Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|787
Gene name
LocationContig_127:27500..30308
Strand+
Gene length (bp)2808
Transcript length (bp)2751
Coding sequence length (bp)2751
Protein length (aa) 917

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01055 Glyco_hydro_31 Glycosyl hydrolases family 31 9.8E-156 239 793
PF16863 NtCtMGAM_N N-terminal barrel of NtMGAM and CtMGAM, maltase-glucoamylase 7.7E-39 35 147
PF13802 Gal_mutarotas_2 Galactose mutarotase-like 1.1E-15 149 212

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2UQV7|AGDC_ASPOR Probable alpha/beta-glucosidase agdC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=agdC PE=3 SV=1 21 887 0.0E+00
sp|B8MZ41|AGDC_ASPFN Probable alpha/beta-glucosidase agdC OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=agdC PE=3 SV=1 21 887 0.0E+00
sp|Q0CMA7|AGDC_ASPTN Probable alpha/beta-glucosidase agdC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=agdC PE=3 SV=1 15 881 0.0E+00
sp|Q4WRH9|AGDC_ASPFU Probable alpha/beta-glucosidase agdC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=agdC PE=3 SV=1 21 908 0.0E+00
sp|B0XNL6|AGDC_ASPFC Probable alpha/beta-glucosidase agdC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=agdC PE=3 SV=1 21 908 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2UQV7|AGDC_ASPOR Probable alpha/beta-glucosidase agdC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=agdC PE=3 SV=1 21 887 0.0E+00
sp|B8MZ41|AGDC_ASPFN Probable alpha/beta-glucosidase agdC OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=agdC PE=3 SV=1 21 887 0.0E+00
sp|Q0CMA7|AGDC_ASPTN Probable alpha/beta-glucosidase agdC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=agdC PE=3 SV=1 15 881 0.0E+00
sp|Q4WRH9|AGDC_ASPFU Probable alpha/beta-glucosidase agdC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=agdC PE=3 SV=1 21 908 0.0E+00
sp|B0XNL6|AGDC_ASPFC Probable alpha/beta-glucosidase agdC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=agdC PE=3 SV=1 21 908 0.0E+00
sp|A1CNK4|AGDC_ASPCL Probable alpha/beta-glucosidase agdC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=agdC PE=3 SV=1 20 861 0.0E+00
sp|A1D1E6|AGDC_NEOFI Probable alpha/beta-glucosidase agdC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=agdC PE=3 SV=1 21 863 0.0E+00
sp|Q5AWI5|AGDC_EMENI Alpha/beta-glucosidase agdC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=agdC PE=2 SV=2 18 876 0.0E+00
sp|D4B0X3|AGD1_ARTBC Probable alpha/beta-glucosidase ARB_02101 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02101 PE=1 SV=1 2 907 0.0E+00
sp|Q92442|AGLU_MUCJA Alpha-glucosidase OS=Mucor javanicus PE=1 SV=1 6 836 2.0E-180
sp|Q9C0Y4|AGLU_SCHPO Alpha-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=agl1 PE=1 SV=2 21 876 5.0E-179
sp|O74254|AMYG_CANAL Glucoamylase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GAM1 PE=1 SV=2 16 883 1.0E-171
sp|Q9URX4|YFZB_SCHPO Uncharacterized family 31 glucosidase C1039.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.11c PE=3 SV=1 19 876 2.0E-171
sp|Q09901|YAJ1_SCHPO Uncharacterized family 31 glucosidase C30D11.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC30D11.01c PE=3 SV=2 20 835 3.0E-166
sp|P56526|AGLU_ASPNG Alpha-glucosidase OS=Aspergillus niger GN=aglA PE=1 SV=1 14 838 2.0E-164
sp|P22861|AMYG_SCHOC Glucoamylase 1 OS=Schwanniomyces occidentalis GN=GAM1 PE=1 SV=1 9 909 3.0E-155
sp|Q12558|AGLU_ASPOR Alpha-glucosidase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=agdA PE=2 SV=1 14 837 2.0E-152
sp|Q9S7Y7|XYL1_ARATH Alpha-xylosidase 1 OS=Arabidopsis thaliana GN=XYL1 PE=1 SV=1 22 833 4.0E-143
sp|P29064|AGLU_CANTS Alpha-glucosidase OS=Candida tsukubaensis PE=1 SV=1 21 878 2.0E-135
sp|O04893|AGLU_SPIOL Alpha-glucosidase OS=Spinacia oleracea PE=1 SV=1 23 832 2.0E-112
sp|Q653V7|AGLU_ORYSJ Probable alpha-glucosidase Os06g0675700 OS=Oryza sativa subsp. japonica GN=Os06g0675700 PE=1 SV=1 53 435 7.0E-95
sp|Q43763|AGLU_HORVU Alpha-glucosidase OS=Hordeum vulgare PE=2 SV=1 53 435 2.0E-85
sp|O04931|AGLU_BETVU Alpha-glucosidase OS=Beta vulgaris PE=1 SV=1 23 430 8.0E-84
sp|P70699|LYAG_MOUSE Lysosomal alpha-glucosidase OS=Mus musculus GN=Gaa PE=1 SV=2 24 423 1.0E-78
sp|F4J6T7|XYL2_ARATH Putative alpha-xylosidase 2 OS=Arabidopsis thaliana GN=XYL2 PE=5 SV=1 22 420 3.0E-76
sp|Q6P7A9|LYAG_RAT Lysosomal alpha-glucosidase OS=Rattus norvegicus GN=Gaa PE=2 SV=1 24 423 5.0E-76
sp|P10253|LYAG_HUMAN Lysosomal alpha-glucosidase OS=Homo sapiens GN=GAA PE=1 SV=4 50 423 4.0E-74
sp|Q5R7A9|LYAG_PONAB Lysosomal alpha-glucosidase OS=Pongo abelii GN=GAA PE=2 SV=1 50 423 1.0E-73
sp|Q9MYM4|LYAG_BOVIN Lysosomal alpha-glucosidase OS=Bos taurus GN=GAA PE=2 SV=1 50 423 2.0E-72
sp|Q653V7|AGLU_ORYSJ Probable alpha-glucosidase Os06g0675700 OS=Oryza sativa subsp. japonica GN=Os06g0675700 PE=1 SV=1 514 834 8.0E-67
sp|Q43763|AGLU_HORVU Alpha-glucosidase OS=Hordeum vulgare PE=2 SV=1 529 849 3.0E-62
sp|O62653|SUIS_SUNMU Sucrase-isomaltase, intestinal OS=Suncus murinus GN=SI PE=2 SV=3 23 423 3.0E-62
sp|P07768|SUIS_RABIT Sucrase-isomaltase, intestinal OS=Oryctolagus cuniculus GN=SI PE=1 SV=3 23 423 1.0E-61
sp|O43451|MGA_HUMAN Maltase-glucoamylase, intestinal OS=Homo sapiens GN=MGAM PE=1 SV=5 28 423 8.0E-61
sp|P23739|SUIS_RAT Sucrase-isomaltase, intestinal OS=Rattus norvegicus GN=Si PE=1 SV=5 23 423 1.0E-58
sp|Q2M2H8|MGAL_HUMAN Probable maltase-glucoamylase 2 OS=Homo sapiens GN=MGAM2 PE=2 SV=3 23 426 2.0E-58
sp|P07768|SUIS_RABIT Sucrase-isomaltase, intestinal OS=Oryctolagus cuniculus GN=SI PE=1 SV=3 553 857 1.0E-57
sp|P23739|SUIS_RAT Sucrase-isomaltase, intestinal OS=Rattus norvegicus GN=Si PE=1 SV=5 24 450 1.0E-57
sp|Q2M2H8|MGAL_HUMAN Probable maltase-glucoamylase 2 OS=Homo sapiens GN=MGAM2 PE=2 SV=3 19 423 1.0E-57
sp|P07768|SUIS_RABIT Sucrase-isomaltase, intestinal OS=Oryctolagus cuniculus GN=SI PE=1 SV=3 24 423 2.0E-57
sp|O43451|MGA_HUMAN Maltase-glucoamylase, intestinal OS=Homo sapiens GN=MGAM PE=1 SV=5 24 454 4.0E-57
sp|P14410|SUIS_HUMAN Sucrase-isomaltase, intestinal OS=Homo sapiens GN=SI PE=1 SV=6 23 423 8.0E-57
sp|O04931|AGLU_BETVU Alpha-glucosidase OS=Beta vulgaris PE=1 SV=1 507 836 1.0E-56
sp|P14410|SUIS_HUMAN Sucrase-isomaltase, intestinal OS=Homo sapiens GN=SI PE=1 SV=6 501 857 4.0E-56
sp|P14410|SUIS_HUMAN Sucrase-isomaltase, intestinal OS=Homo sapiens GN=SI PE=1 SV=6 24 423 8.0E-56
sp|Q6P7A9|LYAG_RAT Lysosomal alpha-glucosidase OS=Rattus norvegicus GN=Gaa PE=2 SV=1 546 851 1.0E-55
sp|P70699|LYAG_MOUSE Lysosomal alpha-glucosidase OS=Mus musculus GN=Gaa PE=1 SV=2 501 850 2.0E-55
sp|O43451|MGA_HUMAN Maltase-glucoamylase, intestinal OS=Homo sapiens GN=MGAM PE=1 SV=5 553 836 2.0E-55
sp|Q9MYM4|LYAG_BOVIN Lysosomal alpha-glucosidase OS=Bos taurus GN=GAA PE=2 SV=1 546 835 6.0E-54
sp|P23739|SUIS_RAT Sucrase-isomaltase, intestinal OS=Rattus norvegicus GN=Si PE=1 SV=5 553 901 8.0E-54
sp|P10253|LYAG_HUMAN Lysosomal alpha-glucosidase OS=Homo sapiens GN=GAA PE=1 SV=4 533 883 4.0E-53
sp|Q5R7A9|LYAG_PONAB Lysosomal alpha-glucosidase OS=Pongo abelii GN=GAA PE=2 SV=1 546 836 4.0E-53
sp|O43451|MGA_HUMAN Maltase-glucoamylase, intestinal OS=Homo sapiens GN=MGAM PE=1 SV=5 534 836 7.0E-52
sp|P07768|SUIS_RABIT Sucrase-isomaltase, intestinal OS=Oryctolagus cuniculus GN=SI PE=1 SV=3 534 849 1.0E-51
sp|P14410|SUIS_HUMAN Sucrase-isomaltase, intestinal OS=Homo sapiens GN=SI PE=1 SV=6 534 856 3.0E-50
sp|O62653|SUIS_SUNMU Sucrase-isomaltase, intestinal OS=Suncus murinus GN=SI PE=2 SV=3 24 449 6.0E-50
sp|Q2M2H8|MGAL_HUMAN Probable maltase-glucoamylase 2 OS=Homo sapiens GN=MGAM2 PE=2 SV=3 538 848 1.0E-49
sp|F4J6T7|XYL2_ARATH Putative alpha-xylosidase 2 OS=Arabidopsis thaliana GN=XYL2 PE=5 SV=1 532 833 1.0E-48
sp|O62653|SUIS_SUNMU Sucrase-isomaltase, intestinal OS=Suncus murinus GN=SI PE=2 SV=3 534 836 1.0E-47
sp|Q2M2H8|MGAL_HUMAN Probable maltase-glucoamylase 2 OS=Homo sapiens GN=MGAM2 PE=2 SV=3 501 836 5.0E-47
sp|O62653|SUIS_SUNMU Sucrase-isomaltase, intestinal OS=Suncus murinus GN=SI PE=2 SV=3 501 857 1.0E-45
sp|Q8BHN3|GANAB_MOUSE Neutral alpha-glucosidase AB OS=Mus musculus GN=Ganab PE=1 SV=1 539 899 2.0E-43
sp|Q8BVW0|GANC_MOUSE Neutral alpha-glucosidase C OS=Mus musculus GN=Ganc PE=1 SV=2 539 883 3.0E-42
sp|Q14697|GANAB_HUMAN Neutral alpha-glucosidase AB OS=Homo sapiens GN=GANAB PE=1 SV=3 539 899 8.0E-42
sp|Q9F234|AGL2_BACTQ Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens PE=3 SV=1 150 422 8.0E-41
sp|P79403|GANAB_PIG Neutral alpha-glucosidase AB OS=Sus scrofa GN=GANAB PE=1 SV=1 539 899 2.0E-40
sp|Q4R4N7|GANAB_MACFA Neutral alpha-glucosidase AB OS=Macaca fascicularis GN=GANAB PE=2 SV=1 539 899 2.0E-40
sp|Q9BE70|GANC_MACFA Neutral alpha-glucosidase C (Fragment) OS=Macaca fascicularis GN=GANC PE=2 SV=2 537 866 3.0E-40
sp|Q8TET4|GANC_HUMAN Neutral alpha-glucosidase C OS=Homo sapiens GN=GANC PE=2 SV=3 537 855 8.0E-40
sp|Q94502|GANAB_DICDI Neutral alpha-glucosidase AB OS=Dictyostelium discoideum GN=modA PE=3 SV=1 539 896 1.0E-39
sp|B9F676|GLU2A_ORYSJ Probable glucan 1,3-alpha-glucosidase OS=Oryza sativa subsp. japonica GN=Os03g0216600 PE=3 SV=1 514 836 2.0E-39
sp|Q9US55|GLU2A_SCHPO Glucosidase 2 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gls2 PE=3 SV=1 539 916 7.0E-39
sp|O00906|AGLU_TETPY Lysosomal acid alpha-glucosidase OS=Tetrahymena pyriformis PE=1 SV=1 67 423 4.0E-38
sp|Q9FN05|PSL5_ARATH Probable glucan 1,3-alpha-glucosidase OS=Arabidopsis thaliana GN=PSL5 PE=1 SV=1 539 856 1.0E-37
sp|P38138|GLU2A_YEAST Glucosidase 2 subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROT2 PE=1 SV=1 539 835 2.0E-37
sp|P23739|SUIS_RAT Sucrase-isomaltase, intestinal OS=Rattus norvegicus GN=Si PE=1 SV=5 550 856 5.0E-37
sp|O00906|AGLU_TETPY Lysosomal acid alpha-glucosidase OS=Tetrahymena pyriformis PE=1 SV=1 553 823 4.0E-35
sp|Q9BE70|GANC_MACFA Neutral alpha-glucosidase C (Fragment) OS=Macaca fascicularis GN=GANC PE=2 SV=2 150 422 2.0E-34
sp|Q9F234|AGL2_BACTQ Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens PE=3 SV=1 515 835 1.0E-33
sp|Q8TET4|GANC_HUMAN Neutral alpha-glucosidase C OS=Homo sapiens GN=GANC PE=2 SV=3 150 422 1.0E-33
sp|Q8BVW0|GANC_MOUSE Neutral alpha-glucosidase C OS=Mus musculus GN=Ganc PE=1 SV=2 150 422 6.0E-33
sp|Q8BHN3|GANAB_MOUSE Neutral alpha-glucosidase AB OS=Mus musculus GN=Ganab PE=1 SV=1 119 422 2.0E-31
sp|P79403|GANAB_PIG Neutral alpha-glucosidase AB OS=Sus scrofa GN=GANAB PE=1 SV=1 119 422 7.0E-31
sp|Q14697|GANAB_HUMAN Neutral alpha-glucosidase AB OS=Homo sapiens GN=GANAB PE=1 SV=3 119 422 1.0E-29
sp|Q4R4N7|GANAB_MACFA Neutral alpha-glucosidase AB OS=Macaca fascicularis GN=GANAB PE=2 SV=1 119 422 2.0E-29
sp|B3PEE6|OL4AG_CELJU Oligosaccharide 4-alpha-D-glucosyltransferase OS=Cellvibrio japonicus (strain Ueda107) GN=agd31B PE=1 SV=1 477 855 9.0E-29
sp|Q9FN05|PSL5_ARATH Probable glucan 1,3-alpha-glucosidase OS=Arabidopsis thaliana GN=PSL5 PE=1 SV=1 84 422 2.0E-27
sp|P0CD66|AGLU_SULSO Alpha-glucosidase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=malA PE=1 SV=1 110 423 6.0E-27
sp|D0KQM8|AGLU_SULS9 Alpha-glucosidase OS=Sulfolobus solfataricus (strain 98/2) GN=malA PE=1 SV=1 110 423 6.0E-27
sp|B9F676|GLU2A_ORYSJ Probable glucan 1,3-alpha-glucosidase OS=Oryza sativa subsp. japonica GN=Os03g0216600 PE=3 SV=1 155 422 1.0E-25
sp|Q9US55|GLU2A_SCHPO Glucosidase 2 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gls2 PE=3 SV=1 151 422 1.0E-25
sp|Q94502|GANAB_DICDI Neutral alpha-glucosidase AB OS=Dictyostelium discoideum GN=modA PE=3 SV=1 150 422 9.0E-23
sp|P38138|GLU2A_YEAST Glucosidase 2 subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROT2 PE=1 SV=1 151 422 1.0E-22
sp|P0CD66|AGLU_SULSO Alpha-glucosidase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=malA PE=1 SV=1 581 794 2.0E-17
sp|D0KQM8|AGLU_SULS9 Alpha-glucosidase OS=Sulfolobus solfataricus (strain 98/2) GN=malA PE=1 SV=1 581 794 2.0E-17
sp|Q9P999|XYLS_SULSO Alpha-xylosidase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=xylS PE=1 SV=1 553 883 5.0E-16
sp|Q5AW25|AGDD_EMENI Alpha-xylosidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=agdD PE=1 SV=1 556 794 6.0E-16
sp|P32138|YIHQ_ECOLI Alpha-glucosidase YihQ OS=Escherichia coli (strain K12) GN=yihQ PE=1 SV=3 542 768 8.0E-13
sp|A7LXT0|GH31A_BACO1 Alpha-xylosidase BoGH31A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / NCTC 11153) GN=BACOVA_02646 PE=1 SV=1 502 857 3.0E-11
sp|P31434|XYLS_ECOLI Alpha-xylosidase OS=Escherichia coli (strain K12) GN=yicI PE=1 SV=2 93 421 7.0E-11
sp|P31434|XYLS_ECOLI Alpha-xylosidase OS=Escherichia coli (strain K12) GN=yicI PE=1 SV=2 540 793 6.0E-10
sp|Q01336|YCR2_ESCVU Uncharacterized family 31 glucosidase ORF2 (Fragment) OS=Escherichia vulneris PE=3 SV=1 139 422 3.0E-06
sp|Q9P999|XYLS_SULSO Alpha-xylosidase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=xylS PE=1 SV=1 151 425 4.0E-06
sp|Q5AW25|AGDD_EMENI Alpha-xylosidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=agdD PE=1 SV=1 151 420 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|787
MRTWSTFFFFATAAASGLDACRGYEASHVSHTDSGLTASLRLLGQPCNAYGTDLDDLTLEVTHETDDRLHVKIQD
RANQVYQVPESVFPRPRGRSSRRQSKLKFRYTASPFSFQVLRAGSDEVLFDTSAASLVFQSQYLRLRTALPKDPY
LYGLGEHSDPFRLKTTNYTRTLWNADSYGVSGDTNQYGSHPFYLEQRQTGSHGVFLLNSNGMDIFINSTNDGKQY
LEYNTLGGILDFWFFSGPQPIAVAQQYGEVAGFPALQPYWGLGFHQCRYGYQDAYDVAEVVHNYSLADIPLETMW
TDIDYMDRRRTFSLDPKRFPLDMMRQLVTHLHNHDQHYVVMVDPAVAYQDYPPLRKGVDDDVFLRRDNGSLWLGV
VWPGVSVFPDWFASKTQEYWNGQIASFFSPTEGIDIDALWIDMNEPSNSMCPWPCDKPYEAARGMPPPAPPVRQP
PRPLPGWPCEFQPPGTCRSERATAAADVMPVTVLTPDTEGAPVRRSGGRIGDAKGLPGRNLLYPKYAIHNKMASQ
DSWNSDRGGLSNRTVHTDVHHQNGLVMYDTHNLFGSMMSTASREAMLARRPSKRPLIITRSTYAGAGSKVGHWLG
DNLSTWDMYRNSIRSMLVFTALFQFSMVGSDVCGFGQDTTEELCARWASLGAFSTFYRNHNEEGALAQEFYRWES
VAESARKAIAIRYRLLDYMYTAMRASSADGRPAVQPVFFLYPHDRLTWPLELQYFYGPALLVAPVTQRGATSVRV
YLPDDIFYDWYTHKPIRGDATEHTFTNQDLTTIPLLIRGGTIIPARLHPAMTTTQLRHQDFELLIALDAQGEAVG
ELYLDDGEALDPTHHHSLISFRYRHRDGLLSIDGSFDYPAQPPRVVKVTVMDAGAELKAGVRQHAAGESRLYSQS
HEVQLSLDRSRVVRVP*
Coding >Ophun1|787
ATGAGGACCTGGAGCACCTTTTTCTTCTTTGCCACTGCGGCCGCCAGTGGCCTCGATGCCTGCCGCGGCTACGAG
GCCTCCCATGTGAGCCATACCGACAGCGGCTTGACGGCCAGTCTGAGGCTTCTGGGCCAACCGTGTAATGCATAT
GGCACCGACTTGGATGACCTCACTCTTGAAGTCACGCATGAGACGGATGACCGCCTTCACGTCAAGATCCAGGAC
CGCGCCAACCAGGTCTACCAGGTCCCCGAATCCGTCTTCCCGCGTCCCAGAGGCCGCAGCTCACGACGCCAGAGC
AAGCTCAAGTTCAGATACACGGCCTCGCCCTTTTCCTTTCAGGTACTCCGCGCCGGATCCGACGAGGTACTCTTC
GACACGTCGGCAGCTTCGCTCGTGTTCCAGTCGCAGTATCTTCGTCTGCGGACCGCCCTTCCCAAGGACCCGTAT
CTTTATGGGCTCGGCGAACACTCAGATCCGTTCAGGCTGAAGACGACCAATTACACCCGGACGCTGTGGAACGCC
GACAGCTACGGCGTGTCGGGCGACACCAACCAATACGGCTCTCACCCCTTTTACCTCGAACAGCGCCAGACGGGC
TCCCATGGCGTCTTCCTGCTCAACTCCAACGGCATGGACATTTTCATCAACTCGACCAACGACGGGAAGCAGTAT
CTCGAGTACAACACGCTCGGCGGCATTCTTGATTTTTGGTTCTTCTCCGGCCCCCAGCCCATCGCCGTCGCTCAG
CAGTACGGCGAGGTGGCAGGCTTTCCGGCCTTGCAACCGTACTGGGGCCTGGGCTTCCACCAGTGCCGCTACGGC
TATCAGGATGCCTACGACGTGGCCGAGGTCGTCCACAACTACAGCCTGGCCGATATCCCGCTCGAGACCATGTGG
ACTGACATTGACTACATGGATCGCCGGCGCACTTTTTCTCTCGACCCGAAGCGCTTCCCTCTCGACATGATGCGC
CAGCTCGTCACCCATCTTCACAACCACGACCAGCACTACGTCGTCATGGTCGACCCGGCCGTGGCTTATCAGGAC
TATCCGCCGCTGCGCAAGGGCGTTGATGATGACGTCTTCCTCCGGCGCGATAACGGCTCCCTCTGGCTGGGCGTC
GTGTGGCCGGGCGTGTCCGTGTTCCCTGACTGGTTCGCCAGCAAGACGCAAGAGTACTGGAACGGCCAAATCGCG
TCCTTCTTCAGCCCGACCGAGGGCATCGACATTGACGCGCTGTGGATCGACATGAACGAGCCCAGCAACTCCATG
TGTCCCTGGCCCTGCGATAAGCCTTACGAGGCGGCTCGAGGGATGCCGCCGCCGGCTCCTCCCGTGCGTCAACCG
CCGCGACCGCTGCCCGGCTGGCCTTGCGAGTTCCAGCCGCCGGGAACGTGCAGGTCCGAGAGGGCGACGGCGGCG
GCCGACGTGATGCCCGTGACGGTGCTGACACCGGACACCGAGGGCGCTCCGGTCCGACGATCCGGGGGCCGGATC
GGAGACGCAAAGGGGCTCCCGGGCCGGAACCTGCTGTATCCCAAGTACGCCATCCACAACAAGATGGCCTCTCAA
GACTCGTGGAACTCGGATCGCGGCGGCCTTTCGAACCGCACCGTCCACACCGACGTTCACCATCAGAACGGACTC
GTCATGTACGACACTCACAACCTGTTCGGGTCCATGATGTCGACAGCCTCGCGCGAGGCCATGCTGGCTCGACGA
CCGAGCAAGCGACCGCTCATCATCACACGCAGCACTTACGCCGGAGCGGGCTCCAAGGTCGGCCACTGGCTGGGC
GACAACCTCTCGACATGGGACATGTATCGGAACTCGATCCGCTCCATGCTCGTCTTCACTGCCCTCTTCCAGTTC
TCCATGGTCGGCTCCGACGTCTGCGGCTTCGGCCAAGACACGACCGAAGAGCTGTGCGCGCGCTGGGCCTCTCTC
GGTGCCTTTTCCACCTTTTACCGCAACCACAACGAGGAGGGCGCGCTGGCACAGGAGTTTTACCGCTGGGAGAGC
GTGGCAGAGAGCGCCCGCAAGGCCATCGCCATCCGCTACCGTCTGCTCGACTACATGTACACCGCCATGCGGGCC
TCGAGCGCAGACGGCAGACCCGCCGTCCAGCCCGTCTTCTTCCTCTACCCGCACGACCGCCTCACCTGGCCCCTT
GAGCTGCAGTACTTTTACGGCCCGGCTCTCCTGGTGGCTCCCGTGACGCAAAGGGGCGCAACCAGCGTACGCGTC
TACCTCCCCGACGACATCTTCTACGACTGGTACACTCACAAGCCCATCCGCGGTGACGCCACAGAACACACCTTT
ACCAACCAAGACCTCACGACGATCCCCCTGCTCATCCGAGGCGGCACCATCATCCCCGCCCGTCTCCATCCAGCC
ATGACAACGACACAGCTTCGCCACCAGGACTTTGAGCTTCTCATCGCCCTAGACGCTCAAGGCGAAGCCGTCGGA
GAACTCTACCTCGACGACGGCGAGGCCCTCGACCCAACCCACCACCACTCCCTCATCTCCTTCCGCTACCGCCAC
CGCGACGGCCTCCTCTCCATAGACGGCTCCTTCGACTATCCCGCCCAACCGCCCCGCGTCGTAAAGGTCACCGTC
ATGGACGCCGGTGCGGAGCTCAAGGCCGGGGTTCGCCAGCATGCCGCCGGCGAGTCGCGCTTGTATAGCCAGAGC
CATGAGGTGCAGCTTTCGCTTGATCGGTCGCGTGTCGTTCGCGTGCCTTGA
Transcript >Ophun1|787
ATGAGGACCTGGAGCACCTTTTTCTTCTTTGCCACTGCGGCCGCCAGTGGCCTCGATGCCTGCCGCGGCTACGAG
GCCTCCCATGTGAGCCATACCGACAGCGGCTTGACGGCCAGTCTGAGGCTTCTGGGCCAACCGTGTAATGCATAT
GGCACCGACTTGGATGACCTCACTCTTGAAGTCACGCATGAGACGGATGACCGCCTTCACGTCAAGATCCAGGAC
CGCGCCAACCAGGTCTACCAGGTCCCCGAATCCGTCTTCCCGCGTCCCAGAGGCCGCAGCTCACGACGCCAGAGC
AAGCTCAAGTTCAGATACACGGCCTCGCCCTTTTCCTTTCAGGTACTCCGCGCCGGATCCGACGAGGTACTCTTC
GACACGTCGGCAGCTTCGCTCGTGTTCCAGTCGCAGTATCTTCGTCTGCGGACCGCCCTTCCCAAGGACCCGTAT
CTTTATGGGCTCGGCGAACACTCAGATCCGTTCAGGCTGAAGACGACCAATTACACCCGGACGCTGTGGAACGCC
GACAGCTACGGCGTGTCGGGCGACACCAACCAATACGGCTCTCACCCCTTTTACCTCGAACAGCGCCAGACGGGC
TCCCATGGCGTCTTCCTGCTCAACTCCAACGGCATGGACATTTTCATCAACTCGACCAACGACGGGAAGCAGTAT
CTCGAGTACAACACGCTCGGCGGCATTCTTGATTTTTGGTTCTTCTCCGGCCCCCAGCCCATCGCCGTCGCTCAG
CAGTACGGCGAGGTGGCAGGCTTTCCGGCCTTGCAACCGTACTGGGGCCTGGGCTTCCACCAGTGCCGCTACGGC
TATCAGGATGCCTACGACGTGGCCGAGGTCGTCCACAACTACAGCCTGGCCGATATCCCGCTCGAGACCATGTGG
ACTGACATTGACTACATGGATCGCCGGCGCACTTTTTCTCTCGACCCGAAGCGCTTCCCTCTCGACATGATGCGC
CAGCTCGTCACCCATCTTCACAACCACGACCAGCACTACGTCGTCATGGTCGACCCGGCCGTGGCTTATCAGGAC
TATCCGCCGCTGCGCAAGGGCGTTGATGATGACGTCTTCCTCCGGCGCGATAACGGCTCCCTCTGGCTGGGCGTC
GTGTGGCCGGGCGTGTCCGTGTTCCCTGACTGGTTCGCCAGCAAGACGCAAGAGTACTGGAACGGCCAAATCGCG
TCCTTCTTCAGCCCGACCGAGGGCATCGACATTGACGCGCTGTGGATCGACATGAACGAGCCCAGCAACTCCATG
TGTCCCTGGCCCTGCGATAAGCCTTACGAGGCGGCTCGAGGGATGCCGCCGCCGGCTCCTCCCGTGCGTCAACCG
CCGCGACCGCTGCCCGGCTGGCCTTGCGAGTTCCAGCCGCCGGGAACGTGCAGGTCCGAGAGGGCGACGGCGGCG
GCCGACGTGATGCCCGTGACGGTGCTGACACCGGACACCGAGGGCGCTCCGGTCCGACGATCCGGGGGCCGGATC
GGAGACGCAAAGGGGCTCCCGGGCCGGAACCTGCTGTATCCCAAGTACGCCATCCACAACAAGATGGCCTCTCAA
GACTCGTGGAACTCGGATCGCGGCGGCCTTTCGAACCGCACCGTCCACACCGACGTTCACCATCAGAACGGACTC
GTCATGTACGACACTCACAACCTGTTCGGGTCCATGATGTCGACAGCCTCGCGCGAGGCCATGCTGGCTCGACGA
CCGAGCAAGCGACCGCTCATCATCACACGCAGCACTTACGCCGGAGCGGGCTCCAAGGTCGGCCACTGGCTGGGC
GACAACCTCTCGACATGGGACATGTATCGGAACTCGATCCGCTCCATGCTCGTCTTCACTGCCCTCTTCCAGTTC
TCCATGGTCGGCTCCGACGTCTGCGGCTTCGGCCAAGACACGACCGAAGAGCTGTGCGCGCGCTGGGCCTCTCTC
GGTGCCTTTTCCACCTTTTACCGCAACCACAACGAGGAGGGCGCGCTGGCACAGGAGTTTTACCGCTGGGAGAGC
GTGGCAGAGAGCGCCCGCAAGGCCATCGCCATCCGCTACCGTCTGCTCGACTACATGTACACCGCCATGCGGGCC
TCGAGCGCAGACGGCAGACCCGCCGTCCAGCCCGTCTTCTTCCTCTACCCGCACGACCGCCTCACCTGGCCCCTT
GAGCTGCAGTACTTTTACGGCCCGGCTCTCCTGGTGGCTCCCGTGACGCAAAGGGGCGCAACCAGCGTACGCGTC
TACCTCCCCGACGACATCTTCTACGACTGGTACACTCACAAGCCCATCCGCGGTGACGCCACAGAACACACCTTT
ACCAACCAAGACCTCACGACGATCCCCCTGCTCATCCGAGGCGGCACCATCATCCCCGCCCGTCTCCATCCAGCC
ATGACAACGACACAGCTTCGCCACCAGGACTTTGAGCTTCTCATCGCCCTAGACGCTCAAGGCGAAGCCGTCGGA
GAACTCTACCTCGACGACGGCGAGGCCCTCGACCCAACCCACCACCACTCCCTCATCTCCTTCCGCTACCGCCAC
CGCGACGGCCTCCTCTCCATAGACGGCTCCTTCGACTATCCCGCCCAACCGCCCCGCGTCGTAAAGGTCACCGTC
ATGGACGCCGGTGCGGAGCTCAAGGCCGGGGTTCGCCAGCATGCCGCCGGCGAGTCGCGCTTGTATAGCCAGAGC
CATGAGGTGCAGCTTTCGCTTGATCGGTCGCGTGTCGTTCGCGTGCCTTGA
Gene >Ophun1|787
ATGAGGACCTGGAGCACCTTTTTCTTCTTTGCCACTGCGGCCGCCAGTGGCCTCGATGCCTGCCGCGGCTACGAG
GCCTCCCATGTGAGCCATACCGACAGCGGCTTGACGGCCAGTCTGAGGCTTCTGGGCCAACCGTGTAATGCATAT
GGCACCGACTTGGATGACCTCACTCTTGAAGTCACGCATGAGACGGGTGTGTATTCGTGATTTGCTCATTGTCGA
GTCCCGTAGATGGCTGACGGCGCATCAGATGACCGCCTTCACGTCAAGATCCAGGACCGCGCCAACCAGGTCTAC
CAGGTCCCCGAATCCGTCTTCCCGCGTCCCAGAGGCCGCAGCTCACGACGCCAGAGCAAGCTCAAGTTCAGATAC
ACGGCCTCGCCCTTTTCCTTTCAGGTACTCCGCGCCGGATCCGACGAGGTACTCTTCGACACGTCGGCAGCTTCG
CTCGTGTTCCAGTCGCAGTATCTTCGTCTGCGGACCGCCCTTCCCAAGGACCCGTATCTTTATGGGCTCGGCGAA
CACTCAGATCCGTTCAGGCTGAAGACGACCAATTACACCCGGACGCTGTGGAACGCCGACAGCTACGGCGTGTCG
GGCGACACCAACCAATACGGCTCTCACCCCTTTTACCTCGAACAGCGCCAGACGGGCTCCCATGGCGTCTTCCTG
CTCAACTCCAACGGCATGGACATTTTCATCAACTCGACCAACGACGGGAAGCAGTATCTCGAGTACAACACGCTC
GGCGGCATTCTTGATTTTTGGTTCTTCTCCGGCCCCCAGCCCATCGCCGTCGCTCAGCAGTACGGCGAGGTGGCA
GGCTTTCCGGCCTTGCAACCGTACTGGGGCCTGGGCTTCCACCAGTGCCGCTACGGCTATCAGGATGCCTACGAC
GTGGCCGAGGTCGTCCACAACTACAGCCTGGCCGATATCCCGCTCGAGACCATGTGGACTGACATTGACTACATG
GATCGCCGGCGCACTTTTTCTCTCGACCCGAAGCGCTTCCCTCTCGACATGATGCGCCAGCTCGTCACCCATCTT
CACAACCACGACCAGCACTACGTCGTCATGGTCGACCCGGCCGTGGCTTATCAGGACTATCCGCCGCTGCGCAAG
GGCGTTGATGATGACGTCTTCCTCCGGCGCGATAACGGCTCCCTCTGGCTGGGCGTCGTGTGGCCGGGCGTGTCC
GTGTTCCCTGACTGGTTCGCCAGCAAGACGCAAGAGTACTGGAACGGCCAAATCGCGTCCTTCTTCAGCCCGACC
GAGGGCATCGACATTGACGCGCTGTGGATCGACATGAACGAGCCCAGCAACTCCATGTGTCCCTGGCCCTGCGAT
AAGCCTTACGAGGCGGCTCGAGGGATGCCGCCGCCGGCTCCTCCCGTGCGTCAACCGCCGCGACCGCTGCCCGGC
TGGCCTTGCGAGTTCCAGCCGCCGGGAACGTGCAGGTCCGAGAGGGCGACGGCGGCGGCCGACGTGATGCCCGTG
ACGGTGCTGACACCGGACACCGAGGGCGCTCCGGTCCGACGATCCGGGGGCCGGATCGGAGACGCAAAGGGGCTC
CCGGGCCGGAACCTGCTGTATCCCAAGTACGCCATCCACAACAAGATGGCCTCTCAAGACTCGTGGAACTCGGAT
CGCGGCGGCCTTTCGAACCGCACCGTCCACACCGACGTTCACCATCAGAACGGACTCGTCATGTACGACACTCAC
AACCTGTTCGGGTCCATGATGTCGACAGCCTCGCGCGAGGCCATGCTGGCTCGACGACCGAGCAAGCGACCGCTC
ATCATCACACGCAGCACTTACGCCGGAGCGGGCTCCAAGGTCGGCCACTGGCTGGGCGACAACCTCTCGACATGG
GACATGTATCGGAACTCGATCCGCTCCATGCTCGTCTTCACTGCCCTCTTCCAGTTCTCCATGGTCGGCTCCGAC
GTCTGCGGCTTCGGCCAAGACACGACCGAAGAGCTGTGCGCGCGCTGGGCCTCTCTCGGTGCCTTTTCCACCTTT
TACCGCAACCACAACGAGGAGGGCGCGCTGGCACAGGAGTTTTACCGCTGGGAGAGCGTGGCAGAGAGCGCCCGC
AAGGCCATCGCCATCCGCTACCGTCTGCTCGACTACATGTACACCGCCATGCGGGCCTCGAGCGCAGACGGCAGA
CCCGCCGTCCAGCCCGTCTTCTTCCTCTACCCGCACGACCGCCTCACCTGGCCCCTTGAGCTGCAGTACTTTTAC
GGCCCGGCTCTCCTGGTGGCTCCCGTGACGCAAAGGGGCGCAACCAGCGTACGCGTCTACCTCCCCGACGACATC
TTCTACGACTGGTACACTCACAAGCCCATCCGCGGTGACGCCACAGAACACACCTTTACCAACCAAGACCTCACG
ACGATCCCCCTGCTCATCCGAGGCGGCACCATCATCCCCGCCCGTCTCCATCCAGCCATGACAACGACACAGCTT
CGCCACCAGGACTTTGAGCTTCTCATCGCCCTAGACGCTCAAGGCGAAGCCGTCGGAGAACTCTACCTCGACGAC
GGCGAGGCCCTCGACCCAACCCACCACCACTCCCTCATCTCCTTCCGCTACCGCCACCGCGACGGCCTCCTCTCC
ATAGACGGCTCCTTCGACTATCCCGCCCAACCGCCCCGCGTCGTAAAGGTCACCGTCATGGACGCCGGTGCGGAG
CTCAAGGCCGGGGTTCGCCAGCATGCCGCCGGCGAGTCGCGCTTGTATAGCCAGAGCCATGAGGTGCAGCTTTCG
CTTGATCGGTCGCGTGTCGTTCGCGTGCCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail