTCGAGCGTCCGGGCCGCGCTGGAGACGGACCCGGATTTGAGGGTGTTCCTGGCGG
GCGGGTTGAATCCCGAGAACGTGGCCGCGGCGGTGACGGCGCTTGGCCAGCTTGGAGAGCGAGTGCTGGGCGTCG
ACGTCAGCAGCGGAGTCGAGGAGGATGGGAAGCAGAGCTTGGCCAAGATAAAGGCCTTTGTCGAGGCGGCCAAGG
CGATTCGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail