Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|773
Gene name
LocationContig_1269:1957..3132
Strand+
Gene length (bp)1175
Transcript length (bp)603
Coding sequence length (bp)603
Protein length (aa) 201

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17146 PIN_6 PIN domain of ribonuclease 4.6E-31 19 110
PF08772 NOB1_Zn_bind Nin one binding (NOB1) Zn-ribbon like 7.5E-30 127 193

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTK0|NOB1_SCHPO 20S-pre-rRNA D-site endonuclease nob1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nob1 PE=3 SV=1 113 191 3.0E-23
sp|Q9UTK0|NOB1_SCHPO 20S-pre-rRNA D-site endonuclease nob1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nob1 PE=3 SV=1 14 111 1.0E-14
sp|Q08444|NOB1_YEAST 20S-pre-rRNA D-site endonuclease NOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOB1 PE=1 SV=1 95 191 1.0E-14
sp|Q9UZ20|NOB1_PYRAB Endoribonuclease Nob1 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=nob1 PE=3 SV=1 44 161 8.0E-14
sp|Q3T042|NOB1_BOVIN RNA-binding protein NOB1 OS=Bos taurus GN=NOB1 PE=2 SV=1 113 198 4.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTK0|NOB1_SCHPO 20S-pre-rRNA D-site endonuclease nob1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nob1 PE=3 SV=1 113 191 3.0E-23
sp|Q9UTK0|NOB1_SCHPO 20S-pre-rRNA D-site endonuclease nob1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nob1 PE=3 SV=1 14 111 1.0E-14
sp|Q08444|NOB1_YEAST 20S-pre-rRNA D-site endonuclease NOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOB1 PE=1 SV=1 95 191 1.0E-14
sp|Q9UZ20|NOB1_PYRAB Endoribonuclease Nob1 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=nob1 PE=3 SV=1 44 161 8.0E-14
sp|Q3T042|NOB1_BOVIN RNA-binding protein NOB1 OS=Bos taurus GN=NOB1 PE=2 SV=1 113 198 4.0E-12
sp|Q4R537|NOB1_MACFA RNA-binding protein NOB1 OS=Macaca fascicularis GN=NOB1 PE=2 SV=1 113 198 5.0E-12
sp|Q8BW10|NOB1_MOUSE RNA-binding protein NOB1 OS=Mus musculus GN=Nob1 PE=1 SV=1 113 198 5.0E-12
sp|Q5RBB3|NOB1_PONAB RNA-binding protein NOB1 OS=Pongo abelii GN=NOB1 PE=2 SV=1 113 198 5.0E-12
sp|Q9ULX3|NOB1_HUMAN RNA-binding protein NOB1 OS=Homo sapiens GN=NOB1 PE=1 SV=1 113 198 6.0E-12
sp|Q6VEU1|NOB1_RAT RNA-binding protein NOB1 OS=Rattus norvegicus GN=Nob1 PE=2 SV=1 113 198 6.0E-12
sp|Q8BW10|NOB1_MOUSE RNA-binding protein NOB1 OS=Mus musculus GN=Nob1 PE=1 SV=1 15 112 3.0E-11
sp|Q6VEU1|NOB1_RAT RNA-binding protein NOB1 OS=Rattus norvegicus GN=Nob1 PE=2 SV=1 15 112 3.0E-11
sp|Q5RBB3|NOB1_PONAB RNA-binding protein NOB1 OS=Pongo abelii GN=NOB1 PE=2 SV=1 15 112 6.0E-11
sp|Q9ULX3|NOB1_HUMAN RNA-binding protein NOB1 OS=Homo sapiens GN=NOB1 PE=1 SV=1 15 112 6.0E-11
sp|P57674|VAPC1_THEAC Ribonuclease VapC1 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=vapC1 PE=3 SV=1 20 140 6.0E-11
sp|Q3T042|NOB1_BOVIN RNA-binding protein NOB1 OS=Bos taurus GN=NOB1 PE=2 SV=1 15 112 1.0E-10
sp|Q4R537|NOB1_MACFA RNA-binding protein NOB1 OS=Macaca fascicularis GN=NOB1 PE=2 SV=1 15 112 2.0E-10
sp|Q08444|NOB1_YEAST 20S-pre-rRNA D-site endonuclease NOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOB1 PE=1 SV=1 9 116 3.0E-10
sp|O29862|NOB1_ARCFU Endoribonuclease Nob1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=nob1 PE=3 SV=1 43 162 2.0E-09
sp|O58440|NOB1_PYRHO Endoribonuclease Nob1 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=nob1 PE=1 SV=1 44 161 9.0E-09
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1005
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3860
Ophiocordyceps australis map64 (Brazil) OphauB2|3217
Ophiocordyceps camponoti-floridani Ophcf2|01600
Ophiocordyceps camponoti-floridani Ophcf2|01601
Ophiocordyceps camponoti-rufipedis Ophun1|773 (this protein)
Ophiocordyceps kimflemingae Ophio5|7868
Ophiocordyceps subramaniannii Hirsu2|8667

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|773
MAEPTPDPTSNPPKPIHSLVLDTGPLIKNDPPVSVLLSKAEALYTIPSVLAEIRDQATRSRVETTLRPFLTVRTP
RAESFRFVQGFARKTGDLAVLSRPDLDVLALAYELESLRMNLNLVTPSLARITQLKSWILRCHGCFATTKQMDRQ
FCPSCGQPTLLRASCSTDQHGVFTVHLKKNFQWNKRGNVYSAGRTGGGVG*
Coding >Ophun1|773
ATGGCAGAGCCAACTCCAGATCCCACCTCCAATCCCCCCAAGCCCATCCACAGCCTCGTCCTCGACACAGGCCCA
TTGATAAAAAACGACCCTCCCGTCAGCGTCCTCCTGTCCAAGGCAGAAGCCCTCTACACCATCCCCTCGGTCCTC
GCCGAGATCCGCGACCAGGCGACGCGCTCCCGCGTCGAGACGACGCTCAGGCCCTTTCTCACCGTCCGGACGCCC
AGGGCAGAGAGCTTCCGGTTCGTGCAGGGGTTTGCAAGGAAGACGGGGGATTTGGCCGTGCTGAGTCGGCCGGAT
TTGGACGTCTTGGCTCTGGCGTATGAGCTTGAATCCCTCCGCATGAACCTCAACCTCGTCACCCCCTCCCTCGCC
CGCATCACCCAGCTGAAGAGCTGGATCCTCCGCTGCCACGGCTGCTTCGCAACCACCAAGCAAATGGACCGCCAG
TTCTGCCCCTCGTGCGGACAGCCCACCCTCCTGCGCGCCAGCTGCTCCACCGACCAGCACGGCGTCTTCACCGTC
CACCTCAAGAAGAACTTCCAGTGGAACAAGCGCGGCAACGTCTACAGCGCGGGAAGGACGGGTGGGGGCGTCGGC
TGA
Transcript >Ophun1|773
ATGGCAGAGCCAACTCCAGATCCCACCTCCAATCCCCCCAAGCCCATCCACAGCCTCGTCCTCGACACAGGCCCA
TTGATAAAAAACGACCCTCCCGTCAGCGTCCTCCTGTCCAAGGCAGAAGCCCTCTACACCATCCCCTCGGTCCTC
GCCGAGATCCGCGACCAGGCGACGCGCTCCCGCGTCGAGACGACGCTCAGGCCCTTTCTCACCGTCCGGACGCCC
AGGGCAGAGAGCTTCCGGTTCGTGCAGGGGTTTGCAAGGAAGACGGGGGATTTGGCCGTGCTGAGTCGGCCGGAT
TTGGACGTCTTGGCTCTGGCGTATGAGCTTGAATCCCTCCGCATGAACCTCAACCTCGTCACCCCCTCCCTCGCC
CGCATCACCCAGCTGAAGAGCTGGATCCTCCGCTGCCACGGCTGCTTCGCAACCACCAAGCAAATGGACCGCCAG
TTCTGCCCCTCGTGCGGACAGCCCACCCTCCTGCGCGCCAGCTGCTCCACCGACCAGCACGGCGTCTTCACCGTC
CACCTCAAGAAGAACTTCCAGTGGAACAAGCGCGGCAACGTCTACAGCGCGGGAAGGACGGGTGGGGGCGTCGGC
TGA
Gene >Ophun1|773
ATGGCAGAGCCAACTCCAGATCCCACCTCCAATCCCCCCAAGCCCATCCACAGCCTCGTCCTCGACACAGGCCCA
TTGATAAAAAACGACCCTCCCGTCAGCGTCCTCCTGTCCAAGGCAGAAGCCCTCTACACCATCCCCTCGGTCCTC
GCCGAGATCCGCGACCAGGCGACGCGCTCCCGCGTCGAGACGACGCTCAGGCCCTTTCTCACCGTCCGGACGCCC
AGGGCAGAGAGCTTCCGGTTCGTGCAGGGGTTTGCAAGGAAGACGGGGGATTTGGCCGTGCTGAGTCGGCCGGAT
TTGGACGTCTTGGCTCTGGCGTATGAGCTTGAATGTGAGCGCAATGGGGGGGATTGGAGGTTGAGGAGCGTGCCT
GGCCAGCGGGGCTTGAATGGTCGTCCTGGGTTGGCGGTGAAAGATGGTGGAGATTCCGCAGGTGGTGATGGGGAG
GGTGCTTCTGAGGAAGTCGTTGGCGATGTGGCGCCAGAGGTCTGCGTCTCTGATGGACTGGATGACTCTCACTCA
CGAAAGTCGCTGGAAACAACGATGCAACATCTAAGTCTGGGCGTCAAAGACACGCCGACAGGGAATGAAGCAGAT
GTTCTCGACAGACAGGTCCAAGACGGGACTGTCGAAGCCGCCTCCGGAGAGATTATCGAAACTTCAAAGGCACGC
AACGATCAGCAAGAGGAGACGCCCAAAGCACCAGCATCAGAAGAGACATACAACCAGCAAAACAACCCCCCCCAA
GACGAAGACTCCGACTCCGACTCCGGCNNCCCCCTCCCACCCCCCCTCCCAACCCCTCCCAGCCGCAGTGCTAAC
CTCAGACTACGCAATGCAAAACGTAGCCCTCCGCATGAACCTCAACCTCGTCACCCCCTCCCTCGCCCGCATCAC
CCAGCTGAAGAGCTGGATCCTCCGCTGCCACGGCTGCTTCGCAACCACCAAGCAAATGGACCGCCAGTTCTGCCC
CTCGTGCGGACAGCCCACCCTCCTGCGCGCCAGCTGCTCCACCGACCAGCACGGCGTCTTCACCGTCCACCTCAA
GAAGAACTTCCAGTGGAACAAGCGCGGCAACGTCTACAGCGTCCCCAAGCCCGTCCACGGCACCGCGGGGGGCGC
GGGTCCCGCGGGGACGGGAGGCGGGAAGGACGGGTGGGGGCGTCGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail